HHsearch alignment for GI: 255764515 and conserved domain: TIGR00631

>TIGR00631 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 All proteins in this family for which functions are known are DNA helicases that function in the nucleotide excision repair and are endonucleases that make the 3' incision next to DNA damage. They are part of a pathway requiring UvrA, UvrB, UvrC, and UvrD homologs.; GO: 0009381 excinuclease ABC activity, 0006289 nucleotide-excision repair, 0005737 cytoplasm, 0009380 excinuclease repair complex.
Probab=99.33  E-value=1.6e-10  Score=81.95  Aligned_cols=122  Identities=16%  Similarity=0.170  Sum_probs=80.6

Q ss_pred             CCHHHHHHC-CCCCEEEEHHHHHHHHHHHHHCC----------CCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCC
Q ss_conf             325665412-48840342223678886641000----------2653344589987642458855899844221116220
Q gi|255764515|r  310 KALEVIIEK-ANAAPIIVAYHFNSDLARLQKAF----------PQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNL  378 (458)
Q Consensus       310 ~~l~~il~~-~~~~kviif~~~~~~~~~i~~~~----------~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL  378 (458)
T Consensus       435 DL~~EI~~R~~~~ERvLVTTLTKkMAEdLTdYl~E~Gikv~YLHSeIdt~ER~eiirdLR~G~fDVLVG-INLLREGLDl  513 (667)
T TIGR00631       435 DLLSEIRQRVARNERVLVTTLTKKMAEDLTDYLKELGIKVRYLHSEIDTLERVEIIRDLRLGEFDVLVG-INLLREGLDL  513 (667)
T ss_pred             HHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCCEEEEE-CCHHHCCCCC
T ss_conf             889999999972894899820167788999997058837987145578999999999844788408860-0020024651


Q ss_pred             CCCCCEEEEEC-----CCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEE-EEEECCCHHHHHHHHHHHH
Q ss_conf             01785999908-----99898686445666620220203787752899-9985899689999999999
Q gi|255764515|r  379 QYGGNILVFFS-----LWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY-YLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       379 ~~a~~~iI~~~-----~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~-~li~~~tide~i~~~~~~K  440 (458)
T Consensus       514 PEVSLVAI-LDADKEGFLRSerSLIQTIGRAAR---N~~G---~VilYAD~iT-~sM~~AI~ET~RRR  573 (667)
T TIGR00631       514 PEVSLVAI-LDADKEGFLRSERSLIQTIGRAAR---NVNG---KVILYADKIT-DSMQKAIEETERRR  573 (667)
T ss_pred             HHHHHHHH-HCCCCCCCCCCCCHHHHHHHHHHH---CCCC---EEEEECCCCC-HHHHHHHHHHHHHH
T ss_conf             14889976-327888998663027889888752---5796---5999728700-78999999878889