HHsearch alignment for GI: 255764515 and conserved domain: TIGR03117

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf4 (CRISPR/cas Subtype as in A. ferrooxidans protein 1), as it lies farthest (fourth closest) from the repeats in the A. ferrooxidans genome.
Probab=94.48  E-value=0.23  Score=26.49  Aligned_cols=50  Identities=26%  Similarity=0.334  Sum_probs=27.7

Q ss_pred             HHCCC-EEEEECCCCCHHHHHHHH-HHHHHHCCCCCEEEEECCHHHHHHHHH
Q ss_conf             96798-099958899868999999-999997599949999160465699999
Q gi|255764515|r   15 LDHKR-CAIWASMGSGKTVSVLTA-LSYIHLWGEKSVLVIAPLRVAQSVWTS   64 (458)
Q Consensus        15 ~~~~~-~ll~~~~G~GKT~~al~~-~~~l~~~~~~~~LIv~P~~l~~~~W~~   64 (458)
T Consensus        13 ~~~~~v~lVEAGTGTGKSLAYLvPAl~~a~~~~g~rVVISTaT~aLQeQL~~   64 (636)
T TIGR03117        13 LRQKRIGMLEASTGVGKTLAMIMAALTMLKERPDQKIAIAVPTLALMGQLWS   64 (636)
T ss_pred             HHCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHH
T ss_conf             6038489998999710889999999999985799988997987999999976