HHsearch alignment for GI: 255764515 and conserved domain: TIGR03015

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=97.68  E-value=0.0005  Score=42.64  Aligned_cols=31  Identities=23%  Similarity=0.395  Sum_probs=18.8

Q ss_pred             HHHHHHCCC--EEEEECCCCCHHHHHHHHHHHH
Q ss_conf             999996798--0999588998689999999999
Q gi|255764515|r   11 VDWILDHKR--CAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        11 v~~~~~~~~--~ll~~~~G~GKT~~al~~~~~l   41 (458)
T Consensus        35 L~~~l~~~~g~~lltGe~GtGKTtllr~l~~~l   67 (269)
T TIGR03015        35 LEYGLSQREGFILITGEVGAGKTTLIRNLLKRL   67 (269)
T ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             999996489659997299898899999999845