Query         gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 458
No_of_seqs    150 out of 6333
Neff          10.2
Searched_HMMs 39220
Date          Mon May 30 06:31:46 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 255764515.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0385 consensus              100.0       0       0  517.8  33.2  422    2-451   167-623 (971)
  2 KOG0384 consensus              100.0       0       0  514.2  32.1  419    1-452   369-836 (1373)
  3 KOG0389 consensus              100.0       0       0  506.0  30.6  436    1-454   398-915 (941)
  4 KOG0392 consensus              100.0       0       0  503.6  29.1  431    2-450   975-1477(1549)
  5 KOG0387 consensus              100.0       0       0  496.0  30.3  428    2-450   205-681 (923)
  6 KOG0390 consensus              100.0       0       0  468.7  30.4  430    1-451   237-731 (776)
  7 KOG0391 consensus              100.0       0       0  438.3  26.7  428    2-450   615-1410(1958)
  8 KOG0388 consensus              100.0       0       0  429.4  29.1  420    2-452   567-1179(1185)
  9 KOG4439 consensus              100.0       0       0  431.6  26.8  420    2-450   325-881 (901)
 10 KOG0386 consensus              100.0       0       0  433.5  21.5  432    2-452   394-863 (1157)
 11 KOG1015 consensus              100.0       0       0  426.4  25.0  433    1-450   667-1300(1567)
 12 KOG1000 consensus              100.0       0       0  412.0  25.9  406    2-447   198-623 (689)
 13 KOG1002 consensus              100.0       0       0  410.7  27.0  430    1-450   183-772 (791)
 14 COG0553 HepA Superfamily II DN 100.0       0       0  413.9  24.1  431    2-450   338-845 (866)
 15 PRK04914 ATP-dependent helicas 100.0       0       0  394.5  30.6  408    1-444   150-622 (955)
 16 KOG1016 consensus              100.0       0       0  351.1  20.7  434    3-451   255-873 (1387)
 17 KOG1001 consensus              100.0       0       0  340.2  20.5  403   18-449   153-672 (674)
 18 pfam00176 SNF2_N SNF2 family N 100.0       0       0  324.9  24.8  276    6-293     1-295 (295)
 19 PRK13766 Hef nuclease; Provisi 100.0 4.8E-42       0  273.0  28.1  426    1-450    14-501 (764)
 20 COG1111 MPH1 ERCC4-like helica 100.0 1.2E-36 3.2E-41  240.1  29.4  427    1-450    14-504 (542)
 21 COG1061 SSL2 DNA or RNA helica 100.0   6E-35 1.5E-39  229.9  23.4  349    1-437    35-404 (442)
 22 KOG0354 consensus              100.0 1.1E-32 2.9E-37  216.2  28.4  418    1-451    61-552 (746)
 23 KOG0298 consensus              100.0 1.7E-33 4.4E-38  221.1  18.6  151   18-177   375-565 (1394)
 24 KOG0383 consensus              100.0 2.8E-36 7.1E-41  238.0   3.9  347    3-375   296-696 (696)
 25 TIGR00603 rad25 DNA repair hel 100.0 1.6E-34 4.1E-39  227.3  12.3  335    2-431   269-634 (756)
 26 PRK11192 ATP-dependent RNA hel 100.0 7.4E-26 1.9E-30  174.9  28.4  322    2-440    25-365 (417)
 27 PRK13767 ATP-dependent helicas 100.0   1E-25 2.6E-30  174.0  23.5  321    2-428    32-398 (878)
 28 PRK10590 ATP-dependent RNA hel 100.0 5.7E-25 1.5E-29  169.5  26.9  320    2-440    23-363 (457)
 29 KOG1123 consensus              100.0 1.6E-26 4.2E-31  178.9  17.5  334    2-432   302-658 (776)
 30 PRK11776 ATP-dependent RNA hel 100.0   1E-24 2.6E-29  168.0  26.4  318    2-439    26-359 (459)
 31 PRK00254 ski2-like helicase; P 100.0 2.6E-25 6.5E-30  171.6  23.4  165    2-177    23-190 (717)
 32 PRK04537 ATP-dependent RNA hel  99.9 5.3E-24 1.4E-28  163.6  28.9  310    2-427    31-364 (574)
 33 PRK01172 ski2-like helicase; P  99.9 1.6E-25   4E-30  172.9  20.6  167    1-177    21-190 (674)
 34 PRK11448 hsdR type I restricti  99.9 7.5E-26 1.9E-30  174.9  14.1  350    1-413   415-807 (1126)
 35 PRK01297 ATP-dependent RNA hel  99.9 4.8E-23 1.2E-27  157.8  28.3  320    3-440   107-450 (472)
 36 PRK02362 ski2-like helicase; P  99.9 1.1E-23 2.7E-28  161.8  24.8  165    2-177    23-192 (736)
 37 PRK04837 ATP-dependent RNA hel  99.9 4.3E-23 1.1E-27  158.1  27.2  309    2-427    31-363 (423)
 38 PRK11634 ATP-dependent RNA hel  99.9 3.6E-23 9.2E-28  158.6  24.1  308    2-426    28-351 (629)
 39 COG1201 Lhr Lhr-like helicases  99.9 7.6E-23 1.9E-27  156.6  25.0  318    2-433    22-366 (814)
 40 PTZ00110 helicase; Provisional  99.9 4.7E-22 1.2E-26  151.8  27.0  309    4-427   206-535 (602)
 41 COG1204 Superfamily II helicas  99.9 2.5E-23 6.3E-28  159.6  20.0  168    2-177    31-201 (766)
 42 TIGR00643 recG ATP-dependent D  99.9   2E-22 5.1E-27  154.1  21.9  314    2-426   307-646 (721)
 43 PRK11057 ATP-dependent DNA hel  99.9 3.5E-21 8.8E-26  146.6  23.7  295    2-422    25-340 (607)
 44 smart00487 DEXDc DEAD-like hel  99.9   2E-22 5.1E-27  154.1  15.7  159    2-163     8-172 (201)
 45 PRK10917 ATP-dependent DNA hel  99.9 2.2E-20 5.7E-25  141.7  25.8  307    2-428   257-585 (677)
 46 COG0513 SrmB Superfamily II DN  99.9 6.1E-20 1.6E-24  139.0  26.9  324    2-440    51-392 (513)
 47 KOG0331 consensus               99.9 2.9E-20 7.3E-25  141.0  22.4  322    3-439   114-462 (519)
 48 COG1205 Distinct helicase fami  99.9 1.1E-19 2.9E-24  137.4  24.0  327    2-435    70-430 (851)
 49 COG4096 HsdR Type I site-speci  99.9 2.6E-21 6.6E-26  147.4  15.4  349    1-424   164-545 (875)
 50 COG1200 RecG RecG-like helicas  99.9 5.2E-20 1.3E-24  139.4  21.8  309    2-428   262-591 (677)
 51 PRK10689 transcription-repair   99.9 3.6E-18 9.1E-23  128.3  25.1  148    4-165   602-762 (1148)
 52 pfam04851 ResIII Type III rest  99.9 7.3E-21 1.9E-25  144.6  11.2  101    1-162     2-102 (103)
 53 KOG0330 consensus               99.9 9.3E-19 2.4E-23  131.9  21.7  316    3-437    84-415 (476)
 54 TIGR00580 mfd transcription-re  99.8 9.1E-19 2.3E-23  131.9  18.6  299    5-426   511-830 (997)
 55 COG4889 Predicted helicase [Ge  99.8 1.7E-19 4.3E-24  136.4  14.8  154    2-162   161-351 (1518)
 56 COG1197 Mfd Transcription-repa  99.8 2.7E-17   7E-22  123.0  24.7  148    4-165   596-756 (1139)
 57 KOG0952 consensus               99.8 1.8E-17 4.6E-22  124.1  23.0  341   16-431   125-495 (1230)
 58 TIGR01389 recQ ATP-dependent D  99.8 4.2E-18 1.1E-22  127.9  19.6  324    2-449    13-367 (607)
 59 COG0514 RecQ Superfamily II DN  99.8 5.3E-17 1.3E-21  121.3  22.6  300    2-427    17-337 (590)
 60 PRK09751 putative ATP-dependen  99.8 3.8E-17 9.8E-22  122.1  20.2  338   22-421     1-381 (1490)
 61 TIGR00614 recQ_fam ATP-depende  99.8 6.1E-17 1.6E-21  120.9  20.9  308    2-424    11-348 (497)
 62 cd00046 DEXDc DEAD-like helica  99.8 2.8E-18   7E-23  129.0  13.2  140   18-161     1-144 (144)
 63 COG1202 Superfamily II helicas  99.8   4E-17   1E-21  121.9  19.0  312    2-426   216-552 (830)
 64 pfam00270 DEAD DEAD/DEAH box h  99.8 6.5E-18 1.7E-22  126.8  14.5  160    4-167     1-165 (167)
 65 cd00079 HELICc Helicase superf  99.8 2.4E-19 6.1E-24  135.4   6.9  112  303-421     8-131 (131)
 66 KOG0350 consensus               99.8 1.2E-16   3E-21  119.1  19.6  352    2-440   159-551 (620)
 67 KOG0333 consensus               99.7 3.5E-16   9E-21  116.3  17.8  332    4-427   269-624 (673)
 68 TIGR03158 cas3_cyano CRISPR-as  99.7 1.3E-15 3.2E-20  112.9  18.5  153    6-163     1-193 (357)
 69 KOG0338 consensus               99.7 1.9E-15 4.8E-20  111.8  18.5  279   22-413   223-524 (691)
 70 KOG0328 consensus               99.7 1.9E-15 4.9E-20  111.8  16.1  314    6-438    53-382 (400)
 71 KOG0343 consensus               99.7   1E-14 2.6E-19  107.4  19.4  320    5-440    94-434 (758)
 72 KOG0340 consensus               99.7 8.1E-14 2.1E-18  101.9  21.1  304    4-415    31-354 (442)
 73 KOG0347 consensus               99.6 9.8E-14 2.5E-18  101.5  19.6  337   19-449   221-613 (731)
 74 COG4581 Superfamily II RNA hel  99.6 4.6E-14 1.2E-18  103.4  17.8  152    2-164   119-272 (1041)
 75 KOG0335 consensus               99.6 6.5E-14 1.7E-18  102.5  17.9  309    2-420    96-439 (482)
 76 KOG0342 consensus               99.6 1.7E-13 4.4E-18   99.9  19.2  310    3-426   105-436 (543)
 77 KOG0351 consensus               99.6   5E-14 1.3E-18  103.2  15.0  298    2-422   264-589 (941)
 78 COG1203 CRISPR-associated heli  99.6 1.2E-12 3.1E-17   94.9  21.2  157    3-161   196-380 (733)
 79 KOG0345 consensus               99.6 2.3E-12 5.8E-17   93.2  22.1  301    2-413    28-355 (567)
 80 KOG0951 consensus               99.6 7.1E-13 1.8E-17   96.2  18.7  337   17-407   325-687 (1674)
 81 KOG0348 consensus               99.6 2.1E-12 5.2E-17   93.4  20.6  373    6-440   163-565 (708)
 82 KOG0344 consensus               99.6 4.5E-14 1.1E-18  103.5  11.7  300    5-416   161-486 (593)
 83 cd00268 DEADc DEAD-box helicas  99.6 5.3E-13 1.4E-17   97.0  16.0  163    2-168    21-190 (203)
 84 KOG0336 consensus               99.6 8.7E-12 2.2E-16   89.7  21.9  110  309-427   452-572 (629)
 85 COG4098 comFA Superfamily II D  99.5 5.1E-11 1.3E-15   85.0  24.8  323    2-456    97-440 (441)
 86 TIGR00348 hsdR type I site-spe  99.5 1.5E-13 3.7E-18  100.4  11.2  161    6-168   301-504 (813)
 87 PRK05580 primosome assembly pr  99.5 8.1E-11 2.1E-15   83.8  24.4  152    2-163   168-330 (699)
 88 COG0610 Type I site-specific r  99.5 7.9E-13   2E-17   96.0  14.1  139   18-165   274-417 (962)
 89 KOG1513 consensus               99.5 7.5E-13 1.9E-17   96.1  13.0   81  354-441   850-937 (1300)
 90 KOG0947 consensus               99.5   7E-12 1.8E-16   90.2  17.3  150    2-165   297-447 (1248)
 91 KOG0341 consensus               99.5 7.8E-13   2E-17   96.0  11.0  118  307-434   408-535 (610)
 92 KOG0326 consensus               99.5 8.3E-13 2.1E-17   95.8  10.9  313    5-440   110-440 (459)
 93 KOG4284 consensus               99.5   2E-11 5.2E-16   87.4  17.3  152    7-160    52-208 (980)
 94 KOG0339 consensus               99.4 6.2E-11 1.6E-15   84.5  19.7  289   24-427   267-575 (731)
 95 COG1110 Reverse gyrase [DNA re  99.4   5E-11 1.3E-15   85.1  18.2  125    3-129    83-215 (1187)
 96 PRK08074 bifunctional ATP-depe  99.4 3.4E-10 8.7E-15   80.0  21.9   82  310-392   746-839 (932)
 97 TIGR02621 cas3_GSU0051 CRISPR-  99.4 2.1E-11 5.4E-16   87.3  14.3   96  319-423   309-432 (975)
 98 KOG0334 consensus               99.4 4.6E-10 1.2E-14   79.2  19.1  309    2-426   387-719 (997)
 99 TIGR01054 rgy reverse gyrase;   99.3 2.7E-10 6.9E-15   80.6  17.1  123    7-129    89-221 (1843)
100 TIGR01587 cas3_core CRISPR-ass  99.3   7E-11 1.8E-15   84.2  14.0  114  309-427   255-395 (424)
101 COG1198 PriA Primosomal protei  99.3 3.5E-09   9E-14   73.9  22.4  152    2-164   198-362 (730)
102 TIGR00631 uvrb excinuclease AB  99.3 1.6E-10 4.1E-15   82.0  15.6  122  310-440   435-573 (667)
103 PRK05298 excinuclease ABC subu  99.3 9.4E-10 2.4E-14   77.3  18.5   86  319-406   444-544 (657)
104 pfam00271 Helicase_C Helicase   99.3   1E-11 2.6E-16   89.2   5.9   67  340-413    12-78  (78)
105 KOG0949 consensus               99.2 1.5E-08 3.8E-13   70.0  21.7  154    6-169   515-677 (1330)
106 PRK09401 reverse gyrase; Revie  99.2 7.6E-09 1.9E-13   71.8  19.9  129    2-132    78-215 (1176)
107 KOG0332 consensus               99.2   1E-09 2.5E-14   77.2  14.7  308    1-425    95-441 (477)
108 KOG0327 consensus               99.2 9.1E-10 2.3E-14   77.4  14.4  311    7-438    53-379 (397)
109 KOG0948 consensus               99.2 8.7E-10 2.2E-14   77.5  14.1  146    2-165   129-279 (1041)
110 KOG0352 consensus               99.2 5.5E-09 1.4E-13   72.7  17.8  309    5-423    23-360 (641)
111 PRK07246 bifunctional ATP-depe  99.2 1.6E-08 4.1E-13   69.8  19.5   87  318-406   645-769 (820)
112 smart00490 HELICc helicase sup  99.2 3.6E-11 9.2E-16   85.9   5.7   66  341-413    17-82  (82)
113 COG1199 DinG Rad3-related DNA   99.2 9.4E-08 2.4E-12   65.2  22.6   65    2-66     15-83  (654)
114 TIGR01407 dinG_rel DnaQ family  99.1 3.8E-08 9.7E-13   67.6  19.9  136  312-453   757-942 (944)
115 COG0556 UvrB Helicase subunit   99.1 1.3E-08 3.4E-13   70.4  17.5  122  311-440   435-572 (663)
116 KOG0346 consensus               99.1 6.5E-08 1.6E-12   66.2  19.8  151    7-161    46-211 (569)
117 KOG0950 consensus               99.1 2.2E-08 5.7E-13   69.0  16.9  158    2-165   223-390 (1008)
118 PRK11664 ATP-dependent RNA hel  99.1 1.8E-08 4.5E-13   69.6  15.4  154    9-176    12-174 (812)
119 KOG0353 consensus               99.1 2.6E-08 6.6E-13   68.6  16.1  159    2-170    94-269 (695)
120 PRK11131 ATP-dependent RNA hel  99.0 1.3E-07 3.3E-12   64.3  17.5  153    6-171    78-238 (1295)
121 pfam07652 Flavi_DEAD Flaviviru  99.0 5.5E-09 1.4E-13   72.7   9.9  127   21-161     6-134 (146)
122 PRK12906 secA preprotein trans  98.9 4.3E-06 1.1E-10   55.2  22.0  124    1-129    77-212 (823)
123 KOG0337 consensus               98.9 1.4E-07 3.5E-12   64.2  13.2  138   20-160    60-204 (529)
124 PRK09200 preprotein translocas  98.8 7.6E-06 1.9E-10   53.7  20.2  150    1-174    75-241 (799)
125 PRK13104 secA preprotein trans  98.8 1.3E-05 3.3E-10   52.3  22.3  123    1-129    79-214 (896)
126 PRK13103 secA preprotein trans  98.8 1.3E-05 3.2E-10   52.3  20.4  124    1-129    79-214 (913)
127 PRK12904 preprotein translocas  98.7 1.3E-05 3.3E-10   52.3  20.2  124    1-129    78-213 (833)
128 KOG1802 consensus               98.7 1.6E-07 4.2E-12   63.8  10.5   67    2-68    410-476 (935)
129 smart00489 DEXDc3 DEAD-like he  98.7 8.5E-07 2.2E-11   59.4  13.0   37    2-38      8-48  (289)
130 smart00488 DEXDc2 DEAD-like he  98.7 8.5E-07 2.2E-11   59.4  13.0   37    2-38      8-48  (289)
131 PRK12903 secA preprotein trans  98.7 2.4E-05 6.1E-10   50.6  23.5  124    1-129    75-210 (885)
132 KOG0953 consensus               98.6 1.1E-06 2.8E-11   58.7  12.5   84  320-406   357-460 (700)
133 PRK12898 secA preprotein trans  98.6 3.2E-05 8.2E-10   49.9  23.2  124    1-129   115-269 (673)
134 PRK13107 preprotein translocas  98.6   5E-05 1.3E-09   48.7  23.0  124    1-129    79-214 (908)
135 PRK11747 dinG ATP-dependent DN  98.6 2.7E-06 6.9E-11   56.4  12.8   65    2-66     25-97  (697)
136 pfam02562 PhoH PhoH-like prote  98.5   2E-06 5.2E-11   57.1  11.6  133    4-165     6-159 (205)
137 COG1643 HrpA HrpA-like helicas  98.5 2.8E-06   7E-11   56.3  11.8  154   10-174    58-218 (845)
138 PRK12326 preprotein translocas  98.5 6.8E-05 1.7E-09   47.9  23.0  124    1-129    86-221 (775)
139 CHL00122 secA preprotein trans  98.5 8.5E-05 2.2E-09   47.3  21.7  124    1-129    73-208 (891)
140 PRK10875 recD exonuclease V su  98.4 2.2E-06 5.5E-11   57.0   8.8  138    5-163   150-298 (607)
141 KOG1803 consensus               98.4 2.4E-06 6.1E-11   56.7   8.8   58    3-61    186-244 (649)
142 KOG0349 consensus               98.4 2.3E-06 5.9E-11   56.8   8.7   94  317-414   501-607 (725)
143 PRK12900 secA preprotein trans  98.4 0.00017 4.4E-09   45.4  21.6  123    2-129    92-226 (983)
144 PRK09694 hypothetical protein;  98.4 5.8E-06 1.5E-10   54.4  10.1  152    4-161   290-482 (878)
145 TIGR01447 recD exodeoxyribonuc  98.4 4.5E-06 1.2E-10   55.0   9.3  145    4-161   229-393 (753)
146 COG3587 Restriction endonuclea  98.4 4.5E-06 1.1E-10   55.1   9.3  135   19-160    76-241 (985)
147 PRK10536 hypothetical protein;  98.3 9.8E-06 2.5E-10   53.0   9.9  142    5-165    62-216 (262)
148 KOG0329 consensus               98.3 2.3E-05   6E-10   50.7  11.4  134   25-160    87-226 (387)
149 KOG0951 consensus               98.2 8.3E-05 2.1E-09   47.3  13.8  105   17-131  1159-1267(1674)
150 KOG0922 consensus               98.2 6.2E-06 1.6E-10   54.2   7.2  158   10-183    59-228 (674)
151 COG0653 SecA Preprotein transl  98.2 0.00024 6.1E-09   44.6  15.2  143    2-172    78-236 (822)
152 pfam09848 DUF2075 Uncharacteri  98.1 1.6E-05   4E-10   51.8   8.0   90   20-132     4-94  (348)
153 TIGR03117 cas_csf4 CRISPR-asso  98.0 0.00023 5.9E-09   44.7  12.3   84  310-394   460-563 (636)
154 TIGR00595 priA primosomal prot  98.0  0.0001 2.6E-09   46.8  10.1  138   21-166     1-146 (524)
155 PRK12899 secA preprotein trans  97.9  0.0014 3.5E-08   40.0  23.1  123    2-129    92-227 (969)
156 pfam02399 Herpes_ori_bp Origin  97.9 0.00012   3E-09   46.5   8.9  133   20-161    52-190 (829)
157 KOG1805 consensus               97.7 0.00045 1.2E-08   42.9   9.9  122    2-129   669-808 (1100)
158 PRK12901 secA preprotein trans  97.7  0.0032 8.2E-08   37.8  22.5  123    2-129   169-304 (1111)
159 PRK10919 ATP-dependent DNA hel  97.7 7.4E-05 1.9E-09   47.7   5.3   54    1-56      1-57  (672)
160 TIGR00963 secA preprotein tran  97.7  0.0019   5E-08   39.1  12.4  124    1-129    57-192 (904)
161 pfam05621 TniB Bacterial TniB   97.7  0.0012 3.2E-08   40.2  11.4  121   18-161    62-189 (302)
162 TIGR03015 pepcterm_ATPase puta  97.7  0.0005 1.3E-08   42.6   9.3   31   11-41     35-67  (269)
163 COG0553 HepA Superfamily II DN  97.7 0.00012 3.1E-09   46.4   6.1  174    2-178    84-284 (866)
164 KOG0920 consensus               97.6   0.001 2.6E-08   40.8  10.5  148    4-162   175-330 (924)
165 TIGR01967 DEAH_box_HrpA ATP-de  97.6 9.6E-05 2.5E-09   47.0   5.2  105  309-427   281-423 (1320)
166 PRK12902 secA preprotein trans  97.6  0.0017 4.3E-08   39.4  11.5  124    1-129    82-217 (946)
167 TIGR01448 recD_rel helicase, R  97.6 0.00034 8.8E-09   43.6   7.9  130    1-160   349-490 (769)
168 PRK12402 replication factor C   97.6 0.00015 3.8E-09   45.8   6.0   26   18-43     37-62  (337)
169 PRK05707 DNA polymerase III su  97.6 0.00055 1.4E-08   42.4   8.8  110    1-129     2-118 (328)
170 KOG0924 consensus               97.6 0.00049 1.2E-08   42.7   8.1  143   12-171   366-520 (1042)
171 KOG0989 consensus               97.6 0.00023 5.9E-09   44.7   6.4   38    6-43     40-83  (346)
172 pfam05876 Terminase_GpA Phage   97.6  0.0011 2.9E-08   40.5   9.8  158    2-165    16-183 (552)
173 PRK00440 rfc replication facto  97.5  0.0027   7E-08   38.2  11.4   25   18-42     38-62  (318)
174 PRK05563 DNA polymerase III su  97.5  0.0012   3E-08   40.4   9.2  113   20-161    41-157 (541)
175 pfam07517 SecA_DEAD SecA DEAD-  97.5  0.0014 3.6E-08   39.9   9.4  122    1-129    74-209 (381)
176 PRK05896 DNA polymerase III su  97.4  0.0026 6.7E-08   38.3  10.2  107   20-156    41-152 (613)
177 PRK08769 DNA polymerase III su  97.4  0.0014 3.5E-08   40.0   8.3  136    2-160     4-151 (319)
178 PRK08451 DNA polymerase III su  97.3  0.0038 9.7E-08   37.3   9.5  120    7-155    19-149 (523)
179 PRK07940 DNA polymerase III su  97.3  0.0038 9.7E-08   37.3   9.5  112   20-160    42-158 (395)
180 PRK09112 DNA polymerase III su  97.3  0.0045 1.1E-07   36.9   9.8  111    7-129    28-153 (352)
181 PRK06674 DNA polymerase III su  97.3  0.0045 1.1E-07   36.9   9.7  112   20-160    41-156 (563)
182 PRK13889 conjugal transfer rel  97.3  0.0096 2.5E-07   34.9  11.4  131    2-168   346-477 (992)
183 PRK06305 DNA polymerase III su  97.2  0.0049 1.2E-07   36.6   9.8  113   20-160    42-158 (462)
184 PRK04195 replication factor C   97.2 0.00097 2.5E-08   40.9   6.2   41  117-160    99-139 (403)
185 KOG0923 consensus               97.2 0.00087 2.2E-08   41.2   5.9  163    3-183   266-443 (902)
186 KOG1132 consensus               97.2  0.0078   2E-07   35.4  10.7   34    2-35     21-58  (945)
187 PRK12377 putative replication   97.2  0.0057 1.4E-07   36.3   9.9   54    5-59     81-142 (248)
188 pfam01695 IstB IstB-like ATP b  97.2  0.0013 3.2E-08   40.2   6.5   52    7-59     37-88  (178)
189 PRK07270 DNA polymerase III su  97.2  0.0051 1.3E-07   36.5   9.3  126    7-161    20-158 (557)
190 pfam11496 HDA2-3 Class II hist  97.1   0.012 3.2E-07   34.2  11.1  180  244-435     7-234 (278)
191 KOG0952 consensus               97.1 0.00075 1.9E-08   41.6   4.6   26  391-416  1037-1062(1230)
192 PRK09183 transposase/IS protei  97.1  0.0074 1.9E-07   35.5   9.6   49   10-59     94-142 (258)
193 PRK06526 transposase; Provisio  97.1  0.0066 1.7E-07   35.9   9.3   49   10-59     91-139 (254)
194 PRK06647 DNA polymerase III su  97.1  0.0083 2.1E-07   35.2   9.8  125    7-160    21-156 (560)
195 KOG0926 consensus               97.1 0.00096 2.4E-08   40.9   4.9  142   10-161   264-424 (1172)
196 cd00009 AAA The AAA+ (ATPases   97.1  0.0023 5.9E-08   38.6   6.9   48   17-66     19-66  (151)
197 pfam03796 DnaB_C DnaB-like hel  97.1  0.0078   2E-07   35.4   9.5  112   20-133    22-145 (186)
198 PRK08058 DNA polymerase III su  97.1  0.0089 2.3E-07   35.1   9.7  128    5-160     9-148 (329)
199 PRK06645 DNA polymerase III su  97.0  0.0068 1.7E-07   35.8   8.9  112   20-160    46-165 (507)
200 COG1484 DnaC DNA replication p  97.0   0.013 3.3E-07   34.1   9.9   50   13-64    101-150 (254)
201 PRK07764 DNA polymerase III su  96.9   0.013 3.3E-07   34.0   9.5  114   20-160    40-157 (775)
202 PRK06995 flhF flagellar biosyn  96.9   0.027 6.9E-07   32.1  11.0   16  351-366   302-317 (404)
203 PRK13826 Dtr system oriT relax  96.9    0.02 5.1E-07   32.9  10.4  131    2-168   381-512 (1102)
204 PRK08181 transposase; Validate  96.9   0.012 3.2E-07   34.2   9.1   47   12-59    101-147 (269)
205 pfam00580 UvrD-helicase UvrD/R  96.8  0.0089 2.3E-07   35.1   7.9   54    3-58      1-57  (494)
206 PRK08116 hypothetical protein;  96.8   0.019 4.9E-07   33.0   9.5   45   19-65    110-154 (262)
207 PRK07993 DNA polymerase III su  96.8   0.013 3.4E-07   34.0   8.6  135    1-161     1-148 (334)
208 PRK06871 DNA polymerase III su  96.8   0.014 3.7E-07   33.8   8.7  108    2-129     1-118 (324)
209 PRK07133 DNA polymerase III su  96.8   0.012 3.2E-07   34.2   8.3  123    7-161    23-156 (718)
210 COG3421 Uncharacterized protei  96.7  0.0032 8.1E-08   37.8   5.2   37   23-59      3-40  (812)
211 PRK07471 DNA polymerase III su  96.7   0.012 3.1E-07   34.2   8.1  111    7-129    22-151 (363)
212 KOG0738 consensus               96.7  0.0092 2.4E-07   35.0   7.3   10   60-69     67-76  (491)
213 PRK06090 DNA polymerase III su  96.7   0.022 5.7E-07   32.6   9.1  109    1-129     2-120 (319)
214 TIGR02928 TIGR02928 orc1/cdc6   96.6   0.037 9.5E-07   31.3   9.8  126    4-146    22-167 (383)
215 smart00382 AAA ATPases associa  96.6  0.0069 1.8E-07   35.7   6.0   40   18-58      3-42  (148)
216 PRK07003 DNA polymerase III su  96.5   0.037 9.3E-07   31.3   9.5  112   20-160    41-156 (816)
217 TIGR00604 rad3 DNA repair heli  96.5   0.013 3.4E-07   34.0   7.3  134  311-457   598-803 (813)
218 pfam12340 DUF3638 Protein of u  96.5   0.012   3E-07   34.4   6.9   78    1-78     22-102 (229)
219 TIGR01970 DEAH_box_HrpB ATP-de  96.5   0.011 2.8E-07   34.5   6.6  147   13-172    13-170 (858)
220 KOG0740 consensus               96.5   0.007 1.8E-07   35.7   5.5   47   18-69    187-233 (428)
221 PRK08691 DNA polymerase III su  96.4   0.047 1.2E-06   30.7   9.5  112   20-160    41-156 (704)
222 PRK08853 DNA polymerase III su  96.4   0.032 8.3E-07   31.7   8.6  113   20-161    41-157 (717)
223 TIGR01074 rep ATP-dependent DN  96.4  0.0084 2.2E-07   35.2   5.5   41    1-43      2-42  (677)
224 TIGR02397 dnaX_nterm DNA polym  96.4   0.037 9.4E-07   31.3   8.8  125    7-161    19-154 (363)
225 PRK05564 DNA polymerase III su  96.3   0.039   1E-06   31.2   8.6   36    7-42      9-51  (313)
226 pfam05707 Zot Zonular occluden  96.2   0.027 6.8E-07   32.2   7.1   43  119-161    72-116 (183)
227 PRK05703 flhF flagellar biosyn  96.2   0.082 2.1E-06   29.2  10.6   25  428-454   383-407 (412)
228 PRK07994 DNA polymerase III su  96.2   0.076 1.9E-06   29.4   9.4  109   20-160    41-156 (643)
229 KOG0925 consensus               96.1    0.01 2.6E-07   34.7   4.7   51  116-170   158-210 (699)
230 pfam05970 DUF889 PIF1 helicase  96.1   0.031   8E-07   31.8   7.2   46   25-71      2-49  (418)
231 PRK00411 cdc6 cell division co  96.1   0.053 1.3E-06   30.4   8.3   42    4-45     35-83  (394)
232 PRK06835 DNA replication prote  96.1   0.014 3.5E-07   34.0   5.2   18  321-339   211-228 (330)
233 pfam04466 Terminase_3 Phage te  96.1   0.093 2.4E-06   28.9   9.7  131   18-163     3-140 (387)
234 KOG0742 consensus               96.0   0.091 2.3E-06   28.9   9.3   23  337-360   456-480 (630)
235 PRK07276 DNA polymerase III su  96.0   0.082 2.1E-06   29.2   8.9  132    1-161     1-144 (290)
236 CHL00181 cbbX CbbX; Provisiona  96.0     0.1 2.6E-06   28.6   9.3  104   19-162    61-171 (287)
237 COG1702 PhoH Phosphate starvat  96.0  0.0077   2E-07   35.5   3.6   13   22-34     29-41  (348)
238 COG1435 Tdk Thymidine kinase [  96.0   0.039   1E-06   31.1   7.2  111   21-160     8-118 (201)
239 PRK10865 protein disaggregatio  96.0   0.045 1.1E-06   30.8   7.5   26   18-43    200-225 (857)
240 TIGR02639 ClpA ATP-dependent C  96.0    0.11 2.7E-06   28.6  14.0   83   18-134   230-319 (774)
241 PRK12323 DNA polymerase III su  95.9    0.11 2.8E-06   28.5   9.0  115   20-160    41-161 (721)
242 PRK06964 DNA polymerase III su  95.9    0.12   3E-06   28.3   9.4   40    3-42      2-46  (342)
243 KOG0737 consensus               95.8   0.046 1.2E-06   30.8   7.0   47   18-69    128-174 (386)
244 PRK04296 thymidine kinase; Pro  95.8   0.056 1.4E-06   30.2   7.5   34   21-55      6-39  (197)
245 KOG0739 consensus               95.8   0.068 1.7E-06   29.7   7.8  103   19-162   168-278 (439)
246 PRK08699 DNA polymerase III su  95.8     0.1 2.6E-06   28.7   8.6  112    3-129     2-125 (325)
247 PRK03992 proteasome-activating  95.7   0.036 9.2E-07   31.4   6.0   40   19-63    168-207 (390)
248 TIGR03346 chaperone_ClpB ATP-d  95.7   0.058 1.5E-06   30.1   7.0   25   18-42    195-219 (852)
