HHsearch alignment for GI: 255764515 and conserved domain: TIGR02621

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype; InterPro: IPR013444 This entry represents a CRISPR-associated putative DEAH-box helicase, or Cas3, subtype found in Actinomyces naeslundii MG1, Geobacter sulfurreducens PCA, Gemmata obscuriglobus UQM 2246, and Desulfotalea psychrophila. The proteins include both DEAH and HD motifs..
Probab=99.40  E-value=2.1e-11  Score=87.32  Aligned_cols=96  Identities=15%  Similarity=0.196  Sum_probs=63.4

Q ss_pred             CCCCEEEEHHHHHHHHHHHHHCCCC----------------CCCHHHHHHHHHHH----CCC------CCCEEEEEHHHC
Q ss_conf             4884034222367888664100026----------------53344589987642----458------855899844221
Q gi|255764515|r  319 ANAAPIIVAYHFNSDLARLQKAFPQ----------------GRTLDKDPCTIQEW----NEG------KIPLLFAHPASC  372 (458)
Q Consensus       319 ~~~~kviif~~~~~~~~~i~~~~~~----------------g~~~~~r~~~i~~f----~~~------~~~vli~s~~~~  372 (458)
T Consensus       309 s~g~~~~Vf~~~~~~v~~v~a~L~k~~~~~~~ltG~vr~~~~d~lar~~~~~~~~Lpp~~~~s~g~~~~g~~~vVaTst~  388 (975)
T TIGR02621       309 SSGEAILVFCNTVDEVKKVVAKLPKEARRLEDLTGTVRGLERDMLARRGEIFNRFLPPYRSGSEGRPQQGTVYVVATSTG  388 (975)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHCCCCCCCHHHHCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCEEEEEECCE
T ss_conf             27866999876843068988645774540776288104334785200131453148764567736689987799973242


Q ss_pred             CCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCC--EEEEEE
Q ss_conf             116220017859999089989868644566662022020378775--289999
Q gi|255764515|r  373 GHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA--VFVYYL  423 (458)
Q Consensus       373 ~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~--v~v~~l  423 (458)
T Consensus       389 EVGadld-fd-hLv-t~~-~~~~sl~QRfGRvn-----R~G~r~~~~~~iVh~  432 (975)
T TIGR02621       389 EVGADLD-FD-HLV-TDL-APFESLVQRFGRVN-----RFGERLDGSIAIVHS  432 (975)
T ss_pred             EECCCCC-CC-HHH-HCC-CHHHHHHHHHHHHC-----CCCCCCCCEEEEEEC
T ss_conf             5503443-11-122-114-42457865430020-----002231650589856