HHsearch alignment for GI: 255764515 and conserved domain: cd00268

>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region.
Probab=99.56  E-value=5.3e-13  Score=96.99  Aligned_cols=163  Identities=18%  Similarity=0.224  Sum_probs=110.1

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC---CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             874789999999996798099958899868999-9999999975---999499991604656999999998558888159
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW---GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~---~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~   77 (458)
T Consensus        21 ~pt~IQ~~~ip~il~g~dvi~~a~TGSGKTlay~lpil~~l~~~~~~~~~~alil~PTrELa~Qi~~~~~~l~~~~~i~~  100 (203)
T cd00268          21 KPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEKLDPSPKKDGPQALILAPTRELALQIAEVARKLGKHTNLKV  100 (203)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99999999999997799889975799722288886999998616676896699996879999999999998505798389


Q ss_pred             EEEECCH--HHHHHHHCCCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEE
Q ss_conf             9985897--8988873077986998064202334420-001132204404531002465431156777766543059807
Q gi|255764515|r   78 SVITGTV--KQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERF  154 (458)
Q Consensus        78 ~~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~  154 (458)
T Consensus       101 ~~~~gg~~~~~~~~~l~~~~~IlI~TPgrl~~~l~~~~~~l~~l~~lVlDEAD~ll~~gf---~~~i~~I~~~l~~~~Q~  177 (203)
T cd00268         101 VVIYGGTSIDKQIRKLKRGPHIVVATPGRLLDLLERGKLDLSKVKYLVLDEADRMLDMGF---EDQIREILKLLPKDRQT  177 (203)
T ss_pred             EEEECCCCHHHHHHHHHCCCEEEEECCHHHHHHHHCCCCCCCCCCEEEEECHHHHHHCCC---HHHHHHHHHHCCCCCEE
T ss_conf             998389887999999853875999681899999984886513224899985888874776---99999999858967779


Q ss_pred             EEECCCCHHHHCCC
Q ss_conf             99658402310010
Q gi|255764515|r  155 IELTGTPSPNGLID  168 (458)
Q Consensus       155 l~LTgTPi~n~~~e  168 (458)
T Consensus       178 ~lfSAT~-~~~v~~  190 (203)
T cd00268         178 LLFSATM-PKEVRD  190 (203)
T ss_pred             EEEEECC-CHHHHH
T ss_conf             9998049-988999