249 PRK07952 DNA replication prote  95.6   0.062 1.6E-06   29.9   7.1   40   19-59     98-137 (242)
250 COG0470 HolB ATPase involved i  95.6   0.079   2E-06   29.3   7.6   42    2-43      2-50  (325)
251 pfam00004 AAA ATPase family as  95.6   0.042 1.1E-06   31.0   6.2   35   20-58      1-35  (131)
252 PRK05648 DNA polymerase III su  95.6    0.14 3.5E-06   27.8   8.8  112   20-160    41-156 (705)
253 PRK11773 uvrD DNA-dependent he  95.6   0.022 5.5E-07   32.7   4.5   50    2-53      9-61  (722)
254 PRK06872 DNA polymerase III su  95.6    0.15 3.8E-06   27.6   9.4  111   20-160    41-156 (696)
255 COG1474 CDC6 Cdc6-related prot  95.5    0.06 1.5E-06   30.0   6.7   45    4-48     22-73  (366)
256 PRK07399 DNA polymerase III su  95.5    0.16 4.1E-06   27.5  10.3   38    7-44      9-53  (314)
257 cd01124 KaiC KaiC is a circadi  95.5    0.16 4.1E-06   27.4   9.2   39   20-59      2-44  (187)
258 PRK06921 hypothetical protein;  95.4   0.068 1.7E-06   29.7   6.6   25   20-44    119-143 (265)
259 PRK08939 primosomal protein Dn  95.4   0.026 6.5E-07   32.3   4.4   45  323-374   186-230 (306)
260 PRK11747 dinG ATP-dependent DN  95.4   0.093 2.4E-06   28.9   7.2   79  311-393   526-617 (697)
261 smart00492 HELICc3 helicase su  95.4    0.03 7.6E-07   31.9   4.6   54  340-394    26-81  (141)
262 PRK13342 recombination factor   95.2     0.2   5E-06   26.9  10.3   29   12-40     29-60  (417)
263 pfam03237 Terminase_6 Terminas  95.2    0.11 2.9E-06   28.3   7.2  133   23-165     3-138 (380)
264 TIGR03345 VI_ClpV1 type VI sec  95.2   0.071 1.8E-06   29.6   6.1   25   18-42    209-233 (852)
265 PRK08770 DNA polymerase III su  95.2     0.2 5.2E-06   26.8   9.6  111   20-160    41-156 (663)
266 COG2804 PulE Type II secretory  95.1   0.073 1.9E-06   29.5   6.1   15  412-426   433-447 (500)
267 PRK09111 DNA polymerase III su  95.1    0.21 5.4E-06   26.7   9.3  113   20-160    48-168 (600)
268 pfam00265 TK Thymidine kinase.  95.0   0.069 1.7E-06   29.7   5.6   35   21-56      5-39  (175)
269 pfam00448 SRP54 SRP54-type pro  95.0    0.23 5.8E-06   26.5  11.0  127   20-166     4-130 (196)
270 cd00984 DnaB_C DnaB helicase C  95.0    0.23 5.9E-06   26.5  11.3   36   20-55     16-51  (242)
271 PRK11054 helD DNA helicase IV;  95.0   0.046 1.2E-06   30.8   4.6   52    3-56    197-251 (684)
272 COG0210 UvrD Superfamily I DNA  94.9   0.078   2E-06   29.4   5.7   54    1-56      1-57  (655)
273 KOG0991 consensus               94.9   0.061 1.6E-06   30.0   5.1   25   17-41     48-72  (333)
274 CHL00095 clpC Clp protease ATP  94.9     0.2 5.1E-06   26.9   7.7   24   18-41    201-224 (823)
275 PRK13341 recombination factor   94.9    0.16   4E-06   27.5   7.1   22   18-39     53-74  (726)
276 pfam02702 KdpD Osmosensitive K  94.9    0.25 6.4E-06   26.3   9.3  104   19-149     7-114 (211)
277 TIGR00382 clpX ATP-dependent C  94.8   0.024 6.1E-07   32.4   2.9   28   15-42    150-177 (452)
278 TIGR00604 rad3 DNA repair heli  94.8   0.014 3.7E-07   33.8   1.7   28    5-32     18-54  (813)
279 PRK04132 replication factor C   94.8   0.038 9.8E-07   31.2   3.8   36    7-42     30-71  (863)
280 pfam06745 KaiC KaiC. This fami  94.8    0.16   4E-06   27.5   6.9   45    9-54      6-56  (231)
281 pfam03354 Terminase_1 Phage Te  94.8    0.19 4.8E-06   27.0   7.3   51    5-55      1-63  (473)
282 TIGR01241 FtsH_fam ATP-depende  94.7   0.018 4.6E-07   33.2   2.0   31    8-38     72-113 (505)
283 COG0464 SpoVK ATPases of the A  94.7   0.094 2.4E-06   28.9   5.7   23   18-40     19-41  (494)
284 PRK05917 DNA polymerase III su  94.6    0.29 7.3E-06   25.9   8.7   25   20-44     22-46  (290)
285 cd03115 SRP The signal recogni  94.6    0.29 7.4E-06   25.9  11.0   34   20-54      3-36  (173)
286 PRK04328 hypothetical protein;  94.5    0.18 4.5E-06   27.2   6.8   44    9-53     11-59  (250)
287 COG3267 ExeA Type II secretory  94.5    0.16   4E-06   27.5   6.5   53   13-67     45-104 (269)
288 pfam06733 DEAD_2 DEAD_2. This   94.5   0.025 6.4E-07   32.3   2.3   38   92-129   112-151 (168)
289 KOG1807 consensus               94.5    0.14 3.6E-06   27.8   6.1   65    3-67    379-448 (1025)
290 TIGR03117 cas_csf4 CRISPR-asso  94.5    0.23 5.9E-06   26.5   7.2   50   15-64     13-64  (636)
291 TIGR02538 type_IV_pilB type IV  94.5   0.044 1.1E-06   30.8   3.5   33  250-285   311-343 (577)
292 TIGR00064 ftsY signal recognit  94.4    0.22 5.5E-06   26.7   6.9  127   18-166    82-219 (284)
293 PRK11034 clpA ATP-dependent Cl  94.3    0.24   6E-06   26.4   7.0   25   18-42    208-232 (758)
294 TIGR00678 holB DNA polymerase   94.2    0.28 7.1E-06   26.0   7.1  128   19-161    16-159 (216)
295 pfam01580 FtsK_SpoIIIE FtsK/Sp  94.1    0.18 4.7E-06   27.1   6.0   42   16-57     37-81  (202)
296 PRK09694 hypothetical protein;  94.0    0.29 7.4E-06   25.9   7.0  101  313-418   552-676 (878)
297 COG2256 MGS1 ATPase related to  93.8    0.39 9.9E-06   25.1   7.3   22   18-39     49-70  (436)
298 cd01122 GP4d_helicase GP4d_hel  93.7    0.45 1.1E-05   24.8  11.7   50    3-54     14-67  (271)
299 TIGR02768 TraA_Ti Ti-type conj  93.5    0.47 1.2E-05   24.6  10.7  130    3-168   415-545 (888)
300 TIGR00345 arsA arsenite-activa  93.4    0.15 3.7E-06   27.7   4.5   41   27-67      7-50  (330)
301 KOG1131 consensus               93.4    0.34 8.7E-06   25.5   6.4   54    3-56     17-76  (755)
302 pfam01935 DUF87 Domain of unkn  93.4    0.18 4.6E-06   27.1   5.0   46   12-58     19-64  (218)
303 PRK10436 hypothetical protein;  93.4    0.26 6.5E-06   26.2   5.7   14   45-58     46-59  (461)
304 PRK10490 sensor protein KdpD;   93.1    0.55 1.4E-05   24.2   9.3  107   19-149    26-133 (895)
305 CHL00176 ftsH cell division pr  93.1     0.1 2.6E-06   28.6   3.3   34   18-55    211-244 (631)
306 cd01129 PulE-GspE PulE/GspE Th  93.0    0.35   9E-06   25.4   6.0   50    2-52     63-114 (264)
307 cd01393 recA_like RecA is a  b  93.0    0.39 9.9E-06   25.1   6.2   59    9-67      6-74  (226)
308 COG4626 Phage terminase-like p  92.9    0.58 1.5E-05   24.1  10.2   56    1-56     60-128 (546)
309 TIGR00631 uvrb excinuclease AB  92.9   0.068 1.7E-06   29.7   2.2   73    7-83     14-91  (667)
310 COG2812 DnaX DNA polymerase II  92.7     0.4   1E-05   25.1   6.0  112   20-160    41-156 (515)
311 TIGR03420 DnaA_homol_Hda DnaA   92.7    0.62 1.6E-05   23.9   9.2   93   20-162    41-133 (226)
312 PRK10263 DNA translocase FtsK;  92.6    0.42 1.1E-05   24.9   5.9   12   27-38    160-171 (1355)
313 pfam06068 TIP49 TIP49 C-termin  92.5    0.12 3.2E-06   28.1   3.2   24   18-41     51-74  (395)
314 KOG4150 consensus               92.4    0.68 1.7E-05   23.7   8.3   85  319-405   523-625 (1034)
315 TIGR00596 rad1 DNA repair prot  92.4    0.28 7.2E-06   26.0   4.9   81  363-449   542-626 (939)
316 PRK06321 replicative DNA helic  92.3    0.71 1.8E-05   23.5  10.9   41  379-422   413-455 (472)
317 TIGR01420 pilT_fam twitching m  92.1    0.37 9.3E-06   25.3   5.1   40   11-50    119-160 (350)
318 PRK08082 consensus              91.9    0.78   2E-05   23.3  10.6   42  379-422   388-431 (453)
319 PRK10733 hflB ATP-dependent me  91.8     0.2 5.2E-06   26.8   3.6   43    8-54    165-218 (644)
320 KOG0731 consensus               91.8    0.19 4.8E-06   27.1   3.3   22   18-39    345-366 (774)
321 PHA00350 putative assembly pro  91.8    0.28 7.1E-06   26.0   4.2   22   21-42      5-28  (402)
322 PRK07132 DNA polymerase III su  91.7    0.83 2.1E-05   23.1  10.7   23   20-42     23-45  (303)
323 PRK08760 replicative DNA helic  91.7    0.83 2.1E-05   23.1  10.5   42  379-422   413-457 (476)
324 TIGR02533 type_II_gspE general  91.6    0.53 1.4E-05   24.3   5.5   22  289-310   279-300 (495)
325 COG1224 TIP49 DNA helicase TIP  91.6    0.25 6.3E-06   26.3   3.8   23   19-41     67-89  (450)
326 PRK06731 flhF flagellar biosyn  91.6    0.86 2.2E-05   23.0   9.6   33   20-53     78-110 (270)
327 TIGR02782 TrbB_P P-type conjug  91.5    0.86 2.2E-05   23.0   6.5   34    7-40    128-162 (315)
328 TIGR03346 chaperone_ClpB ATP-d  91.4    0.32 8.3E-06   25.6   4.2   43  119-161   268-311 (852)
329 CHL00195 ycf46 Ycf46; Provisio  91.4    0.36 9.1E-06   25.3   4.4   44  354-397   351-398 (491)
330 TIGR03499 FlhF flagellar biosy  91.3     0.9 2.3E-05   22.9   8.3   48  357-404   220-270 (282)
331 COG0593 DnaA ATPase involved i  91.3    0.92 2.3E-05   22.9   9.6  103   19-162   115-220 (408)
332 COG3973 Superfamily I DNA and   91.3    0.59 1.5E-05   24.0   5.4   45   20-65    229-278 (747)
333 PRK05595 replicative DNA helic  91.2    0.93 2.4E-05   22.8  10.8   42  379-422   385-428 (444)
334 smart00491 HELICc2 helicase su  91.1    0.48 1.2E-05   24.6   4.9   55  340-394    23-82  (142)
335 COG3972 Superfamily I DNA and   90.8       1 2.6E-05   22.6   9.0  138   26-171   185-348 (660)
336 pfam05872 DUF853 Bacterial pro  90.8    0.33 8.3E-06   25.6   3.7   31   16-46     20-50  (504)
337 PRK13765 ATP-dependent proteas  90.7    0.58 1.5E-05   24.1   5.0   50    7-56     36-102 (637)
338 TIGR01242 26Sp45 26S proteasom  90.5     0.2 5.1E-06   26.9   2.5   20   19-38    158-177 (364)
339 TIGR02640 gas_vesic_GvpN gas v  90.5    0.46 1.2E-05   24.7   4.3   39   12-54     16-54  (265)
340 TIGR00635 ruvB Holliday juncti  90.4    0.24 6.2E-06   26.4   2.8   24   18-41     31-54  (305)
341 PRK08533 flagellar accessory p  90.4     1.1 2.8E-05   22.4  10.0   57   10-68     12-73  (230)
342 PRK10416 cell division protein  90.4     1.1 2.8E-05   22.3  10.4   18  351-368   367-384 (499)
343 pfam07015 VirC1 VirC1 protein.  90.1     1.2   3E-05   22.2   9.4  115   26-176    11-127 (231)
344 TIGR01243 CDC48 AAA family ATP  90.0    0.49 1.2E-05   24.5   4.1   23   18-40    241-263 (980)
345 PRK09302 circadian clock prote  89.9     1.2 3.1E-05   22.1  10.0   44   10-53     12-60  (501)
346 COG2205 KdpD Osmosensitive K+   89.9     1.2 3.1E-05   22.1   8.3   35   19-53     24-58  (890)
347 PRK00652 lpxK tetraacyldisacch  89.7     1.3 3.2E-05   22.0   8.3   22   26-47     60-81  (334)
348 PRK10867 signal recognition pa  89.7     1.3 3.2E-05   22.0   8.9   34   20-53    103-136 (453)
349 PRK10037 cell division protein  89.6     1.3 3.3E-05   22.0   7.3   98   26-128    11-128 (250)
350 TIGR00376 TIGR00376 DNA helica  89.5     1.3 3.3E-05   21.9   8.0   80    3-85    203-284 (709)
351 COG1222 RPT1 ATP-dependent 26S  88.8    0.93 2.4E-05   22.8   4.8   46  320-368   242-297 (406)
352 COG0467 RAD55 RecA-superfamily  88.8    0.96 2.4E-05   22.8   4.9   35   19-54     25-59  (260)
353 COG0542 clpA ATP-binding subun  88.7    0.64 1.6E-05   23.8   3.9   25   18-42    192-216 (786)
354 COG1066 Sms Predicted ATP-depe  88.5     1.5 3.9E-05   21.5   9.9  116   20-160    96-218 (456)
355 PRK09270 frcK putative fructos  88.5    0.95 2.4E-05   22.8   4.7   39   17-55     32-72  (230)
356 TIGR00368 TIGR00368 Mg chelata  88.5    0.27 6.8E-06   26.1   1.9   16   19-34    215-230 (505)
357 cd01130 VirB11-like_ATPase Typ  88.4     1.6   4E-05   21.5   6.5   46    4-51     11-57  (186)
358 TIGR01073 pcrA ATP-dependent D  88.3     1.2 3.1E-05   22.2   5.1  118    2-127     4-148 (811)
359 pfam01637 Arch_ATPase Archaeal  88.2     1.6 4.1E-05   21.4   9.1   49    8-56      8-59  (223)
360 TIGR02902 spore_lonB ATP-depen  88.1     1.1 2.8E-05   22.4   4.8   28    7-34     70-103 (532)
361 COG1192 Soj ATPases involved i  88.1    0.71 1.8E-05   23.5   3.8   34   26-59     12-47  (259)
362 PRK05636 replicative DNA helic  88.1     1.6 4.2E-05   21.3  10.4   13  410-422   482-494 (507)
363 cd01120 RecA-like_NTPases RecA  88.0     1.6 4.2E-05   21.3  10.2   34   20-54      2-35  (165)
364 TIGR02788 VirB11 P-type DNA tr  88.0    0.67 1.7E-05   23.7   3.7   16   16-31    157-172 (328)
365 KOG1806 consensus               88.0     1.4 3.6E-05   21.8   5.3   63    2-64    738-801 (1320)
366 PRK08694 consensus              87.9     1.7 4.3E-05   21.3  11.1   42  379-422   404-447 (468)
367 PRK09361 radB DNA repair and r  87.9     1.1 2.7E-05   22.5   4.6   46    9-55     10-60  (224)
368 TIGR03453 partition_RepA plasm  87.9    0.69 1.8E-05   23.6   3.6   12  147-158   129-140 (387)
369 PRK13869 plasmid-partitioning   87.6    0.75 1.9E-05   23.4   3.7   16  146-161   145-160 (405)
370 KOG0734 consensus               87.5     0.7 1.8E-05   23.6   3.5   44  411-454   655-709 (752)
371 PTZ00293 thymidine kinase; Pro  87.5     1.8 4.5E-05   21.1   7.6  105   21-160     8-114 (284)
372 KOG0736 consensus               87.4    0.47 1.2E-05   24.7   2.6   10  154-163   433-442 (953)
373 TIGR02785 addA_Gpos recombinat  87.4     0.8   2E-05   23.2   3.7   51    5-57      4-59  (1295)
374 PRK10923 glnG nitrogen regulat  87.3     1.8 4.6E-05   21.1   5.5   11   73-83     74-84  (469)
375 PRK13705 plasmid-partitioning   87.2    0.85 2.2E-05   23.1   3.8   15  144-158   128-142 (388)
376 PRK13894 conjugal transfer ATP  87.1     1.9 4.8E-05   21.0   6.1   17   66-82     27-43  (320)
377 TIGR00347 bioD dethiobiotin sy  87.0    0.53 1.4E-05   24.3   2.7   25   23-47      4-28  (187)
378 TIGR03600 phage_DnaB phage rep  86.9     1.9 4.9E-05   20.9   9.8   12  379-391   378-389 (421)
379 cd01131 PilT Pilus retraction   86.8       1 2.6E-05   22.5   4.0   31   20-50      4-34  (198)
380 KOG2543 consensus               86.7     1.7 4.3E-05   21.2   5.1  145    4-165    11-162 (438)
381 COG1219 ClpX ATP-dependent pro  86.7     0.6 1.5E-05   24.0   2.8   24   18-41     98-121 (408)
382 cd01127 TrwB Bacterial conjuga  86.7     1.9 4.8E-05   21.0   5.3   40   17-57     42-81  (410)
383 COG0003 ArsA Predicted ATPase   86.6    0.96 2.5E-05   22.7   3.8   45   20-65      4-51  (322)
384 KOG1942 consensus               86.5    0.66 1.7E-05   23.7   2.9   45   18-68     65-109 (456)
385 COG0552 FtsY Signal recognitio  86.5       2 5.2E-05   20.8   8.8   15  117-131   221-235 (340)
386 PRK12422 chromosomal replicati  86.5       2 5.2E-05   20.8  10.0   12  119-130   204-215 (455)
387 PHA02519 plasmid partition pro  86.3       1 2.7E-05   22.5   3.9   14  145-158   129-142 (387)
388 cd02035 ArsA ArsA ATPase funct  86.3       1 2.5E-05   22.6   3.7   28   25-53      7-34  (217)
389 TIGR01075 uvrD DNA helicase II  86.1     0.4   1E-05   25.0   1.7   32    2-35      4-35  (741)
390 TIGR03371 cellulose_yhjQ cellu  86.0     1.1 2.8E-05   22.4   3.8   32   26-58     11-44  (246)
391 TIGR00959 ffh signal recogniti  85.9    0.97 2.5E-05   22.7   3.5   42   26-70    111-158 (439)
392 KOG0733 consensus               85.7     1.7 4.3E-05   21.3   4.7   24   18-41    223-247 (802)
393 PRK05342 clpX ATP-dependent pr  85.5     0.9 2.3E-05   22.9   3.2   25   17-41    109-133 (411)
394 pfam00308 Bac_DnaA Bacterial d  85.4     2.3 5.8E-05   20.5  12.0  101   20-160    37-138 (219)
395 pfam10412 TrwB_AAD_bind Type I  85.4     2.1 5.3E-05   20.7   5.0   41   16-57     14-54  (386)
396 KOG0741 consensus               85.4    0.77   2E-05   23.3   2.8   36   18-55    257-292 (744)
397 PRK13896 cobyrinic acid a,c-di  85.4     1.6   4E-05   21.5   4.4   29   18-46      2-31  (432)
398 PRK10365 transcriptional regul  85.3     1.5 3.9E-05   21.5   4.3   17  388-404   352-368 (441)
399 COG1444 Predicted P-loop ATPas  85.3     2.3 5.9E-05   20.4   9.4   50    6-55    218-270 (758)
400 pfam09455 Cas_DxTHG CRISPR-ass  85.3     1.4 3.5E-05   21.8   4.1  134   28-167    24-185 (387)
401 TIGR02903 spore_lon_C ATP-depe  85.2     1.4 3.5E-05   21.8   4.0   34    7-40    160-199 (616)
402 pfam09140 MipZ ATPase MipZ. Mi  85.1     1.3 3.3E-05   22.0   3.9   28   26-54     10-39  (261)
403 COG0714 MoxR-like ATPases [Gen  85.1     1.8 4.7E-05   21.0   4.6   29   13-41     39-67  (329)
404 PRK06904 replicative DNA helic  84.7     2.3 5.7E-05   20.5   4.9   42  379-422   408-452 (472)
405 cd00550 ArsA_ATPase Oxyanion-t  84.3     1.4 3.6E-05   21.8   3.7   44   20-64      2-48  (254)
406 PRK05748 replicative DNA helic  84.1     2.6 6.6E-05   20.1   5.0   42  379-422   389-432 (448)
407 PRK13230 nitrogenase reductase  84.0     1.5 3.8E-05   21.6   3.8   33   19-52      3-35  (292)
408 TIGR02173 cyt_kin_arch cytidyl  83.7    0.73 1.9E-05   23.5   2.1   24   21-44      4-27  (173)
409 PRK00313 lpxK tetraacyldisacch  83.7     2.7   7E-05   20.0   7.4   21   26-46     62-82  (332)
410 PRK11361 acetoacetate metaboli  83.6     2.7   7E-05   20.0   6.8   21  385-405   353-373 (457)
411 PRK08006 replicative DNA helic  83.6     2.7   7E-05   20.0   5.1   42  379-422   410-453 (471)
412 COG0444 DppD ABC-type dipeptid  83.5     2.8 7.1E-05   20.0   5.4   24   18-41     32-55  (316)
413 PRK08840 replicative DNA helic  83.5     2.8 7.1E-05   19.9  11.1   43  379-423   403-447 (464)
414 cd02028 UMPK_like Uridine mono  83.4     2.3 5.8E-05   20.5   4.5   33   20-53      2-34  (179)
415 cd01394 radB RadB. The archaea  83.2     2.5 6.4E-05   20.2   4.6   46    9-55      6-56  (218)
416 pfam02374 ArsA_ATPase Anion-tr  83.2     1.8 4.5E-05   21.2   3.9   45   19-64      2-49  (304)
417 TIGR03018 pepcterm_TyrKin exop  83.1     1.8 4.7E-05   21.0   3.9   33   21-53     39-72  (207)
418 pfam00142 Fer4_NifH 4Fe-4S iro  83.1     1.8 4.5E-05   21.2   3.8   26   26-52      9-34  (269)
419 cd02040 NifH NifH gene encodes  82.9     1.8 4.6E-05   21.1   3.8   30   22-52      6-35  (270)
420 PRK07004 replicative DNA helic  82.8     2.8 7.2E-05   19.9   4.8   42  379-422   398-441 (460)
421 COG0465 HflB ATP-dependent Zn   82.7     1.8 4.5E-05   21.1   3.7   10  152-161   287-296 (596)
422 COG4646 DNA methylase [Transcr  82.6    0.66 1.7E-05   23.7   1.5   15  154-168   227-241 (637)
423 PRK05642 DNA replication initi  82.6       3 7.7E-05   19.7   9.5   92   20-161    48-139 (234)
424 cd01125 repA Hexameric Replica  82.5       3 7.7E-05   19.7   8.5   22   20-41      4-25  (239)
425 PRK10246 exonuclease subunit S  82.4    0.23 5.9E-06   26.5  -0.9   37    3-39     11-54  (1047)
426 COG1074 RecB ATP-dependent exo  81.9     2.6 6.5E-05   20.2   4.3   41   17-57     16-60  (1139)
427 COG0378 HypB Ni2+-binding GTPa  81.8     2.5 6.4E-05   20.2   4.2   34   19-54     15-48  (202)
428 KOG0732 consensus               81.5    0.63 1.6E-05   23.8   1.1   50   17-68    298-350 (1080)
429 KOG2028 consensus               81.3     3.4 8.6E-05   19.4   4.9   17   18-34    163-179 (554)
430 pfam07724 AAA_2 AAA domain (Cd  81.2     2.1 5.5E-05   20.6   3.7   36   19-56      5-40  (168)
431 TIGR02982 heterocyst_DevA ABC   81.0     3.5 8.8E-05   19.4   5.5   18  317-334   188-205 (220)
432 PHA02518 ParA-like protein; Pr  80.9     3.5 8.8E-05   19.4   6.5   38   26-65     10-49  (211)
433 COG3640 CooC CO dehydrogenase   80.8     2.4   6E-05   20.4   3.8   33   21-53      4-36  (255)
434 PRK07263 consensus              80.8     3.5 8.9E-05   19.3   4.9   14  409-422   424-437 (453)
435 pfam07726 AAA_3 ATPase family   80.6     1.8 4.5E-05   21.2   3.1   23   19-41      1-23  (131)
436 COG5245 DYN1 Dynein, heavy cha  80.3     2.5 6.4E-05   20.2   3.8   56   12-67   1488-1573(3164)
437 COG4170 SapD ABC-type antimicr  80.2     3.7 9.4E-05   19.2   4.7   19   20-38     36-54  (330)
438 KOG0743 consensus               79.9       1 2.7E-05   22.5   1.7   15  312-326   277-291 (457)
439 cd02042 ParA ParA and ParB of   79.9     2.7 6.8E-05   20.1   3.8   26   26-52      9-34  (104)
440 cd01121 Sms Sms (bacterial rad  79.8     3.8 9.6E-05   19.1  11.0   90   20-133    85-174 (372)
441 pfam01443 Viral_helicase1 Vira  79.8     3.8 9.6E-05   19.1   6.7   37  119-164    61-97  (226)
442 COG1221 PspF Transcriptional r  79.7     3.8 9.7E-05   19.1   5.7   96   18-145   102-198 (403)
443 TIGR00609 recB exodeoxyribonuc  79.6     3.2 8.3E-05   19.5   4.2   39   17-55      9-58  (1324)
444 PRK00090 bioD dithiobiotin syn  79.6     2.9 7.4E-05   19.8   3.9   25   22-46      5-29  (223)
445 pfam06564 YhjQ YhjQ protein. T  79.4     2.5 6.4E-05   20.2   3.6   32   26-58     11-44  (244)
446 PRK13873 conjugal transfer ATP  79.4     3.9 9.9E-05   19.1   5.0   14  247-260   538-551 (815)
447 PRK00771 signal recognition pa  79.4     3.9 9.9E-05   19.1   7.9   33   20-53    100-132 (433)
448 pfam01656 CbiA CobQ/CobB/MinD/  79.1     2.4   6E-05   20.4   3.3   26   26-52      8-33  (212)
449 PRK00149 dnaA chromosomal repl  78.8     4.1  0.0001   18.9  12.3   11  119-129   210-220 (447)
450 TIGR02211 LolD_lipo_ex lipopro  78.7     1.5 3.9E-05   21.5   2.3   21  320-340   191-211 (221)
451 pfam06414 Zeta_toxin Zeta toxi  78.7     3.3 8.4E-05   19.5   4.0   37   17-56     11-48  (191)
452 PTZ00301 uridine kinase; Provi  78.7     4.1  0.0001   18.9   4.8   35   20-54      6-41  (210)
453 COG4128 Zot Zonula occludens t  78.6     4.1 0.00011   18.9   4.6   11  119-129    83-93  (398)
454 KOG0243 consensus               78.5     1.1 2.8E-05   22.4   1.5   51  122-176   333-384 (1041)
455 PRK06067 flagellar accessory p  78.4     4.2 0.00011   18.9  10.8   58    9-68     19-81  (241)
456 COG0132 BioD Dethiobiotin synt  78.4     4.2 0.00011   18.9   4.8   29   18-46      3-32  (223)
457 cd02025 PanK Pantothenate kina  78.4     3.9   1E-04   19.1   4.3   34   20-53      2-36  (220)
458 cd03109 DTBS Dethiobiotin synt  78.3     3.1 7.9E-05   19.7   3.7   34   20-54      2-35  (134)
459 CHL00175 minD septum-site dete  78.1     3.3 8.3E-05   19.5   3.8   26   26-52     23-48  (279)
460 COG2255 RuvB Holliday junction  78.1     2.3 5.9E-05   20.4   3.0   23   19-41     54-76  (332)
461 cd02117 NifH_like This family   78.0       3 7.8E-05   19.7   3.6   31   21-52      4-34  (212)
462 KOG0730 consensus               77.7     4.4 0.00011   18.7   5.4   21   19-39    220-240 (693)
463 PRK01906 tetraacyldisaccharide  77.4     3.2 8.1E-05   19.6   3.6   21   27-47     68-88  (339)
464 pfam05496 RuvB_N Holliday junc  77.3     2.5 6.4E-05   20.2   3.1   23   19-41     52-74  (234)
465 COG0606 Predicted ATPase with   77.1     2.7 6.8E-05   20.1   3.1   35  128-165   177-211 (490)
466 KOG0921 consensus               77.0     4.6 0.00012   18.6   6.3  115   11-129   387-505 (1282)
467 TIGR02237 recomb_radB DNA repa  76.8     4.4 0.00011   18.7   4.2   30   22-52     17-46  (223)
468 PRK12374 putative dithiobiotin  76.5       4  0.0001   19.0   3.9   27   20-46      6-32  (231)
469 COG0541 Ffh Signal recognition  76.5     4.7 0.00012   18.6   4.9   33   20-53    103-135 (451)
470 cd02034 CooC The accessory pro  76.5     3.8 9.7E-05   19.1   3.8   36   21-57      3-40  (116)
471 KOG0729 consensus               76.5     2.1 5.4E-05   20.6   2.5   11  358-368   313-323 (435)
472 PRK11823 DNA repair protein Ra  76.4     4.8 0.00012   18.5  10.2   89   20-133    93-181 (454)
473 PRK00080 ruvB Holliday junctio  76.2     3.1 7.9E-05   19.7   3.3   23   19-41     53-75  (328)
474 PRK13909 putative recombinatio  76.0     4.9 0.00012   18.5   4.3   35   21-55      2-38  (911)
475 cd02036 MinD Bacterial cell di  75.9     3.6 9.1E-05   19.3   3.5   26   26-52      9-34  (179)
476 PRK13900 type IV secretion sys  75.8     4.6 0.00012   18.7   4.0   14   67-80     16-29  (332)
477 PRK13849 putative crown gall t  75.7       5 0.00013   18.4   8.2  115   26-176    11-127 (231)
478 PRK13891 conjugal transfer pro  75.5       5 0.00013   18.4   4.6   35  354-389   713-753 (852)
479 PRK00091 miaA tRNA delta(2)-is  75.4     2.6 6.7E-05   20.1   2.7   22   20-41      7-28  (304)
480 PRK08084 DNA replication initi  75.4     5.1 0.00013   18.4   8.7   92   20-160    48-139 (235)
481 cd01983 Fer4_NifH The Fer4_Nif  75.2     3.7 9.3E-05   19.2   3.4   25   27-51      9-33  (99)
482 PRK11608 pspF phage shock prot  75.0     5.2 0.00013   18.3   5.4   59    7-66     19-77  (325)
483 pfam07728 AAA_5 AAA domain (dy  74.7       3 7.6E-05   19.8   2.9   23   19-41      1-23  (139)
484 COG2894 MinD Septum formation   74.7     3.6 9.1E-05   19.3   3.2   95   27-124    13-120 (272)
485 PRK10787 DNA-binding ATP-depen  74.5     4.8 0.00012   18.5   3.9   38    7-44    336-376 (784)
486 PRK06827 phosphoribosylpyropho  74.5     5.4 0.00014   18.2   6.6   82   15-99    263-345 (381)
487 COG0324 MiaA tRNA delta(2)-iso  74.4       3 7.8E-05   19.7   2.9   22   20-41      6-27  (308)
488 cd02023 UMPK Uridine monophosp  74.4     5.4 0.00014   18.2   4.4   30   21-53      3-32  (198)
489 KOG1564 consensus               73.9     5.5 0.00014   18.1   6.9  120   22-148   107-242 (351)
490 PRK10876 recB exonuclease V su  73.9     5.5 0.00014   18.1   5.1   37   17-53     16-63  (1181)
491 PRK07773 replicative DNA helic  73.8     5.6 0.00014   18.1  11.0  137   20-158   206-360 (868)
492 PRK13764 ATPase; Provisional    73.6     5.2 0.00013   18.3   3.9   31   16-46    258-288 (605)
493 TIGR02759 TraD_Ftype type IV c  73.5     5.7 0.00014   18.1   4.0   33   19-51    210-242 (613)
494 COG1855 ATPase (PilT family) [  73.5     5.3 0.00014   18.3   3.9   29   18-46    264-292 (604)
495 PRK08506 replicative DNA helic  73.4     5.7 0.00015   18.1  11.0  138   20-158   196-350 (473)
496 PTZ00112 origin recognition co  73.1     4.4 0.00011   18.8   3.4   27   18-44    293-320 (650)
497 cd01363 Motor_domain Myosin an  73.1     1.5 3.8E-05   21.6   1.0   26   11-36     16-43  (186)
498 KOG1133 consensus               73.0     5.8 0.00015   18.0   4.5   37    2-38     15-55  (821)
499 KOG0987 consensus               72.7     5.9 0.00015   18.0   6.1  124    2-146   117-245 (540)
500 cd00106 KISc Kinesin motor dom  72.7     1.9 4.8E-05   21.0   1.4   29    8-36     68-98  (328)

