HHsearch alignment for GI: 255764515 and conserved domain: TIGR03346

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=91.40  E-value=0.32  Score=25.60  Aligned_cols=43  Identities=16%  Similarity=0.080  Sum_probs=20.2

Q ss_pred             CEEECCCCCCCCCCCCCCHH-HHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             20440453100246543115-67777665430598079965840
Q gi|255764515|r  119 ATIVVDESTKLKSFRLRQGS-KTARALAKPAWESERFIELTGTP  161 (458)
Q Consensus       119 ~~iIiDEaH~lkn~~~~~~s-~~~~~l~~~~~~~~~~l~LTgTP  161 (458)
T Consensus       268 iILFIDEiHtliGaG~~~G~~DAaNlLKPaLarGelr~IgATT~  311 (852)
T TIGR03346       268 IILFIDELHTLVGAGKAEGAMDAGNMLKPALARGELHCIGATTL  311 (852)
T ss_pred             EEEEEHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCH
T ss_conf             79996125553268876664106777437874798559982789