HHsearch alignment for GI: 255764515 and conserved domain: TIGR02768

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136 This entry represents the Ti-type conjugative transfer relaxase TraA. TraA contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, IPR005053 from INTERPRO) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, IPR014129 from INTERPRO). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer ..
Probab=93.53  E-value=0.47  Score=24.62  Aligned_cols=130  Identities=20%  Similarity=0.211  Sum_probs=66.2

Q ss_pred             CCHHHHHHHHHHHHCCC-EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEE
Q ss_conf             74789999999996798-09995889986899999999999759994999916046569999999985588881599985
Q gi|255764515|r    3 LAPHQTKIVDWILDHKR-CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT   81 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~-~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~   81 (458)
T Consensus       415 Ls~EQ~~Av~hvt~s~~iavVvG~AGtGKSt~L-~aAR~AWe~~Gy~V--~G-AALs-GKAAegLe~~s-----------  478 (888)
T TIGR02768       415 LSEEQKEAVRHVTGSGDIAVVVGRAGTGKSTML-KAAREAWEAAGYRV--IG-AALS-GKAAEGLEAES-----------  478 (888)
T ss_pred             CHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHH-HHHHHHHHHCCCEE--EE-HHHH-HHHHHHHHCCC-----------
T ss_conf             458999998753289964899748998766789-99999998739778--71-5455-58988730026-----------


Q ss_pred             CCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             89789888730779869980642023344200011322044045310024654311567777665430598079965840
Q gi|255764515|r   82 GTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTP  161 (458)
Q Consensus        82 g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTP  161 (458)
T Consensus       479 GI~SRTLASle------------~aW-~~G~d~L~~~dvLviDEAGMV------~S~Qm~r~l-~~A~~AGaKvVLvGD~  538 (888)
T TIGR02768       479 GIESRTLASLE------------YAW-ANGRDLLEDKDVLVIDEAGMV------GSRQMARVL-KEAEEAGAKVVLVGDP  538 (888)
T ss_pred             CCCHHHHHHHH------------HHH-HCCCCCCCCCCEEEEECCCCH------HHHHHHHHH-HHHHHCCCCEEEECCH
T ss_conf             87504788799------------998-738752247766898515441------467788999-9998727605984885


Q ss_pred             HHHHCCC
Q ss_conf             2310010
Q gi|255764515|r  162 SPNGLID  168 (458)
Q Consensus       162 i~n~~~e  168 (458)
T Consensus       539 ~QLqaI~  545 (888)
T TIGR02768       539 EQLQAIE  545 (888)
T ss_pred             HHHCHHH
T ss_conf             7824424