No 1  
>KOG0385 consensus
Probab=100.00  E-value=0  Score=517.76  Aligned_cols=422  Identities=20%  Similarity=0.322  Sum_probs=338.0

Q ss_pred             CCCHHHHHHHHHHHH---CC-CEEEEECCCCCHHHHHHHHHHHHHH-CC-CCCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             874789999999996---79-8099958899868999999999997-59-994999916046569999999985588881
Q gi|255764515|r    2 NLAPHQTKIVDWILD---HK-RCAIWASMGSGKTVSVLTALSYIHL-WG-EKSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~---~~-~~ll~~~~G~GKT~~al~~~~~l~~-~~-~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      +|+|||.+|++|+..   ++ +|+|||+||+|||+|+|+++.++.. .+ .+|.||+||+|++. .|..||.+|+  |.+
T Consensus       167 ~lr~YQveGlnWLi~l~engingILaDEMGLGKTlQtIs~l~yl~~~~~~~GPfLVi~P~StL~-NW~~Ef~rf~--P~l  243 (971)
T KOG0385         167 ELRDYQLEGLNWLISLYENGINGILADEMGLGKTLQTISLLGYLKGRKGIPGPFLVIAPKSTLD-NWMNEFKRFT--PSL  243 (971)
T ss_pred             CCCHHHHCCHHHHHHHHHCCCCCEEEHHCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEHHHHH-HHHHHHHHHC--CCC
T ss_conf             5543320337999999865766584231045338999999999998517999849981276678-9999999768--986


