HHsearch alignment for GI: 255764515 and conserved domain: TIGR03420

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=92.72  E-value=0.62  Score=23.89  Aligned_cols=93  Identities=16%  Similarity=0.145  Sum_probs=47.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
T Consensus        41 l~i~G~~GsGKTHLl~a~~~~~~~~~-~~~~yl~~~-~~~-~~~~~~l~-------------------------------   86 (226)
T TIGR03420        41 LYLWGESGSGKSHLLQAACAAAEERG-KSAIYLPLA-ELA-QADPEVLE-------------------------------   86 (226)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCC-CCEEEECHH-HHH-HHHHHHHH-------------------------------
T ss_conf             99989999988999999999986269-957995299-987-75399997-------------------------------


Q ss_pred             ECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCH
Q ss_conf             806420233442000113220440453100246543115677776654305980799658402
Q gi|255764515|r  100 INFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPS  162 (458)
Q Consensus       100 ~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi  162 (458)
T Consensus        87 --------------~l~~~d~l~iDDi~~i~~~~~~e-~~lF~l~N~~~~~~~-~ilits~~~  133 (226)
T TIGR03420        87 --------------GLEQADLVCLDDVEAIAGQPEWQ-EALFHLYNRVREAGG-RLLIAGRAA  133 (226)
T ss_pred             --------------HCCCCCEEEEECHHHHCCCHHHH-HHHHHHHHHHHHHCC-EEEEECCCC
T ss_conf             --------------27448999996633343783789-999999999986528-289867888