HHsearch alignment for GI: 255764515 and conserved domain: PRK13104

>PRK13104 secA preprotein translocase subunit SecA; Reviewed.
Probab=98.78  E-value=1.3e-05  Score=52.26  Aligned_cols=123  Identities=18%  Similarity=0.283  Sum_probs=69.4

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
T Consensus        79 lg~r~~dvQl~gg~~lh~g~iaEM~TGEGKTL~atlp-~ylnal~g~gvhvvTvNdYLA~RDae~m~~~y~~l---Gltv  154 (896)
T PRK13104         79 LGLRHFDVQLIGGMVLHEGNIAEMRTGEGKTLVATLP-AYLNAISGRGVHIVTVNDYLAKRDSQWMKPIYEFL---GLTV  154 (896)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             3897647999989998458514651788559999999-99987559971997265354464499999999981---9767


Q ss_pred             EEEEC--CHHHHHHHHCCCCCE-EEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--978988873077986-9980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVL-YVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i-~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
T Consensus       155 g~i~~~~~~~~r~~aY~~--DitY~Tn~e~gFDyLrDnm~~~~~~~vqr~~~~aivDEvDSi  214 (896)
T PRK13104        155 GVIYPDMSHKEKQEAYKA--DIVYGTNNEYGFDYLRDNMAFSLTDKVQRELNFAIVDEVDSI  214 (896)
T ss_pred             EEECCCCCHHHHHHHHCC--CEEEECCCCCCCCCCCCCHHCCHHHHCCCCCCEEEEECHHHH
T ss_conf             341899997999997149--937967865415235721113847625667764787422354