Q ss_pred             EEEEEECCHHHHHHHHC-----CCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             59998589789888730-----7798699806420233442000113220440453100246543115677776654305
Q gi|255764515|r   76 NISVITGTVKQRTKVLK-----TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE  150 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~~~-----~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~  150 (458)
                      .+.++.|+...|.....     +..+|+|+|||..-.. +..+...+|..+||||||++||.    .|+..+.+...  +
T Consensus       244 ~~~~~~Gdk~eR~~~~r~~~~~~~fdV~iTsYEi~i~d-k~~lk~~~W~ylvIDEaHRiKN~----~s~L~~~lr~f--~  316 (971)
T KOG0385         244 NVVVYHGDKEERAALRRDIMLPGRFDVCITSYEIAIKD-KSFLKKFNWRYLVIDEAHRIKNE----KSKLSKILREF--K  316 (971)
T ss_pred             CEEEEECCHHHHHHHHHHHHCCCCCCEEEEHHHHHHHH-HHHHHCCCCEEEEECHHHHHCCH----HHHHHHHHHHH--C
T ss_conf             34988479999999999853157876686407889866-88986199349995236541462----44899999985--6


Q ss_pred             CCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98079965840231001013467751788877532778877736956403300002455554558999997424543320
Q gi|255764515|r  151 SERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLD  230 (458)
Q Consensus       151 ~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~  230 (458)
                      +.++++|||||+||++.|||++|+|+-|...  .....| ..|+........         ......++..+.++.+++.
T Consensus       317 ~~nrLLlTGTPLQNNL~ELWaLLnFllPdiF--~~~e~F-~swF~~~~~~~~---------~e~v~~Lh~vL~pFlLRR~  384 (971)
T KOG0385         317 TDNRLLLTGTPLQNNLHELWALLNFLLPDIF--NSAEDF-DSWFDFTNCEGD---------QELVSRLHKVLRPFLLRRI  384 (971)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHCHHHC--CCHHHH-HHHHCCCCCCCC---------HHHHHHHHHHHHHHHHHHH
T ss_conf             6552675278543649999999976221420--578899-999711343355---------8999999986638999998


Q ss_pred             CCCCC-CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHHHCCCCCCCCCCCCCC-------
Q ss_conf             00010-01001100034524536899888999999851033452-0223478888754203541000223430-------
Q gi|255764515|r  231 IADYQ-NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENI-EAFNSASKTVKCLQLANGAVYYDEEKHW-------  301 (458)
Q Consensus       231 ~~~~~-~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~-~~~~~~~~~~~l~q~~~~~~~~~~~~~~-------  301 (458)
                      +.++. .+|++......+.|++-|.+-|..+...-+..+.+... .......-++.|++.|+||.+++.....       
T Consensus       385 K~dVe~sLppKkE~~iyvgms~mQkk~Y~~iL~kdl~~~n~~~~~~k~kL~NI~mQLRKccnHPYLF~g~ePg~pyttde  464 (971)
T KOG0385         385 KSDVEKSLPPKKELIIYVGMSSMQKKWYKAILMKDLDALNGEGKGEKTKLQNIMMQLRKCCNHPYLFDGAEPGPPYTTDE  464 (971)
T ss_pred             HHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHHCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             88787418975326786065088999999999611375426663203789999999997469964148888899988621


Q ss_pred             -HHCCCCCCCCHHHHHHC--CCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCC--CCEEE
Q ss_conf             -00134333325665412--488403422236788866410----------0026533445899876424588--55899
Q gi|255764515|r  302 -KEVHDEKIKALEVIIEK--ANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGK--IPLLF  366 (458)
Q Consensus       302 -~~~~~~k~~~l~~il~~--~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~--~~vli  366 (458)
                       ....|+|+..|..++..  ..|.+|+||+++..+++.+..          ++-|..+.++|...|+.||.+.  .-|++
T Consensus       465 hLv~nSGKm~vLDkLL~~Lk~~GhRVLIFSQmt~mLDILeDyc~~R~y~ycRiDGSt~~eeR~~aI~~fn~~~s~~FiFl  544 (971)
T KOG0385         465 HLVTNSGKMLVLDKLLPKLKEQGHRVLIFSQMTRMLDILEDYCMLRGYEYCRLDGSTSHEEREDAIEAFNAPPSEKFIFL  544 (971)
T ss_pred             HHHHCCCCEEHHHHHHHHHHHCCCEEEEEHHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEE
T ss_conf             78754761116998889998489769982698889999999987517526872388870789999986389976258999


Q ss_pred             EEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf             84422111622001785999908998986864456666202202037877528999985899689999999999999999
Q gi|255764515|r  367 AHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDL  446 (458)
Q Consensus       367 ~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~  446 (458)
                      +|++|||.||||+. +++||+||..|||....||.+|+     |||||+++|.||+||+++||||+|+++...|..+...
T Consensus       545 LSTRAGGLGINL~a-ADtVIlyDSDWNPQ~DLQAmDRa-----HRIGQ~K~V~V~RLitentVEe~IveRA~~KL~Ld~~  618 (971)
T KOG0385         545 LSTRAGGLGINLTA-ADTVILYDSDWNPQVDLQAMDRA-----HRIGQKKPVVVYRLITENTVEEKIVERAAAKLRLDKL  618 (971)
T ss_pred             EECCCCCCCCCCCC-CCEEEEECCCCCCHHHHHHHHHH-----HHCCCCCCEEEEEEECCCHHHHHHHHHHHHHHCHHHH
T ss_conf             85046666302223-64799966899821437889988-----8607877159999753551899999999987441553


Q ss_pred             HHHHH
Q ss_conf             98554
Q gi|255764515|r  447 LLNAL  451 (458)
Q Consensus       447 ~~~~~  451 (458)
                      |++..
T Consensus       619 VIq~g  623 (971)
T KOG0385         619 VIQQG  623 (971)
T ss_pred             HHCCC
T ss_conf             01377


No 2  
>KOG0384 consensus
Probab=100.00  E-value=0  Score=514.16  Aligned_cols=419  Identities=20%  Similarity=0.315  Sum_probs=338.1

Q ss_pred             CCCCHHHHHHHHHHH----HCCCEEEEECCCCCHHHHHHHHHHHHHHCC--CCCEEEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             987478999999999----679809995889986899999999999759--99499991604656999999998558888
Q gi|255764515|r    1 MNLAPHQTKIVDWIL----DHKRCAIWASMGSGKTVSVLTALSYIHLWG--EKSVLVIAPLRVAQSVWTSEVQRWSNFSH   74 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~----~~~~~ll~~~~G~GKT~~al~~~~~l~~~~--~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~   74 (458)
                      .+||+||++|++||+    ++.+|+||||||||||+|+|+++..|...+  .+|.|||||-|.+. .|++||+.|+   .
T Consensus       369 ~~LRDYQLeGlNWLl~~W~k~~n~ILADEMGLGKTvQtI~FLs~l~~~~~~~GPfLvVvPLSTi~-~W~ref~~Wt---d  444 (1373)
T KOG0384         369 NELRDYQLEGLNWLLYSWYKRNNCILADEMGLGKTVQTITFLSYLFHSLQIHGPFLVVVPLSTIT-AWEREFETWT---D  444 (1373)
T ss_pred             CCHHHHHHCCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCH-HHHHHHHHHH---H
T ss_conf             61446563132899998864686475400257740134599999998454478869998640007-8999999875---1


Q ss_pred             CEEEEEECCHHHHHHHHC------C-----CCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHH
Q ss_conf             159998589789888730------7-----79869980642023344200011322044045310024654311567777
Q gi|255764515|r   75 MNISVITGTVKQRTKVLK------T-----PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARA  143 (458)
Q Consensus        75 ~~~~~~~g~~~~r~~~~~------~-----~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~  143 (458)
                      +++.+++|+...|.-+-.      .     ..++++||||.+-.+.. .+..++|.+++|||||++||.    .|+++..
T Consensus       445 mN~ivY~G~~~SR~~I~qYE~~~~~~~~~~KFn~LlTTyE~vLkDk~-~L~~i~W~~~~vDEAHRLKN~----~s~Ly~~  519 (1373)
T KOG0384         445 MNVIVYHGNLESRQLIRQYEFYHSSNTKKLKFNALLTTYEIVLKDKA-ELSKIPWRYLLVDEAHRLKND----ESKLYES  519 (1373)
T ss_pred             CCEEEEECCHHHHHHHHHHHEEECCCCCEEEEEEEEHHHHHHHCCHH-HHCCCCEEEEEECHHHHHCCC----HHHHHHH
T ss_conf             46588826656789998765045477751788764001898972688-864575278974166550650----4489999


Q ss_pred             HHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             66543059807996584023100101346775178887753277887773695640330000245555455899999742
Q gi|255764515|r  144 LAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLS  223 (458)
Q Consensus       144 l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~  223 (458)
                      +...  +..+++++||||.||++.|||++++||+|+..  .+...|...+ ...             .......+...|.
T Consensus       520 L~~f--~~~hrlLiTGTPLQNsi~EL~sLL~Fl~P~kF--~~~~ef~~e~-~~~-------------~e~~v~~Lq~~L~  581 (1373)
T KOG0384         520 LNQF--KMNHRLLITGTPLQNSLKELWSLLHFLMPGKF--DSWDEFLEEF-DEE-------------TEEQVRKLQQILK  581 (1373)
T ss_pred             HHHH--HHCCEEEEECCCCCCCHHHHHHHHHHHCCCCC--CCHHHHHHHH-CCH-------------HHHHHHHHHHHHH
T ss_conf             9986--43075775478540319999999877375557--8678998873-302-------------3889999999876


Q ss_pred             HHHHHHHCCCCC-CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCC-CCHHHHHHHHHHHHHHCCCCCCCCCCCCC-
Q ss_conf             454332000010-010011000345245368998889999998510334-52022347888875420354100022343-
Q gi|255764515|r  224 DCCLSLDIADYQ-NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYDEEKH-  300 (458)
Q Consensus       224 ~~~~~~~~~~~~-~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~-~~~~~~~~~~~~~l~q~~~~~~~~~~~~~-  300 (458)
                      |+++++.++|+. .+|+......+|+|+.-|.+.|..+....+..+..+ .....+.+..++.|+..|+||.++..... 
T Consensus       582 P~~LRRlKkDVEKSLp~K~E~IlrVels~lQk~yYk~ILtkN~~~LtkG~~g~~~~llNimmELkKccNHpyLi~gaee~  661 (1373)
T KOG0384         582 PFLLRRLKKDVEKSLPPKEETILRVELSDLQKQYYKAILTKNFSALTKGAKGSTPSLLNIMMELKKCCNHPYLIKGAEEK  661 (1373)
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHH
T ss_conf             89999988877522786312256540567899999999985399983667889802999999999864780004858888


Q ss_pred             ---------------CHHCCCCCCCCHHHHHHC--CCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHH
Q ss_conf             ---------------000134333325665412--488403422236788866410----------00265334458998
Q gi|255764515|r  301 ---------------WKEVHDEKIKALEVIIEK--ANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCT  353 (458)
Q Consensus       301 ---------------~~~~~~~k~~~l~~il~~--~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~  353 (458)
                                     .....|+|+..|..++.+  ..|++|+||++.+.+++.|..          ++-|....+-|+.+
T Consensus       662 ~~~~~~~~~~d~~l~~lI~sSGKlVLLDKLL~rLk~~GHrVLIFSQMVRmLDIL~eYL~~r~ypfQRLDGsvrgelRq~A  741 (1373)
T KOG0384         662 ILGDFRDKMRDEALQALIQSSGKLVLLDKLLPRLKEGGHRVLIFSQMVRMLDILAEYLSLRGYPFQRLDGSVRGELRQQA  741 (1373)
T ss_pred             HHHHHHHCCHHHHHHHHHHHCCCEEEHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH
T ss_conf             88765301467999999971685886987789986189459971999999999999999738861114687616889988


Q ss_pred             HHHHCCCCCC--EEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHH
Q ss_conf             7642458855--89984422111622001785999908998986864456666202202037877528999985899689
Q gi|255764515|r  354 IQEWNEGKIP--LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDE  431 (458)
Q Consensus       354 i~~f~~~~~~--vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide  431 (458)
                      |+.||++..+  |+|+||+|||.||||..|+ +||.||..|||....||.+|+     |||||++.|.||+||++||+||
T Consensus       742 iDhFnap~SddFvFLLSTRAGGLGINLatAD-TVIIFDSDWNPQNDLQAqARa-----HRIGQkk~VnVYRLVTk~TvEe  815 (1373)
T KOG0384         742 IDHFNAPDSDDFVFLLSTRAGGLGINLATAD-TVIIFDSDWNPQNDLQAQARA-----HRIGQKKHVNVYRLVTKNTVEE  815 (1373)
T ss_pred             HHHCCCCCCCCEEEEEECCCCCCCCCCCCCC-EEEEECCCCCCCHHHHHHHHH-----HHHCCCCEEEEEEEECCCCHHH
T ss_conf             8743699988649998315676640224466-699968999950578999988-----6606645478999745784489


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999985541
Q gi|255764515|r  432 LVLQRLRTKSTIQDLLLNALK  452 (458)
Q Consensus       432 ~i~~~~~~K~~~~~~~~~~~~  452 (458)
                      .|+++...|.-+--+|+..+.
T Consensus       816 EilERAk~KmvLD~aVIQ~m~  836 (1373)
T KOG0384         816 EILERAKLKMVLDHAVIQRMD  836 (1373)
T ss_pred             HHHHHHHHHHHHHHHHHHHHC
T ss_conf             999999887515899987511


No 3  
>KOG0389 consensus
Probab=100.00  E-value=0  Score=505.98  Aligned_cols=436  Identities=19%  Similarity=0.270  Sum_probs=333.1

Q ss_pred             CCCCHHHHHHHHHHH---HCC-CEEEEECCCCCHHHHHHHHHHHHHHCCC-CCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             987478999999999---679-8099958899868999999999997599-94999916046569999999985588881
Q gi|255764515|r    1 MNLAPHQTKIVDWIL---DHK-RCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~---~~~-~~ll~~~~G~GKT~~al~~~~~l~~~~~-~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      ++|.|||..||+|+.   +++ +|+||||||+|||+|+|+++++|...|. .|-|||||+|+++| |.+||.||+  |.+
T Consensus       398 i~LkdYQlvGvNWL~Llyk~~l~gILADEMGLGKTiQvIaFlayLkq~g~~gpHLVVvPsSTleN-WlrEf~kwC--Psl  474 (941)
T KOG0389         398 IQLKDYQLVGVNWLLLLYKKKLNGILADEMGLGKTIQVIAFLAYLKQIGNPGPHLVVVPSSTLEN-WLREFAKWC--PSL  474 (941)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCEEHHHCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCHHHHH-HHHHHHHHC--CCE
T ss_conf             73342220228999999974233053222057633489999999997299998379920316888-999999759--752


Q ss_pred             EEEEEECCHHHHHHHH------CCCCCEEEECCCCHH--HHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             5999858978988873------077986998064202--33442000113220440453100246543115677776654
Q gi|255764515|r   76 NISVITGTVKQRTKVL------KTPAVLYVINFENLG--WLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKP  147 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~~------~~~~~i~i~s~e~~~--~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~  147 (458)
                      ++..++|+..+|..+-      ..+++|+++||..+.  ...+.++..++|+.+|.||+|.+||    ..|.|++-++.+
T Consensus       475 ~Ve~YyGSq~ER~~lR~~i~~~~~~ydVllTTY~la~~~kdDRsflk~~~~n~viyDEgHmLKN----~~SeRy~~LM~I  550 (941)
T KOG0389         475 KVEPYYGSQDERRELRERIKKNKDDYDVLLTTYNLAASSKDDRSFLKNQKFNYVIYDEGHMLKN----RTSERYKHLMSI  550 (941)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCHHHHHHHHHCCCCEEEECCHHHHHC----CCHHHHHHHCCC
T ss_conf             8774157689999999998616888528998721103886778999866666799613265421----334988875064


Q ss_pred             HHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             30598079965840231001013467751788877532778877736956403300002455554558999997424543
Q gi|255764515|r  148 AWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCL  227 (458)
Q Consensus       148 ~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~  227 (458)
                        +|..|++|||||.||++.||+++|.|+-|. .|.....++..-+.............-. .. ..-..-...+.++++
T Consensus       551 --~An~RlLLTGTPLQNNL~ELiSLL~FvlP~-vF~~~~~dl~~if~~k~~~d~d~e~~~l-~q-erIsrAK~im~PFIL  625 (941)
T KOG0389         551 --NANFRLLLTGTPLQNNLKELISLLAFVLPK-VFDSSMEDLDVIFKAKKTSDGDIENALL-SQ-ERISRAKTIMKPFIL  625 (941)
T ss_pred             --CCCCEEEEECCCCCCCHHHHHHHHHHHHHH-HHHCCCHHHHHHHHCCCCCCCHHHHHHH-HH-HHHHHHHHHHHHHHH
T ss_conf             --655358851874201299999999997457-5532224799998246776430467788-99-999999975427889


Q ss_pred             HHHCCCC-CCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCH-HHHHHHHHHHHHHCCCCCCCCCCC-------
Q ss_conf             3200001-0010011000345245368998889999998510334520-223478888754203541000223-------
Q gi|255764515|r  228 SLDIADY-QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIE-AFNSASKTVKCLQLANGAVYYDEE-------  298 (458)
Q Consensus       228 ~~~~~~~-~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~q~~~~~~~~~~~-------  298 (458)
                      ++.+.++ ..+|+...+...++|+..|...|+++....-......... .......++.++++++||.++...       
T Consensus       626 RR~K~qVL~~LPpK~~~Ie~c~mse~Q~~~Y~~~~~~~~~~~~~~~~ns~~~~~~vlmqlRK~AnHPLL~R~~Y~de~L~  705 (941)
T KOG0389         626 RRLKSQVLKQLPPKIQRIEYCEMSEKQKQLYDELIELYDVKLNEVSKNSELKSGNVLMQLRKAANHPLLFRSIYTDEKLR  705 (941)
T ss_pred             HHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHCCHHHHH
T ss_conf             99899898746974325676424638999999999998511043223310256139999998735725778760388999


Q ss_pred             ----------------C-------------------------------CCHHCCCCCCCCHHHHHHC--CCCCEEEEHHH
Q ss_conf             ----------------4-------------------------------3000134333325665412--48840342223
Q gi|255764515|r  299 ----------------K-------------------------------HWKEVHDEKIKALEVIIEK--ANAAPIIVAYH  329 (458)
Q Consensus       299 ----------------~-------------------------------~~~~~~~~k~~~l~~il~~--~~~~kviif~~  329 (458)
                                      .                               ...-..|+|++.|..++.+  .+|.+|+||++
T Consensus       706 ~mak~il~e~ay~~~n~qyIfEDm~~msDfelHqLc~~f~~~~~f~L~d~~~mdSgK~r~L~~LLp~~k~~G~RVLiFSQ  785 (941)
T KOG0389         706 KMAKRILNEPAYKKANEQYIFEDMEVMSDFELHQLCCQFRHLSKFQLKDDLWMDSGKCRKLKELLPKIKKKGDRVLIFSQ  785 (941)
T ss_pred             HHHHHHHCCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEEH
T ss_conf             99999727553320278888998876518999999986578765323884443003276999987887616877999608


Q ss_pred             HHHHHHHHHHCC---------CCCCC-HHHHHHHHHHHCCC-CCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHH
Q ss_conf             678886641000---------26533-44589987642458-85589984422111622001785999908998986864
Q gi|255764515|r  330 FNSDLARLQKAF---------PQGRT-LDKDPCTIQEWNEG-KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQ  398 (458)
Q Consensus       330 ~~~~~~~i~~~~---------~~g~~-~~~r~~~i~~f~~~-~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~  398 (458)
                      |..+++.+...+         .+|+| .+.|+.+|++|+.. .+.|+++|++|||.||||+.| |+||.+|+++||-...
T Consensus       786 FTqmLDILE~~L~~l~~~ylRLDGsTqV~~RQ~lId~Fn~d~difVFLLSTKAGG~GINLt~A-n~VIihD~dFNP~dD~  864 (941)
T KOG0389         786 FTQMLDILEVVLDTLGYKYLRLDGSTQVNDRQDLIDEFNTDKDIFVFLLSTKAGGFGINLTCA-NTVIIHDIDFNPYDDK  864 (941)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHCCCCCEEEEEEEECCCCCEECCCCC-CEEEEEECCCCCCCCC
T ss_conf             889999999999862733786148864138999998626677557999861467650211236-4589960577975520


Q ss_pred             HHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             45666620220203787752899998589968999999999999999998554137
Q gi|255764515|r  399 QMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE  454 (458)
Q Consensus       399 Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~~~~~  454 (458)
                      ||++|+     ||.||+++|+||+||+++||||.|+++...|..+-.++.+..|.+
T Consensus       865 QAEDRc-----HRvGQtkpVtV~rLItk~TIEE~I~~lA~~KL~Le~~lt~~~k~~  915 (941)
T KOG0389         865 QAEDRC-----HRVGQTKPVTVYRLITKSTIEEGILRLAKTKLALEADLTEDGKGV  915 (941)
T ss_pred             HHHHHH-----HHHCCCCEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCH
T ss_conf             468888-----761785406999987457189999999987654555532576431


No 4  
>KOG0392 consensus
Probab=100.00  E-value=0  Score=503.64  Aligned_cols=431  Identities=21%  Similarity=0.294  Sum_probs=341.8

Q ss_pred             CCCHHHHHHHHHHH--HC--CCEEEEECCCCCHHHHHHHHHHHHHHC--------CCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             87478999999999--67--980999588998689999999999975--------9994999916046569999999985
Q gi|255764515|r    2 NLAPHQTKIVDWIL--DH--KRCAIWASMGSGKTVSVLTALSYIHLW--------GEKSVLVIAPLRVAQSVWTSEVQRW   69 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~--~~--~~~ll~~~~G~GKT~~al~~~~~l~~~--------~~~~~LIv~P~~l~~~~W~~Ei~kf   69 (458)
                      +||.||++||+|+.  +.  -.|+||||||+|||+|+|++++.-...        ...|.|||||.++.. .|+.|+.+|
T Consensus       975 ~LRkYQqEGVnWLaFLnky~LHGILcDDMGLGKTLQticilAsd~y~r~s~~~e~~~~PSLIVCPsTLtG-HW~~E~~kf 1053 (1549)
T KOG0392         975 KLRKYQQEGVNWLAFLNKYKLHGILCDDMGLGKTLQTICILASDHYKRRSESSEFNRLPSLIVCPSTLTG-HWKSEVKKF 1053 (1549)
T ss_pred             HHHHHHHHCCHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCHHHCCCCEEEECCCHHHH-HHHHHHHHH
T ss_conf             8999988025899999873335454213463278999999978887502466011358758988700114-899999875


Q ss_pred             CCCCCCEEEEEECCHHHHHHHHCC--CCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             588881599985897898887307--798699806420233442000113220440453100246543115677776654
Q gi|255764515|r   70 SNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKP  147 (458)
Q Consensus        70 ~~~~~~~~~~~~g~~~~r~~~~~~--~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~  147 (458)
                      +++  +++..+.|.+..|...-..  ..+|+|++|+.++++...+ ....|..+|+||+|-+||..+    +..++...+
T Consensus      1054 ~pf--L~v~~yvg~p~~r~~lR~q~~~~~iiVtSYDv~RnD~d~l-~~~~wNYcVLDEGHVikN~kt----kl~kavkqL 1126 (1549)
T KOG0392        1054 FPF--LKVLQYVGPPAERRELRDQYKNANIIVTSYDVVRNDVDYL-IKIDWNYCVLDEGHVIKNSKT----KLTKAVKQL 1126 (1549)
T ss_pred             CCH--HHHHHHCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHH-HHCCCCEEEECCCCEECCHHH----HHHHHHHHH
T ss_conf             630--1234313775877777754366656996589988789999-855222699407604211388----999999997


Q ss_pred             HHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHH--HHHHHHHHHHHHHHHHH
Q ss_conf             3059807996584023100101346775178887753277887773695640330000245--55545589999974245
Q gi|255764515|r  148 AWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRY--TAKETAQKEIEAQLSDC  225 (458)
Q Consensus       148 ~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~--~~~~~~~~~l~~~l~~~  225 (458)
                        .+.+|+.|||||++|++.|+|++++||.||. +|+ ..+|.++|..+.--......-..  ..+.-+.+.+++..-++
T Consensus      1127 --~a~hRLILSGTPIQNnvleLWSLFdFLMPGf-LGt-EKqFqsrf~kpI~asRd~K~Sske~EaG~lAleaLHKqVLPF 1202 (1549)
T KOG0392        1127 --RANHRLILSGTPIQNNVLELWSLFDFLMPGF-LGT-EKQFQSRFGKPILASRDPKSSSKEQEAGVLALEALHKQVLPF 1202 (1549)
T ss_pred             --HHCCEEEEECCCCCCCHHHHHHHHHHHCCCC-CCC-HHHHHHHHCCHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             --6402377408876667999999999846665-671-888988755504542386556667876488999999988899


Q ss_pred             HHHHHCCCC-CCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCC--------HHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             433200001-001001100034524536899888999999851033452--------02234788887542035410002
Q gi|255764515|r  226 CLSLDIADY-QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENI--------EAFNSASKTVKCLQLANGAVYYD  296 (458)
Q Consensus       226 ~~~~~~~~~-~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~--------~~~~~~~~~~~l~q~~~~~~~~~  296 (458)
                      ++|+.+.|+ .++|+..+....++|++.|.+.|+.+.+.+........-        ...+....+..++.+|+||.+.-
T Consensus      1203 ~LRRlKedVL~DLPpKIIQDyyCeLs~lQ~kLY~df~~~~k~~~~~~~d~~~~S~gt~~~HvFqaLqYlrKLcnHpaLvl 1282 (1549)
T KOG0392        1203 LLRRLKEDVLKDLPPKIIQDYYCELSPLQKKLYRDFVKKAKQCVSSQIDGGEESLGTDKTHVFQALQYLRKLCNHPALVL 1282 (1549)
T ss_pred             HHHHHHHHHHHHCCHHHHHHEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCHHCCCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99998888876488565331034067899999999988750352003464321057514889999999998548964442


Q ss_pred             CCCC-----------------CHHCCCCCCCCHHHHHHCC----------------CCCEEEEHHHHHHHHHHHHHCC--
Q ss_conf             2343-----------------0001343333256654124----------------8840342223678886641000--
Q gi|255764515|r  297 EEKH-----------------WKEVHDEKIKALEVIIEKA----------------NAAPIIVAYHFNSDLARLQKAF--  341 (458)
Q Consensus       297 ~~~~-----------------~~~~~~~k~~~l~~il~~~----------------~~~kviif~~~~~~~~~i~~~~--  341 (458)
                      ....                 ....+++|+.+|..++.++                .+.+++|||+++.+++.+.+.+  
T Consensus      1283 t~~hp~la~i~~~l~~~~~~LHdi~hspKl~AL~qLL~eCGig~~~~~~~g~~s~vsqHRiLIFcQlK~mlDlVekDL~k 1362 (1549)
T KOG0392        1283 TPVHPDLAAIVSHLAHFNSSLHDIQHSPKLSALKQLLSECGIGNNSDSEVGTPSDVSQHRILIFCQLKSMLDLVEKDLFK 1362 (1549)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCEEEEEEEHHHHHHHHHHHHHH
T ss_conf             77750299998788774014777653526789999999817898875333671021155168764077799999999865


Q ss_pred             -----------CCCCCHHHHHHHHHHHCCC-CCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCC
Q ss_conf             -----------2653344589987642458-8558998442211162200178599990899898686445666620220
Q gi|255764515|r  342 -----------PQGRTLDKDPCTIQEWNEG-KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ  409 (458)
Q Consensus       342 -----------~~g~~~~~r~~~i~~f~~~-~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~  409 (458)
                                 -|..++..|.+++++||++ .++||+.++.+||.||||+.| ++|||+|-.|||+...||++|.     
T Consensus      1363 ~~mpsVtymRLDGSVpp~~R~kiV~~FN~DptIDvLlLTThVGGLGLNLTGA-DTVVFvEHDWNPMrDLQAMDRA----- 1436 (1549)
T KOG0392        1363 KYMPSVTYMRLDGSVPPGDRQKIVERFNEDPTIDVLLLTTHVGGLGLNLTGA-DTVVFVEHDWNPMRDLQAMDRA----- 1436 (1549)
T ss_pred             HHCCCEEEEEECCCCCCHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCC-CEEEEEECCCCCHHHHHHHHHH-----
T ss_conf             1147516997348889077799999716898513899962004532246787-5589972688832457887788-----


Q ss_pred             HHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             20378775289999858996899999999999999999855
Q gi|255764515|r  410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA  450 (458)
Q Consensus       410 hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~  450 (458)
                      ||+||++.|+||+||++||+||+|+..+.=|..+++.|++.
T Consensus      1437 HRIGQKrvVNVyRlItrGTLEEKVMgLQkFKmnvAntvInq 1477 (1549)
T KOG0392        1437 HRIGQKRVVNVYRLITRGTLEEKVMGLQKFKMNVANTVINQ 1477 (1549)
T ss_pred             HHHCCCEEEEEEEEHHCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             86267315666630230658998765788866888888732


No 5  
>KOG0387 consensus
Probab=100.00  E-value=0  Score=495.95  Aligned_cols=428  Identities=22%  Similarity=0.313  Sum_probs=332.5

Q ss_pred             CCCHHHHHHHHHHHH----CCCEEEEECCCCCHHHHHHHHHHHHHHCC--CCCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             874789999999996----79809995889986899999999999759--994999916046569999999985588881
Q gi|255764515|r    2 NLAPHQTKIVDWILD----HKRCAIWASMGSGKTVSVLTALSYIHLWG--EKSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~----~~~~ll~~~~G~GKT~~al~~~~~l~~~~--~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      +|+|||.++|+||++    +.+|+|+||||||||+|.|++++.|...+  .+|+|||||++++. ||.+|+.+|.  |..
T Consensus       205 ~Lf~yQreGV~WL~~L~~q~~GGILgDeMGLGKTIQiisFLaaL~~S~k~~~paLIVCP~Tii~-qW~~E~~~w~--p~~  281 (923)
T KOG0387         205 KLFPYQREGVQWLWELYCQRAGGILGDEMGLGKTIQIISFLAALHHSGKLTKPALIVCPATIIH-QWMKEFQTWW--PPF  281 (923)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCHHHHH-HHHHHHHHHC--CCE
T ss_conf             8648889889999999732578762012357640158999998750243258659982488999-9999998747--653


Q ss_pred             EEEEEECCHH-----------HHHHHH----CCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHH
Q ss_conf             5999858978-----------988873----0779869980642023344200011322044045310024654311567
Q gi|255764515|r   76 NISVITGTVK-----------QRTKVL----KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKT  140 (458)
Q Consensus        76 ~~~~~~g~~~-----------~r~~~~----~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~  140 (458)
                      .+.+++|+..           .+..++    .....+++++|+.+.... .......|+.+|+||+|+|||+.    ++.
T Consensus       282 rv~ilh~t~s~~r~~~~~~~~~~~~~L~r~~~~~~~ilitty~~~r~~~-d~l~~~~W~y~ILDEGH~IrNpn----s~i  356 (923)
T KOG0387         282 RVFILHGTGSGARYDASHSSHKKDKLLIRKVATDGGILITTYDGFRIQG-DDLLGILWDYVILDEGHRIRNPN----SKI  356 (923)
T ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHEEEECCCCCEEEEEHHHHCCCC-CCCCCCCCCEEEECCCCCCCCCC----CHH
T ss_conf             7999714776544443101344312220353046847997422420047-52346503479823765046985----089


Q ss_pred             HHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHH--HHHHHHHHH
Q ss_conf             777665430598079965840231001013467751788877532778877736956403300002455--554558999
Q gi|255764515|r  141 ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYT--AKETAQKEI  218 (458)
Q Consensus       141 ~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~--~~~~~~~~l  218 (458)
                      +.++.++  ++.+|+.||||||||++.|||+++.|+.||. ||. ...|...|......+.........  ..+.-...+
T Consensus       357 slackki--~T~~RiILSGTPiQNnL~ELwsLfDFv~PG~-Lgt-~~~F~~~f~~pI~~GgyaNAs~~qv~~aykca~~L  432 (923)
T KOG0387         357 SLACKKI--RTVHRIILSGTPIQNNLTELWSLFDFVFPGK-LGT-LPVFQQNFEHPINRGGYANASPRQVQTAYKCAVAL  432 (923)
T ss_pred             HHHHHHC--CCCCEEEEECCCCCCHHHHHHHHHHHCCCCC-CCC-HHHHHHHHHHHEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             9999861--5666488618621010899987766406774-455-17787630111003565789879999999999999


Q ss_pred             HHHHHHHHHHHHCCCCC--CCCCCCEEEEEEECCHHHHHHHHHHHHHH-HHHCCCCCCHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             99742454332000010--01001100034524536899888999999-8510334520223478888754203541000
Q gi|255764515|r  219 EAQLSDCCLSLDIADYQ--NIDKPILITKKVPLPQPVMKQYHKFQREL-YCDLQGENIEAFNSASKTVKCLQLANGAVYY  295 (458)
Q Consensus       219 ~~~l~~~~~~~~~~~~~--~l~~~~~~~~~v~l~~~~~~~y~~~~~~~-~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~  295 (458)
                      +..+.++++++.+.+..  .+|.....+..+.|++.|.+.|.++.... +..+..+.   .+.+..+.-++.+||||-++
T Consensus       433 r~lI~PylLRR~K~dv~~~~Lp~K~E~VlfC~LT~~QR~~Y~~fl~s~~v~~i~ng~---~~~l~Gi~iLrkICnHPdll  509 (923)
T KOG0387         433 RDLISPYLLRRMKSDVKGLKLPKKEEIVLFCRLTKLQRRLYQRFLNSSEVNKILNGK---RNCLSGIDILRKICNHPDLL  509 (923)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCC---CCCEECHHHHHHHCCCCCCC
T ss_conf             987679999999988644217886525899856699999999986059899997498---44121518888645894102


Q ss_pred             CCCC---------CCHHCCCCCCCCHHHHHH--CCCCCEEEEHHHHHHHHHHHHHCCC----------CCC-CHHHHHHH
Q ss_conf             2234---------300013433332566541--2488403422236788866410002----------653-34458998
Q gi|255764515|r  296 DEEK---------HWKEVHDEKIKALEVIIE--KANAAPIIVAYHFNSDLARLQKAFP----------QGR-TLDKDPCT  353 (458)
Q Consensus       296 ~~~~---------~~~~~~~~k~~~l~~il~--~~~~~kviif~~~~~~~~~i~~~~~----------~g~-~~~~r~~~  353 (458)
                      +...         ......++|++.+..++.  ...|.+++.|++...+++.|..-+.          +|. +...|+..
T Consensus       510 ~~~~~~~~~~~D~~g~~k~sGKm~vl~~ll~~W~kqg~rvllFsqs~~mLdilE~fL~~~~~ysylRmDGtT~~~~R~~l  589 (923)
T KOG0387         510 DRRDEDEKQGPDYEGDPKRSGKMKVLAKLLKDWKKQGDRVLLFSQSRQMLDILESFLRRAKGYSYLRMDGTTPAALRQKL  589 (923)
T ss_pred             CCCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHH
T ss_conf             67642123588767895652169999999999861797799841377999999999873478538971588862010578


Q ss_pred             HHHHCCC-CCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHH
Q ss_conf             7642458-855899844221116220017859999089989868644566662022020378775289999858996899
Q gi|255764515|r  354 IQEWNEG-KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDEL  432 (458)
Q Consensus       354 i~~f~~~-~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~  432 (458)
                      |++||++ ...|+++++++||.|+||+.| |.||.|||.|||+...||..|+|     |+||++.|.||+|+++|||||.
T Consensus       590 Vd~Fne~~s~~VFLLTTrvGGLGlNLTgA-nRVIIfDPdWNPStD~QAreRaw-----RiGQkkdV~VYRL~t~gTIEEk  663 (923)
T KOG0387         590 VDRFNEDESIFVFLLTTRVGGLGLNLTGA-NRVIIFDPDWNPSTDNQARERAW-----RIGQKKDVVVYRLMTAGTIEEK  663 (923)
T ss_pred             HHHHCCCCCEEEEEEEECCCCCCCCCCCC-CEEEEECCCCCCCCCHHHHHHHH-----HHCCCCCEEEEEEECCCCHHHH
T ss_conf             98636787457999973035541124567-55899799999764257888888-----6357465599997327718999


Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999855
Q gi|255764515|r  433 VLQRLRTKSTIQDLLLNA  450 (458)
Q Consensus       433 i~~~~~~K~~~~~~~~~~  450 (458)
                      ||.++.-|..+.+-++..
T Consensus       664 iY~rQI~Kq~Ltn~il~~  681 (923)
T KOG0387         664 IYHRQIFKQFLTNRILKN  681 (923)
T ss_pred             HHHHHHHHHHHHHHHHCC
T ss_conf             999999998888887429


No 6  
>KOG0390 consensus
Probab=100.00  E-value=0  Score=468.70  Aligned_cols=430  Identities=20%  Similarity=0.285  Sum_probs=315.1

Q ss_pred             CCCCHHHHHHHHHHHHC----------CCEEEEECCCCCHHHHHHHHHHHH-HHCCC-----CCEEEEECCHHHHHHHHH
Q ss_conf             98747899999999967----------980999588998689999999999-97599-----949999160465699999
Q gi|255764515|r    1 MNLAPHQTKIVDWILDH----------KRCAIWASMGSGKTVSVLTALSYI-HLWGE-----KSVLVIAPLRVAQSVWTS   64 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~----------~~~ll~~~~G~GKT~~al~~~~~l-~~~~~-----~~~LIv~P~~l~~~~W~~   64 (458)
                      ..|+|||.+|++|+.++          ++|++||+||+|||++.|+++..+ ...+.     .+.|||||++++. .|.+
T Consensus       237 ~~LrPHQ~EG~~FL~knl~g~~~~~~~~GCImAd~~GlGKTlq~IsflwtlLrq~P~~~~~~~k~lVV~P~sLv~-nWkk  315 (776)
T KOG0390         237 KILRPHQREGFEFLYKNLAGLIRPKNSGGCIMADEPGLGKTLQCISFIWTLLRQFPQAKPLINKPLVVAPSSLVN-NWKK  315 (776)
T ss_pred             HHCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCHHHHH-HHHH
T ss_conf             412815787789978641131115888754720788764078889999999986867554446607984588887-8999


Q ss_pred             HHHHHCCCCCCEEEEEECCHHH----HHHHH-----CCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             9998558888159998589789----88873-----07798699806420233442000113220440453100246543
Q gi|255764515|r   65 EVQRWSNFSHMNISVITGTVKQ----RTKVL-----KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLR  135 (458)
Q Consensus        65 Ei~kf~~~~~~~~~~~~g~~~~----r~~~~-----~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~  135 (458)
                      ||.||.....+....+.|..+.    ...++     ...+.+.++||+++....+.++. ..++++|+||+|++||.   
T Consensus       316 EF~KWl~~~~i~~l~~~~~~~~~w~~~~sil~~~~~~~~~~vli~sye~~~~~~~~il~-~~~glLVcDEGHrlkN~---  391 (776)
T KOG0390         316 EFGKWLGNHRINPLDFYSTKKSSWIKLKSILFLGYKQFTTPVLIISYETASDYCRKILL-IRPGLLVCDEGHRLKNS---  391 (776)
T ss_pred             HHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHEEEEEEECCHHHHHHHHHHHHC-CCCCEEEECCCCCCCCH---
T ss_conf             99874253555404542345256666678988622112578786369999999999854-78986997798885622---


Q ss_pred             CHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHH-HHHHHHH
Q ss_conf             115677776654305980799658402310010134677517888775327788777369564033000024-5555455
Q gi|255764515|r  136 QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVR-YTAKETA  214 (458)
Q Consensus       136 ~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~-~~~~~~~  214 (458)
                       .+++.+++.++  +++++++|||||+||+..|+|++++|++|+. ++. ..+|...+......+....... .......
T Consensus       392 -~s~~~kaL~~l--~t~rRVLLSGTp~QNdl~EyFnlL~fvrP~~-Lgs-~~sf~k~~~~~i~~~~~~~~s~e~~~~~~r  466 (776)
T KOG0390         392 -DSLTLKALSSL--KTPRRVLLTGTPIQNDLKEYFNLLDFVRPGF-LGS-ISSFKKKFEIPILRGRDADASEEDREREER  466 (776)
T ss_pred             -HHHHHHHHHHC--CCCCEEEEECCCCCCCHHHHHHHHHHCCHHH-CCC-HHHHHHHHHCCCCCCCCCCCCHHHHHHHHH
T ss_conf             -45899999746--8773699607753346999978885157011-255-378887751344235677855354525799


Q ss_pred             HHHHHHHHHHHHHHHHCCCCC-CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             899999742454332000010-0100110003452453689988899999985103345202234788887542035410
Q gi|255764515|r  215 QKEIEAQLSDCCLSLDIADYQ-NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAV  293 (458)
Q Consensus       215 ~~~l~~~l~~~~~~~~~~~~~-~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~  293 (458)
                      ..++......+++++...... -+|.....++....++.|.+.|.++.+........+     ..+....++.++|+||.
T Consensus       467 l~eL~~~t~~fi~rrt~~il~k~LP~k~e~vv~~n~t~~Q~~~~~~l~~~~~~~~~~~-----~~l~~~~~L~k~cnhP~  541 (776)
T KOG0390         467 LQELRELTNKFILRRTGDILLKYLPGKYEYVVFCNPTPIQKELYKKLLDSMKMRTLKG-----YALELITKLKKLCNHPS  541 (776)
T ss_pred             HHHHHHHHHHHEEECCCCHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHC-----CHHHHHHHHHHHHCCHH
T ss_conf             9999999976522111203455388854699995780899999999987777654313-----22558899898736877


Q ss_pred             CCC------CCCCC-----------------HHCCCCCCCCHHHHHH---CCCCCEEEEHHHHHHHHHHHHHC-------
Q ss_conf             002------23430-----------------0013433332566541---24884034222367888664100-------
Q gi|255764515|r  294 YYD------EEKHW-----------------KEVHDEKIKALEVIIE---KANAAPIIVAYHFNSDLARLQKA-------  340 (458)
Q Consensus       294 ~~~------~~~~~-----------------~~~~~~k~~~l~~il~---~~~~~kviif~~~~~~~~~i~~~-------  340 (458)
                      +..      .+...                 ....+.|+..|..+++   +..-.++++-++++.+++.+...       
T Consensus       542 L~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~ks~kl~~L~~ll~~~~ek~~~~~v~Isny~~tldl~e~~~~~~g~~  621 (776)
T KOG0390         542 LLLLCEKTEKEKAFKNPALLLDPGKLKLDAGDGSKSGKLLVLVFLLEVIREKLLVKSVLISNYTQTLDLFEQLCRWRGYE  621 (776)
T ss_pred             HHCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHHHCCCE
T ss_conf             63133223444122685765032124666555115668999999999986522317999622899999999997653844


Q ss_pred             ---CCCCCCHHHHHHHHHHHCCCCC--CEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCC
Q ss_conf             ---0265334458998764245885--58998442211162200178599990899898686445666620220203787
Q gi|255764515|r  341 ---FPQGRTLDKDPCTIQEWNEGKI--PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK  415 (458)
Q Consensus       341 ---~~~g~~~~~r~~~i~~f~~~~~--~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~  415 (458)
                         +.|.++..+|+.+|+.||++..  .|+++|++|||+||||. |++++|+||++|||+..+||++|+|     |.||+
T Consensus       622 ~~rLdG~~~~~qRq~~vd~FN~p~~~~~vfLlSsKAgg~GinLi-GAsRlil~D~dWNPa~d~QAmaR~~-----RdGQK  695 (776)
T KOG0390         622 VLRLDGKTSIKQRQKLVDTFNDPESPSFVFLLSSKAGGEGLNLI-GASRLILFDPDWNPAVDQQAMARAW-----RDGQK  695 (776)
T ss_pred             EEEECCCCCHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCEEEC-CCCEEEEECCCCCCHHHHHHHHHHC-----CCCCC
T ss_conf             89973877668888998733599887418998544555763201-3403899579998236789999764-----57874


Q ss_pred             CCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             752899998589968999999999999999998554
Q gi|255764515|r  416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNAL  451 (458)
Q Consensus       416 ~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~~  451 (458)
                      ++|+||+|++.||+||.+|+++..|..+.+.+++.-
T Consensus       696 k~v~iYrLlatGtiEEk~~qrq~~K~~lS~~v~~~~  731 (776)
T KOG0390         696 KPVYIYRLLATGTIEEKIYQRQTHKEGLSSMVFDEE  731 (776)
T ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHEEEECC
T ss_conf             268999963279813888999987600132477332


No 7  
>KOG0391 consensus
Probab=100.00  E-value=0  Score=438.26  Aligned_cols=428  Identities=20%  Similarity=0.335  Sum_probs=318.8

Q ss_pred             CCCHHHHHHHHHHH----HCCCEEEEECCCCCHHHHHHHHHHHHH-HCCCC-CEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             87478999999999----679809995889986899999999999-75999-4999916046569999999985588881
Q gi|255764515|r    2 NLAPHQTKIVDWIL----DHKRCAIWASMGSGKTVSVLTALSYIH-LWGEK-SVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~----~~~~~ll~~~~G~GKT~~al~~~~~l~-~~~~~-~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      +|+.||..|++||.    +|-+|+||||||+|||++.|+++++|- .++.| +-|||||++++.| |..||++|+  |++
T Consensus       615 qLReYQkiGLdWLatLYeknlNGILADEmGLGKTIQtISllAhLACeegnWGPHLIVVpTsviLn-WEMElKRwc--Pgl  691 (1958)
T KOG0391         615 QLREYQKIGLDWLATLYEKNLNGILADEMGLGKTIQTISLLAHLACEEGNWGPHLIVVPTSVILN-WEMELKRWC--PGL  691 (1958)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEHHHHCCCCHHHHHHHHHHHHHCCCCCCCCEEEEECHHHHH-HHHHHHHHC--CCC
T ss_conf             78888875179999998733443222331465145799999998750457787369851322113-367886527--753


Q ss_pred             EEEEEECCHHHHHHH---HCC--CCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             599985897898887---307--798699806420233442000113220440453100246543115677776654305
Q gi|255764515|r   76 NISVITGTVKQRTKV---LKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE  150 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~---~~~--~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~  150 (458)
                      ++..+.|+.++|...   |..  ..+|.|+||..+-.+...+ ....|.++|+||||++||....+    -+++  +..+
T Consensus       692 KILTYyGs~kErkeKRqgW~kPnaFHVCItSYklv~qd~~AF-krkrWqyLvLDEaqnIKnfksqr----WQAl--lnfn  764 (1958)
T KOG0391         692 KILTYYGSHKERKEKRQGWAKPNAFHVCITSYKLVFQDLTAF-KRKRWQYLVLDEAQNIKNFKSQR----WQAL--LNFN  764 (1958)
T ss_pred             EEEEECCCHHHHHHHHHCCCCCCEEEEEEHHHHHHHHHHHHH-HHHCCCEEEHHHHHHHCCHHHHH----HHHH--HCCC
T ss_conf             576521778888887514468880488631068887377888-76411223214555423006788----9998--5300


Q ss_pred             CCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98079965840231001013467751788877532778877736956403300002455554558999997424543320
Q gi|255764515|r  151 SERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLD  230 (458)
Q Consensus       151 ~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~  230 (458)
                      +.++++|||||.+|++.|||++++||.|...  .+...|. .|+...-.+...+...+.  ......+++-+.++.+++.
T Consensus       765 sqrRLLLtgTPLqNslmELWSLmhFLmP~~f--~shd~fk-~wfsnPltgmiEgsqeyn--~klV~RLHkVlrPfiLRRl  839 (1958)
T KOG0391         765 SQRRLLLTGTPLQNSLMELWSLMHFLMPQTF--ASHDIFK-PWFSNPLTGMIEGSQEYN--HKLVIRLHKVLRPFILRRL  839 (1958)
T ss_pred             HHHEEEECCCCHHHHHHHHHHHHHHHHCHHH--HHHHHHH-HHHCCCCHHHCCCCHHHC--HHHHHHHHHHHHHHHHHHH
T ss_conf             1200221187204679999999998702333--0014677-775181211100421214--1899999987678999998


Q ss_pred             CCCCC-CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCC----------
Q ss_conf             00010-0100110003452453689988899999985103345202234788887542035410002234----------
Q gi|255764515|r  231 IADYQ-NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEK----------  299 (458)
Q Consensus       231 ~~~~~-~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~----------  299 (458)
                      +.|+. .+|....+.+.+.++..|...|+.+....-..-.-+....++.+.-+++|+.+||||-+++...          
T Consensus       840 K~DVEKQlpkKyEHvv~CrLSkRQR~LYDDfmsq~~TKetLkSGhfmsVlnilmqLrKvCNHPnLfEpRpv~ssfV~e~l  919 (1958)
T KOG0391         840 KRDVEKQLPKKYEHVVKCRLSKRQRALYDDFMSQPGTKETLKSGHFMSVLNILMQLRKVCNHPNLFEPRPVGSSFVAEPL  919 (1958)
T ss_pred             HHHHHHHCCHHHHHHEEEEHHHHHHHHHHHHHHCCCHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCE
T ss_conf             88898753043244123100156777888886160146675237636899999999986379875778888861014751


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|255764515|r  300 --------------------------------------------------------------------------------  299 (458)
Q Consensus       300 --------------------------------------------------------------------------------  299 (458)
                                                                                                      
T Consensus       920 ~~s~as~~~r~l~el~~k~p~~~~ls~~p~~~~vp~v~pas~~~sAspl~s~l~~ls~~~rPp~pt~~g~~F~~~aa~at  999 (1958)
T KOG0391         920 EYSSASKITRHLAELLSKKPIPRKLSEEPSTSAVPAVRPASAKLSASPLASALPQLSLRGRPPIPTFAGAPFQTSAASAT  999 (1958)
T ss_pred             ECCCCCCCHHHHHHHCCCCCCCHHHHCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCC
T ss_conf             02664321023444304799844543177755544223255430256563311225678899876546654450021036


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|255764515|r  300 --------------------------------------------------------------------------------  299 (458)
Q Consensus       300 --------------------------------------------------------------------------------  299 (458)
                                                                                                      
T Consensus      1000 sphteea~~~~v~r~~~~~~va~~q~r~lt~p~~~veq~n~~k~~~htt~~~p~~~~~svl~~~sv~t~pl~~ap~p~~~ 1079 (1958)
T KOG0391        1000 SPHTEEASASSVARLPSGEVVAIAQLRSLTGPQSRVEQPNTPKTLQHTTAGQPLQLQGSVLQIVSVPTQPLLRAPGPVVM 1079 (1958)
T ss_pred             CCCCCCCCCCCHHCCCCHHEEECCCCCCCCCCHHHHHCCCCCEEEEEECCCCCCCCCCCEEEECCCCCCCCCCCCCCCCE
T ss_conf             87645432321001432000110332434471767626787304664214676444443000001466310017887301


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|255764515|r  300 --------------------------------------------------------------------------------  299 (458)
Q Consensus       300 --------------------------------------------------------------------------------  299 (458)
                                                                                                      
T Consensus      1080 ~l~~a~gsr~pv~~ddpa~ltp~sg~pkl~gtat~~~g~~pr~~~~klee~Rkrql~erl~ri~~~~APvyg~e~l~~c~ 1159 (1958)
T KOG0391        1080 ALHGALGSRPPVGGDDPAPLTPQSGVPKLVGTATLAVGEPPRAIGGKLEEERKRQLKERLDRIYLVNAPVYGRELLRICA 1159 (1958)
T ss_pred             ECCHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHC
T ss_conf             04254336787788982102666688887423222157775113430356777789898888864147632223443213


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|255764515|r  300 --------------------------------------------------------------------------------  299 (458)
Q Consensus       300 --------------------------------------------------------------------------------  299 (458)
                                                                                                      
T Consensus      1160 lp~e~i~p~~~ea~~e~~l~~~r~le~l~~iIdrfafv~ppvva~ppslra~~ppp~~~~r~r~~~~qlrsel~p~~~~~ 1239 (1958)
T KOG0391        1160 LPSEGIVPWRSEAPSELMLTLCRCLESLQDIIDRFAFVIPPVVAAPPSLRAPRPPPLYSHRMRILRQQLRSELAPYFQQR 1239 (1958)
T ss_pred             CCHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHEEECCCCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHH
T ss_conf             66343043533471344454888888999999875251364257873223799970002378999987788725643301


Q ss_pred             -------------CCHHCCCCCCCCHHHHHH--CCCCCEEEEHHHHHHHHHHHHHC----------CCCCCCHHHHHHHH
Q ss_conf             -------------300013433332566541--24884034222367888664100----------02653344589987
Q gi|255764515|r  300 -------------HWKEVHDEKIKALEVIIE--KANAAPIIVAYHFNSDLARLQKA----------FPQGRTLDKDPCTI  354 (458)
Q Consensus       300 -------------~~~~~~~~k~~~l~~il~--~~~~~kviif~~~~~~~~~i~~~----------~~~g~~~~~r~~~i  354 (458)
                                   .......+|+..|.-++.  ..+|+.|+||++...+++.+..-          +-+....+.|+.+.
T Consensus      1240 q~~~~r~lqFPelrLiQyDcGKLQtLAiLLqQLk~eghRvLIfTQMtkmLDVLEqFLnyHgylY~RLDg~t~vEqRQaLm 1319 (1958)
T KOG0391        1240 QTTAPRLLQFPELRLIQYDCGKLQTLAILLQQLKSEGHRVLIFTQMTKMLDVLEQFLNYHGYLYVRLDGNTSVEQRQALM 1319 (1958)
T ss_pred             HCCCHHHHCCCCHHEEECCCCHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHH
T ss_conf             00222653385101000042059999999999985585488516889999999999854256899844875388999999


Q ss_pred             HHHCCC-CCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHH
Q ss_conf             642458-8558998442211162200178599990899898686445666620220203787752899998589968999
Q gi|255764515|r  355 QEWNEG-KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV  433 (458)
Q Consensus       355 ~~f~~~-~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i  433 (458)
                      ++||.+ .+-++|+|+.+||+||||+.| ++|||||..|||.-.-||-+||     |||||+++|+||+||+..||||.|
T Consensus      1320 erFNaD~RIfcfILSTrSggvGiNLtgA-DTVvFYDsDwNPtMDaQaQDrC-----hRIGqtRdVhIYRliSerTIEenI 1393 (1958)
T KOG0391        1320 ERFNADRRIFCFILSTRSGGVGINLTGA-DTVVFYDSDWNPTMDAQAQDRC-----HRIGQTRDVHIYRLISERTIEENI 1393 (1958)
T ss_pred             HHHCCCCCEEEEEEECCCCCCCCCCCCC-CEEEEECCCCCCHHHHHHHHHH-----HHHCCCCCEEEEEEECCCHHHHHH
T ss_conf             9736787169999852678642013467-4589845888801326889888-----874573413788740334078999


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999855
Q gi|255764515|r  434 LQRLRTKSTIQDLLLNA  450 (458)
Q Consensus       434 ~~~~~~K~~~~~~~~~~  450 (458)
                      ++...+|+.+-+.++++
T Consensus      1394 LKkanqKr~L~evaiqg 1410 (1958)
T KOG0391        1394 LKKANQKRMLDEVAIQG 1410 (1958)
T ss_pred             HHHHHHHHHHHHHHHCC
T ss_conf             86322777666664215


No 8  
>KOG0388 consensus
Probab=100.00  E-value=0  Score=429.39  Aligned_cols=420  Identities=20%  Similarity=0.351  Sum_probs=316.4

Q ss_pred             CCCHHHHHHHHHHHH---CC-CEEEEECCCCCHHHHHHHHHHHHHHCCC--CCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             874789999999996---79-8099958899868999999999997599--94999916046569999999985588881
Q gi|255764515|r    2 NLAPHQTKIVDWILD---HK-RCAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~---~~-~~ll~~~~G~GKT~~al~~~~~l~~~~~--~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      .|+.||+.|++|+.+   .+ +|+||||||+|||+++|+++++|.....  +|.|||+|+|++- .|..||.+|.  |.+
T Consensus       567 tLKEYQlkGLnWLvnlYdqGiNGILADeMGLGKTVQsisvlAhLaE~~nIwGPFLVVtpaStL~-NWaqEisrFl--P~~  643 (1185)
T KOG0388         567 TLKEYQLKGLNWLVNLYDQGINGILADEMGLGKTVQSISVLAHLAETHNIWGPFLVVTPASTLH-NWAQEISRFL--PSF  643 (1185)
T ss_pred             HHHHHHHCCHHHHHHHHHCCCCCEEHHHHCCCHHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHH-HHHHHHHHHC--CCC
T ss_conf             1688765007899999870344121333045326889999999987445887638960278776-7999999858--654


Q ss_pred             EEEEEECCHHHHHHHH-----------CCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             5999858978988873-----------07798699806420233442000113220440453100246543115677776
Q gi|255764515|r   76 NISVITGTVKQRTKVL-----------KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARAL  144 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~~-----------~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l  144 (458)
                      ++..+-|+..+|..+-           +...+|+|+||+.+..+ ..++...+|..+|+|||+.+|+..    |.+-+.+
T Consensus       644 k~lpywGs~~eRkiLrKfw~rKnmY~rna~fhVviTSYQlvVtD-eky~qkvKWQYMILDEAQAIKSSs----S~RWKtL  718 (1185)
T KOG0388         644 KVLPYWGSPSERKILRKFWNRKNMYRRNAPFHVVITSYQLVVTD-EKYLQKVKWQYMILDEAQAIKSSS----SSRWKTL  718 (1185)
T ss_pred             EEECCCCCHHHHHHHHHHCCHHHHHCCCCCCEEEEEEEEEEECH-HHHHHHHHHHHEEHHHHHHHHHHH----HHHHHHH
T ss_conf             24347688026689997404444430479952899753111115-999986334520055787764322----5678877


Q ss_pred             HHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCH-HHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6543059807996584023100101346775178887753277887773695-640330000245555455899999742
Q gi|255764515|r  145 AKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNT-TQIGSHIGAVRYTAKETAQKEIEAQLS  223 (458)
Q Consensus       145 ~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~-~~~~~~~~~~~~~~~~~~~~~l~~~l~  223 (458)
                        ++.+|+++++||||||+|+.-|||++|+|+.|.  ++.+..+|- +|+.. .+.+...   .....+.-+..++..+.
T Consensus       719 --LsF~cRNRLLLTGTPIQNsMqELWALLHFIMPs--LFDshneFs-eWFSKdIEshAe~---~~tlneqqL~RLH~ILK  790 (1185)
T KOG0388         719 --LSFKCRNRLLLTGTPIQNSMQELWALLHFIMPS--LFDSHNEFS-EWFSKDIESHAEM---NTTLNEQQLQRLHAILK  790 (1185)
T ss_pred             --HHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHH--HHHCHHHHH-HHHHHHHHHHHHH---CCCCCHHHHHHHHHHHH
T ss_conf             --402103404531885301799999999998667--531347788-9886525768875---57727999999999872


Q ss_pred             HHHHHHHCCCC-CCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCC--------
Q ss_conf             45433200001-001001100034524536899888999999851033452022347888875420354100--------
Q gi|255764515|r  224 DCCLSLDIADY-QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY--------  294 (458)
Q Consensus       224 ~~~~~~~~~~~-~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~--------  294 (458)
                      ++|+++.++++ .++.....+.+.+.++..|...|..+.+....         ......++.++..|+||-+        
T Consensus       791 PFMLRRvKkdV~sELg~Kteidv~CdLs~RQ~~lYq~ik~~iS~---------~E~~~~vmQlrKVCNHPdLFer~e~~s  861 (1185)
T KOG0388         791 PFMLRRVKKDVISELGQKTEIDVYCDLSYRQKVLYQEIKRSISS---------MEMENLVMQLRKVCNHPDLFERLEPRS  861 (1185)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHCCCHHHHHHCCCCC
T ss_conf             89999988788877436317999840068899999999988668---------899999999998648868876347764


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|255764515|r  295 --------------------------------------------------------------------------------  294 (458)
Q Consensus       295 --------------------------------------------------------------------------------  294 (458)
                                                                                                      
T Consensus       862 ~L~~~V~~nl~dv~S~Grnpi~ykiP~L~~~d~le~~~fniye~i~~~~g~~~~v~Geg~~~w~~~l~~e~k~G~~~~~n  941 (1185)
T KOG0388         862 GLSLEVSDNLGDVVSFGRNPIDYKIPSLVAKDALEMFRFNIYEMIERINGLRRIVNGEGPNAWYLRLSLEFKYGGYVFRN  941 (1185)
T ss_pred             EEEEECCCCHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHCCCCEEEECCCCCCCCC
T ss_conf             16777115777787378886011022789999999877768999998750676525898511002103552258732242


Q ss_pred             ---------------------------------------------------CCCCCCCHH--------------------
Q ss_conf             ---------------------------------------------------022343000--------------------
Q gi|255764515|r  295 ---------------------------------------------------YDEEKHWKE--------------------  303 (458)
Q Consensus       295 ---------------------------------------------------~~~~~~~~~--------------------  303 (458)
                                                                         ...+.+..+                    
T Consensus       942 ~e~~~Kavtr~ll~p~~~~~e~~~rvi~~e~~~L~~~~y~y~P~v~apPvLI~~ead~PeId~E~~~~pLn~~i~~Ppm~ 1021 (1185)
T KOG0388         942 VEEAGKAVTRNLLNPESSLLESMRRVIDEEAYRLQRHVYCYSPVVAAPPVLISNEADLPEIDLENRHIPLNTTIYVPPMN 1021 (1185)
T ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHEEEECCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEECCCHH
T ss_conf             99999999998428520036889988647888865400343564578974320356788887556675666636348477


Q ss_pred             ---CCCCCCCCHHHHHH--CCCCCEEEEHHHHHHHHHHHHHCC---------CCCC-CHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             ---13433332566541--248840342223678886641000---------2653-34458998764245885589984
Q gi|255764515|r  304 ---VHDEKIKALEVIIE--KANAAPIIVAYHFNSDLARLQKAF---------PQGR-TLDKDPCTIQEWNEGKIPLLFAH  368 (458)
Q Consensus       304 ---~~~~k~~~l~~il~--~~~~~kviif~~~~~~~~~i~~~~---------~~g~-~~~~r~~~i~~f~~~~~~vli~s  368 (458)
                         ..|+|+..|.+++.  +..|..+++|.+...+++.+...+         .+|+ ....|..++..|+.+++-|+++|
T Consensus      1022 ~FitdSgKL~~LDeLL~kLkaegHRvL~yfQMTkM~dl~EdYl~yr~Y~ylRLDGSsk~~dRrd~vrDwQ~sdiFvFLLS 1101 (1185)
T KOG0388        1022 TFITDSGKLVVLDELLPKLKAEGHRVLMYFQMTKMIDLIEDYLVYRGYTYLRLDGSSKASDRRDVVRDWQASDIFVFLLS 1101 (1185)
T ss_pred             HHHCCCCCEEEHHHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             65316654363998989864178258821579899999999987604606985575404678888863357755899974


Q ss_pred             HHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             42211162200178599990899898686445666620220203787752899998589968999999999999999998
Q gi|255764515|r  369 PASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL  448 (458)
Q Consensus       369 ~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~  448 (458)
                      +.|||.||||+ |+++|||||..|||....||++|.     ||.||+++|+||+|+++||+||+|+++..+|..+...|+
T Consensus      1102 TRAGGLGINLT-AADTViFYdSDWNPT~D~QAMDRA-----HRLGQTrdvtvyrl~~rgTvEEk~l~rA~qK~~vQq~Vm 1175 (1185)
T KOG0388        1102 TRAGGLGINLT-AADTVIFYDSDWNPTADQQAMDRA-----HRLGQTRDVTVYRLITRGTVEEKVLERANQKDEVQQMVM 1175 (1185)
T ss_pred             CCCCCCCCCCC-CCCEEEEECCCCCCCHHHHHHHHH-----HHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             04676620111-242489944889963216778888-----750675430456520013179999987534788999977


Q ss_pred             HHHH
Q ss_conf             5541
Q gi|255764515|r  449 NALK  452 (458)
Q Consensus       449 ~~~~  452 (458)
                      .+.+
T Consensus      1176 ~G~~ 1179 (1185)
T KOG0388        1176 HGNI 1179 (1185)
T ss_pred             CCCC
T ss_conf             0773


No 9  
>KOG4439 consensus
Probab=100.00  E-value=0  Score=431.65  Aligned_cols=420  Identities=20%  Similarity=0.297  Sum_probs=301.1

Q ss_pred             CCCHHHHHHHHHHHHC-----CCEEEEECCCCCHHHHHHHHHHHHHH-------CC--CCCEEEEECCHHHHHHHHHHHH
Q ss_conf             8747899999999967-----98099958899868999999999997-------59--9949999160465699999999
Q gi|255764515|r    2 NLAPHQTKIVDWILDH-----KRCAIWASMGSGKTVSVLTALSYIHL-------WG--EKSVLVIAPLRVAQSVWTSEVQ   67 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~-----~~~ll~~~~G~GKT~~al~~~~~l~~-------~~--~~~~LIv~P~~l~~~~W~~Ei~   67 (458)
                      .|+|||..|..||..+     .+|+|+||||+|||+++|+++..-+.       .+  ..++|||||+|++ +||..|++
T Consensus       325 ~LmpHQkaal~Wl~wRE~q~~~GGILaddmGLGKTlsmislil~qK~~~~~~~~~~~~a~~TLII~PaSli-~qW~~Ev~  403 (901)
T KOG4439         325 ELMPHQKAALRWLLWRESQPPSGGILADDMGLGKTLSMISLILHQKAARKAREKKGESASKTLIICPASLI-HQWEAEVA  403 (901)
T ss_pred             ECCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCHHHH-HHHHHHHH
T ss_conf             44514665414310013479998650213345530679999998899987541445655772886739999-98899999


Q ss_pred             HHCCCCCCEEEEEECCHH-HHHHHHCCCCCEEEECCCCHHHHH----H-----HCCCCCCCCEEECCCCCCCCCCCCCCH
Q ss_conf             855888815999858978-988873077986998064202334----4-----200011322044045310024654311
Q gi|255764515|r   68 RWSNFSHMNISVITGTVK-QRTKVLKTPAVLYVINFENLGWLV----Q-----ELKGTWPFATIVVDESTKLKSFRLRQG  137 (458)
Q Consensus        68 kf~~~~~~~~~~~~g~~~-~r~~~~~~~~~i~i~s~e~~~~~~----~-----~~~~~~~~~~iIiDEaH~lkn~~~~~~  137 (458)
                      +-.....+.|++++|+.+ .-.......|+++|+||..+.+.-    +     .-+....|..||+||||.+||..    
T Consensus       404 ~rl~~n~LsV~~~HG~n~r~i~~~~L~~YDvViTTY~lva~~~~~e~~~~~~~spL~~I~W~RVILDEAH~IrN~~----  479 (901)
T KOG4439         404 RRLEQNALSVYLYHGPNKREISAKELRKYDVVITTYNLVANKPDDELEEGKNSSPLARIAWSRVILDEAHNIRNSN----  479 (901)
T ss_pred             HHHHHCCEEEEEECCCCCCCCCHHHHHHCCEEEEEEECCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCC----
T ss_conf             9986350079986178615478888732566998521101577303331567427777567775342455413663----


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             56777766543059807996584023100101346775178887753277887773695640330000245555455899
Q gi|255764515|r  138 SKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKE  217 (458)
Q Consensus       138 s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~  217 (458)
                      +++..++-+  ..++++|+||||||+|+..|+|+++.||.-. +|+. +..    |..........+.          ..
T Consensus       480 tq~S~AVC~--L~a~~RWclTGTPiqNn~~DvysLlrFLr~~-pF~D-~~~----Wke~i~~~s~~g~----------~r  541 (901)
T KOG4439         480 TQCSKAVCK--LSAKSRWCLTGTPIQNNLWDVYSLLRFLRCP-PFGD-LKQ----WKENIDNMSKGGA----------NR  541 (901)
T ss_pred             HHHHHHHHH--HHHCCEEECCCCCCCCCHHHHHHHHHHHCCC-CCCH-HHH----HHHHCCCCCCCCH----------HH
T ss_conf             067889887--7620413312675444416799999996689-8503-778----8874367454504----------56


Q ss_pred             HHHHHHHHHHHHHC------CCCCCCCCCCEEEEEEECCHHHHHHHHHHHH---HHHHH----CCCC----C--------
Q ss_conf             99974245433200------0010010011000345245368998889999---99851----0334----5--------
Q gi|255764515|r  218 IEAQLSDCCLSLDI------ADYQNIDKPILITKKVPLPQPVMKQYHKFQR---ELYCD----LQGE----N--------  272 (458)
Q Consensus       218 l~~~l~~~~~~~~~------~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~---~~~~~----~~~~----~--------  272 (458)
                      +.-..+..++++.+      .+...+|......+.++|+..+.+.|+-+..   .++..    ..+.    .        
T Consensus       542 lnll~K~LmLRRTKdQl~a~~klv~Lp~k~i~l~~leLs~~E~~vY~i~~~askk~~kq~L~~~e~~~~~~~~~s~~~~~  621 (901)
T KOG4439         542 LNLLTKSLMLRRTKDQLQANGKLVNLPEKNIELHELELSGDEAKVYQIMMEASKKLFKQFLLQREDRNNDGGYQSRNRFI  621 (901)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHC
T ss_conf             66654467765657765046641027540338899763404889999999999999999987665403545766632010


Q ss_pred             ----------------------CH-HHHHHHHHHHHHHCCCCCCCCCCC----------------CCC------------
Q ss_conf             ----------------------20-223478888754203541000223----------------430------------
Q gi|255764515|r  273 ----------------------IE-AFNSASKTVKCLQLANGAVYYDEE----------------KHW------------  301 (458)
Q Consensus       273 ----------------------~~-~~~~~~~~~~l~q~~~~~~~~~~~----------------~~~------------  301 (458)
                                            .. ....+..+.+|+|+|+|+-.....                ...            
T Consensus       622 ~~~~e~~~~~~~~pR~~aagsn~~~~s~IL~LLlrLRQ~ccH~~~~k~~ld~~~~~~~g~~~sde~~~e~~~l~el~k~~  701 (901)
T KOG4439         622 GGHDEFGNYYNIGPRFLAAGSNFEIMSHILVLLLRLRQACCHFGLLKAALDPEEFQMNGGDDSDEEQLEEDNLAELEKND  701 (901)
T ss_pred             CCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCHHCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             24554445333461232047732467899999999987730701202645878763047640334434456787654214


Q ss_pred             -----------------H-----HCCCCCCCCHHHHHHC---CCCCEEEEHHHHHHHHHHHHHCCC----------CCCC
Q ss_conf             -----------------0-----0134333325665412---488403422236788866410002----------6533
Q gi|255764515|r  302 -----------------K-----EVHDEKIKALEVIIEK---ANAAPIIVAYHFNSDLARLQKAFP----------QGRT  346 (458)
Q Consensus       302 -----------------~-----~~~~~k~~~l~~il~~---~~~~kviif~~~~~~~~~i~~~~~----------~g~~  346 (458)
                                       .     ...|+|+.+..++++.   ...+|++|.+++..+++.+...+.          +...
T Consensus       702 ~T~~~~D~~ed~p~~~~~q~Fe~~r~S~Ki~~~l~~le~i~~~skeK~viVSQwtsvLniv~~hi~~~g~~y~si~Gqv~  781 (901)
T KOG4439         702 ETDCSDDNCEDLPTAFPDQAFEPDRPSCKIAMVLEILETILTSSKEKVVIVSQWTSVLNIVRKHIQKGGHIYTSITGQVL  781 (901)
T ss_pred             CCCCCCCCCCCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHCCEEEEEECCCCC
T ss_conf             42256654223666433444034453057888999999886136650564267788887888887507713662057404


Q ss_pred             HHHHHHHHHHHC--CCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEE
Q ss_conf             445899876424--588558998442211162200178599990899898686445666620220203787752899998
Q gi|255764515|r  347 LDKDPCTIQEWN--EGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLI  424 (458)
Q Consensus       347 ~~~r~~~i~~f~--~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li  424 (458)
                      ..+|+.+++.||  +|..+|+++|..|||+||||. ++|++|++|++|||+..+||.+||     ||+||+++|+||+|+
T Consensus       782 vK~Rq~iv~~FN~~k~~~rVmLlSLtAGGVGLNL~-GaNHlilvDlHWNPaLEqQAcDRI-----YR~GQkK~V~IhR~~  855 (901)
T KOG4439         782 VKDRQEIVDEFNQEKGGARVMLLSLTAGGVGLNLI-GANHLILVDLHWNPALEQQACDRI-----YRMGQKKDVFIHRLM  855 (901)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEECCCCCEEEEC-CCCEEEEEECCCCHHHHHHHHHHH-----HHHCCCCCEEEEEEE
T ss_conf             06789999998860488059999970674135203-563389985466878889998999-----984266725899987


Q ss_pred             ECCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             58996899999999999999999855
Q gi|255764515|r  425 AQNTIDELVLQRLRTKSTIQDLLLNA  450 (458)
Q Consensus       425 ~~~tide~i~~~~~~K~~~~~~~~~~  450 (458)
                      ++||+|++|...++.|.+++..|+++
T Consensus       856 ~~gTvEqrV~~LQdkKldlA~~VL~G  881 (901)
T KOG4439         856 CKGTVEQRVKSLQDKKLDLAKGVLTG  881 (901)
T ss_pred             ECCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             43728999998888888877664257


No 10 
>KOG0386 consensus
Probab=100.00  E-value=0  Score=433.55  Aligned_cols=432  Identities=20%  Similarity=0.283  Sum_probs=334.9

Q ss_pred             CCCHHHHHHHHHHHH----CCCEEEEECCCCCHHHHHHHHHHHHHH--CCCCCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             874789999999996----798099958899868999999999997--59994999916046569999999985588881
Q gi|255764515|r    2 NLAPHQTKIVDWILD----HKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~----~~~~ll~~~~G~GKT~~al~~~~~l~~--~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      +|++||..+++||..    |.+++||||||+|||+++|+++.+|..  ...+|.|||||.+++.| |..||.+|+  |.+
T Consensus       394 ~Lk~YQl~GLqWmVSLyNNnLNGILADEMGLGKTIQtIsLitYLmE~K~~~GP~LvivPlstL~N-W~~Ef~kWa--PSv  470 (1157)
T KOG0386         394 ELKEYQLHGLQWMVSLYNNNLNGILADEMGLGKTIQTISLITYLMEHKQMQGPFLIIVPLSTLVN-WSSEFPKWA--PSV  470 (1157)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCHHCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCC-CHHHCCCCC--CCE
T ss_conf             77442453157776315898243320010441488999999999997056798389543545677-122024346--651


Q ss_pred             EEEEEECCHHHHHHHH----CCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             5999858978988873----077986998064202334420001132204404531002465431156777766543059
Q gi|255764515|r   76 NISVITGTVKQRTKVL----KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWES  151 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~~----~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~  151 (458)
                      ....+.|++..|....    -+...|++++|+.+-. .+.++..+.|..+||||+|++||.    .++....+.. ...+
T Consensus       471 ~~i~YkGtp~~R~~l~~qir~gKFnVLlTtyEyiik-dk~lLsKI~W~yMIIDEGHRmKNa----~~KLt~~L~t-~y~~  544 (1157)
T KOG0386         471 QKIQYKGTPQQRSGLTKQQRHGKFNVLLTTYEYIIK-DKALLSKISWKYMIIDEGHRMKNA----ICKLTDTLNT-HYRA  544 (1157)
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCCEEEEEEHHHHCC-CHHHHHCCCCCCEEECCCCCCCCH----HHHHHHHHHC-CCCC
T ss_conf             356541788888667898860011034200877537-999984469863563222224512----5578877502-5521


Q ss_pred             CEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHH--HHHHHHHHHHHHHH
Q ss_conf             8079965840231001013467751788877532778877736956403300002455554558--99999742454332
Q gi|255764515|r  152 ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQ--KEIEAQLSDCCLSL  229 (458)
Q Consensus       152 ~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~--~~l~~~l~~~~~~~  229 (458)
                      .+|++|||||++|++.|+|++|+|+-|..  +.+..+| +.|++..--. ..........+..+  ..+++-+.++.+++
T Consensus       545 q~RLLLTGTPLQN~LpELWaLLNFlLP~I--FnS~~~F-eqWFN~PFan-tGek~eLteEEtlLIIrRLHkVLRPFlLRR  620 (1157)
T KOG0386         545 QRRLLLTGTPLQNNLPELWALLNFLLPNI--FNSCKAF-EQWFNQPFAN-TGEKVELTEEETLLIIRRLHKVLRPFLLRR  620 (1157)
T ss_pred             HHHHHHCCCHHHHCCHHHHHHHHHHCCCH--HHHHHHH-HHHHHHHHHH-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             21565328832221177899998763521--1047579-8986126664-387312552278999999887664788876


Q ss_pred             HCCCC-CCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCC--CCCHHHHHHHHHHHHHHCCCCCCCCCCCCC------
Q ss_conf             00001-001001100034524536899888999999851033--452022347888875420354100022343------
Q gi|255764515|r  230 DIADY-QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQG--ENIEAFNSASKTVKCLQLANGAVYYDEEKH------  300 (458)
Q Consensus       230 ~~~~~-~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~--~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~------  300 (458)
                      .+.++ ..+|..+..+..+.|+.-|...|..+........++  +...........+.++.+|+||..++..+.      
T Consensus       621 lKkeVE~~LPdKve~viKC~mSalQq~lY~~m~~~g~l~~d~~~g~~g~k~L~N~imqLRKiCNHP~lf~~ve~~~~~~~  700 (1157)
T KOG0386         621 LKKEVEQELPDKVEDVIKCDMSALQQSLYKQMQNKGQLLKDTAKGKKGYKPLFNTIMQLRKLCNHPYLFANVENSYTLHY  700 (1157)
T ss_pred             HHHHHHHHCCHHHHHHHHEEHHHHHHHHHHHHHHCCCCCCCCHHCCCCCHHHHHHHHHHHHHCCCCHHHHHHCCCCCCCC
T ss_conf             56777664734554763020205667631888847988767210034641154576999985477215444303422002


Q ss_pred             ---CHHCCCCCCCCHHHHHHC--CCCCEEEEHHHHHHHHHHHHH---------CCCCCCCH-HHHHHHHHHHCCCCC--C
Q ss_conf             ---000134333325665412--488403422236788866410---------00265334-458998764245885--5
Q gi|255764515|r  301 ---WKEVHDEKIKALEVIIEK--ANAAPIIVAYHFNSDLARLQK---------AFPQGRTL-DKDPCTIQEWNEGKI--P  363 (458)
Q Consensus       301 ---~~~~~~~k~~~l~~il~~--~~~~kviif~~~~~~~~~i~~---------~~~~g~~~-~~r~~~i~~f~~~~~--~  363 (458)
                         .....++|+..|..++..  ..|..|+.|++.+..++.+.-         ...+|+|. ++|-..++.||.++.  .
T Consensus       701 ~~~dL~R~sGKfELLDRiLPKLkatgHRVLlF~qMTrlmdimEdyL~~~~~kYlRLDG~TK~~eRg~ll~~FN~Pds~yf  780 (1157)
T KOG0386         701 DIKDLVRVSGKFELLDRILPKLKATGHRVLLFSQMTRLMDILEDYLQIREYKYLRLDGQTKVEERGDLLEIFNAPDSPYF  780 (1157)
T ss_pred             CHHHHHHHCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHEEEECCCCCHHHHHHHHHHHCCCCCCEE
T ss_conf             70578773147999976608877327601157778888999999986624212441587661468999997159998625


Q ss_pred             EEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             89984422111622001785999908998986864456666202202037877528999985899689999999999999
Q gi|255764515|r  364 LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI  443 (458)
Q Consensus       364 vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~  443 (458)
                      +++.|+.|||.|+|||.|++++| ||..|||....||.+|.     ||+||++.|.|+++++-++++|.|+.....|.++
T Consensus       781 ~FllstragglglNlQtadtvii-fdsdwnp~~d~qaqdra-----hrigq~~evRv~rl~tv~sveE~il~~a~~Kl~~  854 (1157)
T KOG0386         781 IFLLSTRAGGLGLNLQTADTVII-FDSDWNPHQDLQAQDRA-----HRIGQKKEVRVLRLITVNSVEEKILAEAFYKLDV  854 (1157)
T ss_pred             EEEEEECCCCCCCCHHHCCEEEE-ECCCCCCHHHHHHHHHH-----HHHHCHHHEEEEEEEHHHHHHHHHHHHHHHHCCC
T ss_conf             64332102555403211352788-65888831679999999-----9750212301123100407999999999975074


Q ss_pred             HHHHHHHHH
Q ss_conf             999985541
Q gi|255764515|r  444 QDLLLNALK  452 (458)
Q Consensus       444 ~~~~~~~~~  452 (458)
                      ..-++.+++
T Consensus       855 d~kviqag~  863 (1157)
T KOG0386         855 DGKVIQAGK  863 (1157)
T ss_pred             HHHHHHCCC
T ss_conf             176643012


No 11 
>KOG1015 consensus
Probab=100.00  E-value=0  Score=426.42  Aligned_cols=433  Identities=22%  Similarity=0.297  Sum_probs=312.8

Q ss_pred             CCCCHHHHHHHHHHHHC-------------CCEEEEECCCCCHHHHHHHHHHHHHH---CCCCCEEEEECCHHHHHHHHH
Q ss_conf             98747899999999967-------------98099958899868999999999997---599949999160465699999
Q gi|255764515|r    1 MNLAPHQTKIVDWILDH-------------KRCAIWASMGSGKTVSVLTALSYIHL---WGEKSVLVIAPLRVAQSVWTS   64 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~-------------~~~ll~~~~G~GKT~~al~~~~~l~~---~~~~~~LIv~P~~l~~~~W~~   64 (458)
                      .+|.|||..+|.||++.             -+|+|||.||||||+|.++++-....   .|-+++|||||.+++. .|..
T Consensus       667 ~kLKpHQv~GvqFMwd~~~eSlkr~~~~~GsGcILAHcMGLGKTlQVvtflhTvL~c~klg~ktaLvV~PlNt~~-NW~~  745 (1567)
T KOG1015         667 IKLKPHQVDGVQFMWDCCCESLKRTKKSPGSGCILAHCMGLGKTLQVVTFLHTVLLCDKLGFKTALVVCPLNTAL-NWMN  745 (1567)
T ss_pred             HHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHCCCCEEHHHHHHHHHHHHHCCCCCEEEEECCHHHHH-HHHH
T ss_conf             644722013025899999999886127998631778750456400146788899874204785689972359988-9999


Q ss_pred             HHHHHCCC----CCCEEEEEEC--CHHHH---HHHHCCCCCEEEECCCCHHHHHHHC--------------CCCCCCCEE
Q ss_conf             99985588----8815999858--97898---8873077986998064202334420--------------001132204
Q gi|255764515|r   65 EVQRWSNF----SHMNISVITG--TVKQR---TKVLKTPAVLYVINFENLGWLVQEL--------------KGTWPFATI  121 (458)
Q Consensus        65 Ei~kf~~~----~~~~~~~~~g--~~~~r---~~~~~~~~~i~i~s~e~~~~~~~~~--------------~~~~~~~~i  121 (458)
                      ||++|...    ..++|..+..  .+..|   ...|.....|+|+.|++++.+...-              +-.-.+|+|
T Consensus       746 EFekWm~~~e~~~~leV~eL~~vkr~e~R~~~L~~W~~~ggVmIiGYdmyRnLa~gr~vk~rk~ke~f~k~lvdpGPD~v  825 (1567)
T KOG1015         746 EFEKWMEGLEDDEKLEVSELATVKRPEERSYMLQRWQEDGGVMIIGYDMYRNLAQGRNVKSRKLKEIFNKALVDPGPDFV  825 (1567)
T ss_pred             HHHHHCCCCCCCCCCEEEHHHHCCCHHHHHHHHHHHHHCCCEEEEEHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             99986124222466212021202674889999999975297799736888877514560356799999986057899768


Q ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCC
Q ss_conf             40453100246543115677776654305980799658402310010134677517888775327788777369564033
Q gi|255764515|r  122 VVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGS  201 (458)
Q Consensus       122 IiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~  201 (458)
                      ||||+|-+||..+    ...+++.+.  .++++|+|||||.+|++.|+|.|++|+-|+ .||. +.+|++||.+..+.+.
T Consensus       826 VCDE~HiLKNeks----a~Skam~~i--rtkRRI~LTGTPLQNNLmEY~CMVnFVKe~-lLGs-~~EfrNRFvNpI~nGq  897 (1567)
T KOG1015         826 VCDEGHILKNEKS----AVSKAMNSI--RTKRRIILTGTPLQNNLMEYHCMVNFVKEN-LLGS-IKEFRNRFVNPIQNGQ  897 (1567)
T ss_pred             EECCHHHHCCCHH----HHHHHHHHH--HHHEEEEEECCCHHHHHHHHHHHHHHCCCC-CCCC-CHHHHHHHCCCCCCCC
T ss_conf             7242122135247----899999987--764047752671133248887888760433-3457-5889976238222675


Q ss_pred             CHHHHHH--HHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHH---
Q ss_conf             0000245--55545589999974245433200001-00100110003452453689988899999985103345202---
Q gi|255764515|r  202 HIGAVRY--TAKETAQKEIEAQLSDCCLSLDIADY-QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEA---  275 (458)
Q Consensus       202 ~~~~~~~--~~~~~~~~~l~~~l~~~~~~~~~~~~-~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~---  275 (458)
                      .......  ........+++..|..++.+....-. ..+||....++.|.+++-|.++|..+....  .-.+.+...   
T Consensus       898 ~~dST~~DVr~Mk~RsHILye~LkgcVqRkDy~Vltk~LPPK~eyVi~vrltelQ~~LYq~yL~h~--~~~G~d~eg~~g  975 (1567)
T KOG1015         898 CADSTMVDVRVMKKRSHILYEMLKGCVQRKDYTVLTKFLPPKHEYVIAVRLTELQCKLYQYYLDHL--TGVGNDSEGGRG  975 (1567)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCHHHHHHHHHHHHHC--CCCCCCCCCCCC
T ss_conf             577738889999888899999998787531055531458986269999862599999999998631--256875335442


Q ss_pred             --HHHHHHHHHHHHCCCCCCCC----------------------------------------------------------
Q ss_conf             --23478888754203541000----------------------------------------------------------
Q gi|255764515|r  276 --FNSASKTVKCLQLANGAVYY----------------------------------------------------------  295 (458)
Q Consensus       276 --~~~~~~~~~l~q~~~~~~~~----------------------------------------------------------  295 (458)
                        .+.+...-.+.+|..||...                                                          
T Consensus       976 ~~arlf~dfqmlsrIwtHP~~lqL~s~~~enkR~~seddm~~fi~D~sde~e~s~~s~d~~~~~ks~~~s~~Desss~~~ 1055 (1567)
T KOG1015         976 AGARLFQDFQMLSRIWTHPWCLQLDSISKENKRYFSEDDMDEFIADDSDETEMSLSSDDYTKKKKSGKKSKKDESSSGSG 1055 (1567)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEECHHHHHHCCCCCCCCHHCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCC
T ss_conf             23567788999999964887423135665411335643200255678741001236663011023344566655555556


Q ss_pred             -----------------------------------------------------------CCCCCCHHCCCCCCCCHHHHH
Q ss_conf             -----------------------------------------------------------223430001343333256654
Q gi|255764515|r  296 -----------------------------------------------------------DEEKHWKEVHDEKIKALEVII  316 (458)
Q Consensus       296 -----------------------------------------------------------~~~~~~~~~~~~k~~~l~~il  316 (458)
                                                                                 .+.......+|+|+..|.+|+
T Consensus      1056 ~~g~~ev~k~k~rk~r~~~~~~~~~~g~~~D~~l~ll~dlag~~s~~~d~ppew~kd~v~e~d~~v~~~SgKmiLLleIL 1135 (1567)
T KOG1015        1056 SDGDVEVIKVKNRKSRGGGEGNVDETGNNPDVSLKLLEDLAGSSSNPSDPPPEWYKDFVTEADAEVLEHSGKMILLLEIL 1135 (1567)
T ss_pred             CCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEHHHHHH
T ss_conf             67752443210021036656764223788625789863214554477888557677665441123440376224599999


Q ss_pred             H--CCCCCEEEEHHHHHHHHHHHHHCC-------------------------------CCC-CCHHHHHHHHHHHCCCC-
Q ss_conf             1--248840342223678886641000-------------------------------265-33445899876424588-
Q gi|255764515|r  317 E--KANAAPIIVAYHFNSDLARLQKAF-------------------------------PQG-RTLDKDPCTIQEWNEGK-  361 (458)
Q Consensus       317 ~--~~~~~kviif~~~~~~~~~i~~~~-------------------------------~~g-~~~~~r~~~i~~f~~~~-  361 (458)
                      .  +.-|.|++||++-...++.|...+                               .+| .+..+|..+.++||++. 
T Consensus      1136 ~mceeIGDKlLVFSQSL~SLdLIe~fLe~v~r~gk~~~d~~~~~~~eGkW~~GkDyyriDGst~s~~R~k~~~~FNdp~N 1215 (1567)
T KOG1015        1136 RMCEEIGDKLLVFSQSLISLDLIEDFLELVSREGKEDKDKPLIYKGEGKWLRGKDYYRLDGSTTSQSRKKWAEEFNDPTN 1215 (1567)
T ss_pred             HHHHHHCCEEEEEECCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEECCCCEEEECCCCCHHHHHHHHHHHCCCCC
T ss_conf             99997365368762333225899999986024686544464222555522047743775485537889999998468335


Q ss_pred             --CCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHH
Q ss_conf             --558998442211162200178599990899898686445666620220203787752899998589968999999999
Q gi|255764515|r  362 --IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRT  439 (458)
Q Consensus       362 --~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~  439 (458)
                        .+.+|+|++||+.||||- |+|+||.||-.|||+-..|++-|+     ||+||++||+||+|+|.||+|++||+++..
T Consensus      1216 lRaRl~LISTRAGsLGiNLv-AANRVIIfDasWNPSyDtQSIFRv-----yRfGQtKPvyiYRfiAqGTmEeKIYkRQVT 1289 (1567)
T KOG1015        1216 LRARLFLISTRAGSLGINLV-AANRVIIFDASWNPSYDTQSIFRV-----YRFGQTKPVYIYRFIAQGTMEEKIYKRQVT 1289 (1567)
T ss_pred             CEEEEEEEEECCCCCCCCEE-ECCEEEEEECCCCCCCCHHHHHHH-----HHHCCCCCEEEHHHHHCCCHHHHHHHHHHH
T ss_conf             01379999622676520023-314289994555875206889999-----860576731401445414088899998876


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999855
Q gi|255764515|r  440 KSTIQDLLLNA  450 (458)
Q Consensus       440 K~~~~~~~~~~  450 (458)
                      |..++-.|+|.
T Consensus      1290 Kqsls~RVVDe 1300 (1567)
T KOG1015        1290 KQSLSFRVVDE 1300 (1567)
T ss_pred             HHHHHHHHHHH
T ss_conf             75543543029


No 12 
>KOG1000 consensus
Probab=100.00  E-value=0  Score=412.04  Aligned_cols=406  Identities=22%  Similarity=0.260  Sum_probs=296.1

Q ss_pred             CCCHHHHHHHHHHHHC-CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             8747899999999967-980999588998689999999999975999499991604656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDH-KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~-~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      .|.|||.++|.|.+++ +|++||||||+|||+|||+++.+.  ..+|+.|||||+++.. .|.+++++|.+.-.. +.++
T Consensus       198 ~LlPFQreGv~faL~RgGR~llADeMGLGKTiQAlaIA~yy--raEwplliVcPAsvrf-tWa~al~r~lps~~p-i~vv  273 (689)
T KOG1000         198 RLLPFQREGVIFALERGGRILLADEMGLGKTIQALAIARYY--RAEWPLLIVCPASVRF-TWAKALNRFLPSIHP-IFVV  273 (689)
T ss_pred             HHCCHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHH--HHCCCEEEEECHHHHH-HHHHHHHHHCCCCCC-EEEE
T ss_conf             61703565478898538739984124541688999999998--6048679992278868-999999985310260-4788


Q ss_pred             ECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             58978988873077986998064202334420001132204404531002465431156777766543059807996584
Q gi|255764515|r   81 TGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        81 ~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      .+..+. ..-......|.|+||+.+..+.+.+.. .+|.+||+||+|++|+..+    ++.+++.-+...++++++||||
T Consensus       274 ~~~~D~-~~~~~t~~~v~ivSye~ls~l~~~l~~-~~~~vvI~DEsH~Lk~skt----kr~Ka~~dllk~akhvILLSGT  347 (689)
T KOG1000         274 DKSSDP-LPDVCTSNTVAIVSYEQLSLLHDILKK-EKYRVVIFDESHMLKDSKT----KRTKAATDLLKVAKHVILLSGT  347 (689)
T ss_pred             ECCCCC-CCCCCCCCEEEEEEHHHHHHHHHHHHC-CCCEEEEEECHHHHHCCCH----HHHHHHHHHHHHHHHEEEECCC
T ss_conf             526677-654566772789878999999998736-5411899712565410112----2366665699876444772388


Q ss_pred             CHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHCCCCC-CCC
Q ss_conf             023100101346775178887753277887773695640330000245555455899999742-454332000010-010
Q gi|255764515|r  161 PSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLS-DCCLSLDIADYQ-NID  238 (458)
Q Consensus       161 Pi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~-~~~~~~~~~~~~-~l~  238 (458)
                      |.-.+|.|||+++..+++  .+++.|.+|-.+||+..+......    ..+..+..++...+. ..|+++.+.+.+ ++|
T Consensus       348 PavSRP~elytqi~avd~--tlfp~f~efa~rYCd~k~vr~~~D----ykg~tnl~EL~~lL~k~lMIRRlK~dvL~qLP  421 (689)
T KOG1000         348 PAVSRPSELYTQIRAVDH--TLFPNFHEFAIRYCDGKQVRFCFD----YKGCTNLEELAALLFKRLMIRRLKADVLKQLP  421 (689)
T ss_pred             CCCCCCHHHHHHHHHHCC--CCCCCHHHHHHHHCCCCCCCEEEE----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             556781442135554121--004228998777537641102450----37787789999999999999999998875388


Q ss_pred             CCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHHH-
Q ss_conf             0110003452453689988899999985103345202234788887542035410002234300013433332566541-
Q gi|255764515|r  239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE-  317 (458)
Q Consensus       239 ~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il~-  317 (458)
                      +. ...+.+.....+-...+.+..+... ....+....+.......                +......|+..+.+.+- 
T Consensus       422 pK-rr~Vv~~~~gr~da~~~~lv~~a~~-~t~~~~~e~~~~~l~l~----------------y~~tgiaK~~av~eyi~~  483 (689)
T KOG1000         422 PK-RREVVYVSGGRIDARMDDLVKAAAD-YTKVNSMERKHESLLLF----------------YSLTGIAKAAAVCEYILE  483 (689)
T ss_pred             CC-CEEEEEECCCCCCHHHHHHHHHHHH-CCHHHHHHHHHHHHHHH----------------HHHHCCCCCHHHHHHHHH
T ss_conf             01-0489997478622678999987532-00123666656778878----------------987511020889999974


Q ss_pred             -----CCCCCEEEEHHHHHHHHHHHHHCC---------CCCCCH-HHHHHHHHHHC-CCCCCEEEEEHHHCCCCCCCCCC
Q ss_conf             -----248840342223678886641000---------265334-45899876424-58855899844221116220017
Q gi|255764515|r  318 -----KANAAPIIVAYHFNSDLARLQKAF---------PQGRTL-DKDPCTIQEWN-EGKIPLLFAHPASCGHGLNLQYG  381 (458)
Q Consensus       318 -----~~~~~kviif~~~~~~~~~i~~~~---------~~g~~~-~~r~~~i~~f~-~~~~~vli~s~~~~~~GlnL~~a  381 (458)
                           ...+.|.+||+|+..+++.|...+         ++|+++ .+|...++.|+ +.+..|.++|+.|||+||+|+ |
T Consensus       484 ~~~l~d~~~~KflVFaHH~~vLd~Iq~~~~~r~vg~IRIDGst~s~~R~ll~qsFQ~seev~VAvlsItA~gvGLt~t-A  562 (689)
T KOG1000         484 NYFLPDAPPRKFLVFAHHQIVLDTIQVEVNKRKVGSIRIDGSTPSHRRTLLCQSFQTSEEVRVAVLSITAAGVGLTLT-A  562 (689)
T ss_pred             CCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCCCEEEEEEEEEECCCCEEEE-C
T ss_conf             744456887359999414879999999998747975885698984347899987314631479999986314441465-1


Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             859999089989868644566662022020378775289999858996899999999999999999
Q gi|255764515|r  382 GNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLL  447 (458)
Q Consensus       382 ~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~  447 (458)
                      ++.|+|.+++|||..+.||++|+     ||+||+..|.||+|+++||+|+.+|..+.+|.+...++
T Consensus       563 a~~VVFaEL~wnPgvLlQAEDRa-----HRiGQkssV~v~ylvAKgT~Ddy~Wp~l~~KL~vl~s~  623 (689)
T KOG1000         563 ASVVVFAELHWNPGVLLQAEDRA-----HRIGQKSSVFVQYLVAKGTADDYMWPMLQQKLDVLGSV  623 (689)
T ss_pred             CCEEEEEEECCCCCEEEECHHHH-----HHCCCCCEEEEEEEEECCCHHHHHHHHHHHHHHHHHHC
T ss_conf             32589998237875477514656-----64056651138999954845777789999998788662


No 13 
>KOG1002 consensus
Probab=100.00  E-value=0  Score=410.71  Aligned_cols=430  Identities=19%  Similarity=0.248  Sum_probs=307.5

Q ss_pred             CCCCHHHHHHHHHHHHC-----CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             98747899999999967-----9809995889986899999999999759994999916046569999999985588881
Q gi|255764515|r    1 MNLAPHQTKIVDWILDH-----KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~-----~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      |.|.|||.+++.|+...     .+|+||||||.|||+|+|+++..  .-...++|||||.-.+. ||..||.+|+. ..+
T Consensus       183 i~LL~fQkE~l~Wl~~QE~Ss~~GGiLADEMGMGKTIQtIaLlla--e~~ra~tLVvaP~VAlm-QW~nEI~~~T~-gsl  258 (791)
T KOG1002         183 IPLLPFQKEGLAWLTSQEESSVAGGILADEMGMGKTIQTIALLLA--EVDRAPTLVVAPTVALM-QWKNEIERHTS-GSL  258 (791)
T ss_pred             ECCHHHHHHHHHHHHHHHHHHHCCCEEHHHHCCCHHHHHHHHHHH--CCCCCCEEEECCHHHHH-HHHHHHHHHCC-CCE
T ss_conf             213144677788887735543124311243146417999999986--23568706975489999-99999987625-764


Q ss_pred             EEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHH----------------HCCCCCCCCEEECCCCCCCCCCCCCCHHH
Q ss_conf             59998589789888730779869980642023344----------------20001132204404531002465431156
Q gi|255764515|r   76 NISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQ----------------ELKGTWPFATIVVDESTKLKSFRLRQGSK  139 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~----------------~~~~~~~~~~iIiDEaH~lkn~~~~~~s~  139 (458)
                      ++.+++|..+.....-...|++++++|..+....+                .++-.++|..||+||||.+|+.    .|.
T Consensus       259 kv~~YhG~~R~~nikel~~YDvVLTty~vvEs~yRk~~~GfrrKngv~ke~SlLHsi~~~RiIlDEAH~IK~R----~sn  334 (791)
T KOG1002         259 KVYIYHGAKRDKNIKELMNYDVVLTTYAVVESVYRKQDYGFRRKNGVDKEKSLLHSIKFYRIILDEAHNIKDR----QSN  334 (791)
T ss_pred             EEEEEECCCCCCCHHHHHCCCEEEEECHHHHHHHHHCCCCCCCCCCCCCCCCHHHHCEEEEEEHHHHCCCCCC----CCC
T ss_conf             7999726423577888606767997018788898740234211377424532333101023522120253101----332


Q ss_pred             HHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHH-CCHH---------------------
Q ss_conf             777766543059807996584023100101346775178887753277887773-6956---------------------
Q gi|255764515|r  140 TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARW-FNTT---------------------  197 (458)
Q Consensus       140 ~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~-~~~~---------------------  197 (458)
                      ++|+.-  ...+.|+|+|||||.+|++.|||++++||+-. ++.   +.|.... |...                     
T Consensus       335 TArAV~--~L~tt~rw~LSGTPLQNrigElySLiRFL~i~-Pfs---yyfc~~cdc~~~~~~ftdr~~c~~c~h~~m~h~  408 (791)
T KOG1002         335 TARAVF--ALETTYRWCLSGTPLQNRIGELYSLIRFLNIN-PFS---YYFCTKCDCASLDWKFTDRMHCDHCSHNIMQHT  408 (791)
T ss_pred             HHHHHH--HHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCC-CCH---HHHHHHCCCCCCCEEECCCCCCCCCCCHHHHHH
T ss_conf             788887--66766532205883011278999999987068-404---435432243422111024456875441065654


Q ss_pred             -HHCC-CHHHHHH----HHHHHHHHHHHHHHHHHHHHHHCC---CCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHC
Q ss_conf             -4033-0000245----555455899999742454332000---010010011000345245368998889999998510
Q gi|255764515|r  198 -QIGS-HIGAVRY----TAKETAQKEIEAQLSDCCLSLDIA---DYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDL  268 (458)
Q Consensus       198 -~~~~-~~~~~~~----~~~~~~~~~l~~~l~~~~~~~~~~---~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~  268 (458)
                       .++. .......    -++..+...+...+..+++++.+-   +.+.+|+..+..+.--++.+....|+.+-......+
T Consensus       409 ~~~n~~mlk~IqkfG~eGpGk~af~~~h~llk~ImlrrTkl~RAdDLgLPPRiv~vRrD~fn~eE~D~YeSLY~dSkrkf  488 (791)
T KOG1002         409 CFFNHFMLKPIQKFGVEGPGKEAFNNIHTLLKNIMLRRTKLERADDLGLPPRIVTVRRDFFNEEEKDLYESLYKDSKRKF  488 (791)
T ss_pred             HHHCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             32122004551120456841787777778999999887210320003799500221043302578899999987657766


Q ss_pred             CC----C--CCHHHHHHHHHHHHHHCCCCCCCCCCCCC------------------------------------------
Q ss_conf             33----4--52022347888875420354100022343------------------------------------------
Q gi|255764515|r  269 QG----E--NIEAFNSASKTVKCLQLANGAVYYDEEKH------------------------------------------  300 (458)
Q Consensus       269 ~~----~--~~~~~~~~~~~~~l~q~~~~~~~~~~~~~------------------------------------------  300 (458)
                      .+    +  .-...+....+.+++|++.||.+......                                          
T Consensus       489 ntyieeGvvlNNYAnIF~LitRmRQ~aDHP~LVl~S~~~n~~~enk~~~~C~lc~d~aed~i~s~ChH~FCrlCi~eyv~  568 (791)
T KOG1002         489 NTYIEEGVVLNNYANIFTLITRMRQAADHPDLVLYSANANLPDENKGEVECGLCHDPAEDYIESSCHHKFCRLCIKEYVE  568 (791)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEHHHCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             66776315453078999999999974468400110211478766657244124688266567643147899999999987


Q ss_pred             ------------------------CHH---------------------CCCCCCCCHHH----HHHCCCCCEEEEHHHHH
Q ss_conf             ------------------------000---------------------13433332566----54124884034222367
Q gi|255764515|r  301 ------------------------WKE---------------------VHDEKIKALEV----IIEKANAAPIIVAYHFN  331 (458)
Q Consensus       301 ------------------------~~~---------------------~~~~k~~~l~~----il~~~~~~kviif~~~~  331 (458)
                                              ..+                     ..|.|+++|.+    +.+.....|-|||++|.
T Consensus       569 ~f~~~~nvtCP~C~i~LsiDlse~alek~~l~~Fk~sSIlnRinm~~~qsSTKIEAL~EEl~~l~~rd~t~KsIVFSQFT  648 (791)
T KOG1002         569 SFMENNNVTCPVCHIGLSIDLSEPALEKTDLKGFKASSILNRINMDDWQSSTKIEALVEELYFLRERDRTAKSIVFSQFT  648 (791)
T ss_pred             HHHCCCCCCCCCCCCCCCCCCCCHHHHHCCHHHHHHHHHHHHCCHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             64114687786334444445452243213454435677763404132000157999999999999715525420498778


Q ss_pred             HHHHHHHHCCC----------CCCCHHHHHHHHHHH-CCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHH
Q ss_conf             88866410002----------653344589987642-4588558998442211162200178599990899898686445
Q gi|255764515|r  332 SDLARLQKAFP----------QGRTLDKDPCTIQEW-NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM  400 (458)
Q Consensus       332 ~~~~~i~~~~~----------~g~~~~~r~~~i~~f-~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~  400 (458)
                      ++++.|..+++          +++++..|...|+.| ++..+.|+++|.+|||+.|||+.|++ |.++||||||+..+|+
T Consensus       649 SmLDLi~~rL~kaGfscVkL~GsMs~~ardatik~F~nd~~c~vfLvSLkAGGVALNLteASq-VFmmDPWWNpaVe~Qa  727 (791)
T KOG1002         649 SMLDLIEWRLGKAGFSCVKLVGSMSPAARDATIKYFKNDIDCRVFLVSLKAGGVALNLTEASQ-VFMMDPWWNPAVEWQA  727 (791)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEEECCCCEEEEECHHCE-EEEECCCCCHHHHHHH
T ss_conf             899999988612673389963677867789999974128881799998605846863100002-5762664367777554


Q ss_pred             HHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             66662022020378775289999858996899999999999999999855
Q gi|255764515|r  401 IERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA  450 (458)
Q Consensus       401 ~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~  450 (458)
                      .+||     |||||.+||.|.+|+.++|||++|.+++++|..++.+-++.
T Consensus       728 ~DRi-----HRIGQ~rPvkvvrf~iEnsiE~kIieLQeKKa~mihaTi~q  772 (791)
T KOG1002         728 QDRI-----HRIGQYRPVKVVRFCIENSIEEKIIELQEKKANMIHATIGQ  772 (791)
T ss_pred             HHHH-----HHHCCCCCEEEEEEEHHCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             4467-----76047565268886301228999999998886562433177


No 14 
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]
Probab=100.00  E-value=0  Score=413.86  Aligned_cols=431  Identities=24%  Similarity=0.349  Sum_probs=328.2

Q ss_pred             CCCHHHHHHHHHHHH-----CCCEEEEECCCCCHHHHHHHHHHHHHHCC---CCCEEEEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             874789999999996-----79809995889986899999999999759---9949999160465699999999855888
Q gi|255764515|r    2 NLAPHQTKIVDWILD-----HKRCAIWASMGSGKTVSVLTALSYIHLWG---EKSVLVIAPLRVAQSVWTSEVQRWSNFS   73 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~-----~~~~ll~~~~G~GKT~~al~~~~~l~~~~---~~~~LIv~P~~l~~~~W~~Ei~kf~~~~   73 (458)
                      +|+|||..+++|+..     ..++++||+||+|||+++++++..+....   .++.|||||.+++. +|.+|+.+|.+  
T Consensus       338 ~lr~yq~~g~~wl~~~l~~~~~~~ilad~mglGKTiq~i~~l~~~~~~~~~~~~~~liv~p~s~~~-nw~~e~~k~~~--  414 (866)
T COG0553         338 ELRPYQLEGVNWLSELLRSNLLGGILADDMGLGKTVQTIALLLSLLESIKVYLGPALIVVPASLLS-NWKREFEKFAP--  414 (866)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEECCHHHHH-HHHHHHHHHCC--
T ss_conf             104889986699999877623687757523342199999998777764013578726871477776-79999986141--


Q ss_pred             CCE-EEEEECCHHH----HHHH---HCC----CCCEEEECCCCHHHH--HHHCCCCCCCCEEECCCCCCCCCCCCCCHHH
Q ss_conf             815-9998589789----8887---307----798699806420233--4420001132204404531002465431156
Q gi|255764515|r   74 HMN-ISVITGTVKQ----RTKV---LKT----PAVLYVINFENLGWL--VQELKGTWPFATIVVDESTKLKSFRLRQGSK  139 (458)
Q Consensus        74 ~~~-~~~~~g~~~~----r~~~---~~~----~~~i~i~s~e~~~~~--~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~  139 (458)
                      .++ +....|....    +...   ...    ..+++++||+.+...  .........|+.+|+||||++||..    ++
T Consensus       415 ~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~v~itty~~l~~~~~~~~~l~~~~~~~~v~DEa~~ikn~~----s~  490 (866)
T COG0553         415 DLRLVLVYHGEKSELDKKREALRDLLKLHLVIIFDVVITTYELLRRFLVDHGGLKKIEWDRVVLDEAHRIKNDQ----SS  490 (866)
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCEEHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCHH----HH
T ss_conf             21002321153112103699999998621330101899999999975020554223677698997887540477----89


Q ss_pred             HHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHH-HCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHH
Q ss_conf             77776654305980799658402310010134677-51788877532778877736956403300002455554558999
Q gi|255764515|r  140 TARALAKPAWESERFIELTGTPSPNGLIDLWGQIW-FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEI  218 (458)
Q Consensus       140 ~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~-~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  218 (458)
                      ..+++.  ..++.++++|||||++|++.|+|++++ |+.|+ .++.....|...|............  ..........+
T Consensus       491 ~~~~l~--~~~~~~~~~LtgTPlen~l~eL~sl~~~f~~p~-~~~~~~~~f~~~~~~~~~~~~~~~~--~~~~~~~~~~l  565 (866)
T COG0553         491 EGKALQ--FLKALNRLDLTGTPLENRLGELWSLLQEFLNPG-LLGTSFAIFTRLFEKPIQAEEDIGP--LEARELGIELL  565 (866)
T ss_pred             HHHHHH--HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCC-CCCCHHHHHHHHHCCHHHHHHHHCH--HHHHHHHHHHH
T ss_conf             999999--875543322899964560899999989985743-2662389999986016665432010--24567789999


Q ss_pred             HHHHHHHHHHHHCCC--CC-CCCCCCEEEEEEECCHHHHHHHHHHHH---HHHHHCCC---CCC-------HHHHHHHHH
Q ss_conf             997424543320000--10-010011000345245368998889999---99851033---452-------022347888
Q gi|255764515|r  219 EAQLSDCCLSLDIAD--YQ-NIDKPILITKKVPLPQPVMKQYHKFQR---ELYCDLQG---ENI-------EAFNSASKT  282 (458)
Q Consensus       219 ~~~l~~~~~~~~~~~--~~-~l~~~~~~~~~v~l~~~~~~~y~~~~~---~~~~~~~~---~~~-------~~~~~~~~~  282 (458)
                      ...+.++++++.+.+  .. .+|+.......++++..|.+.|.....   .....+..   ...       ...+.+..+
T Consensus       566 ~~~i~~f~lrr~k~~~~v~~~lp~k~e~~~~~~l~~~q~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~  645 (866)
T COG0553         566 RKLLSPFILRRTKEDVEVLKELPPKIEKVLECELSEEQRELYEALLEGAEKNQQLLEDLEKADSDENRIGDSELNILALL  645 (866)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCHHHHEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             86432676540011167887486322200114763779999999986403378999988752101555546777787889


Q ss_pred             HHHHHCCCCCCCCCCC-CCCHH--------------------CCC-CCCCCHHHHH-H--CCCCC--EEEEHHHHHHHHH
Q ss_conf             8754203541000223-43000--------------------134-3333256654-1--24884--0342223678886
Q gi|255764515|r  283 VKCLQLANGAVYYDEE-KHWKE--------------------VHD-EKIKALEVII-E--KANAA--PIIVAYHFNSDLA  335 (458)
Q Consensus       283 ~~l~q~~~~~~~~~~~-~~~~~--------------------~~~-~k~~~l~~il-~--~~~~~--kviif~~~~~~~~  335 (458)
                      .+++++|++|..+... .....                    ..+ .|...+.+++ .  ..++.  ++++|++|..+++
T Consensus       646 ~~lr~~~~~p~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~k~~~l~~ll~~~~~~~~~~~kvlifsq~t~~l~  725 (866)
T COG0553         646 TRLRQICNHPALVDEGLEATFDRIVLLLREDKDFDYLKKPLIQLSKGKLQALDELLLDKLLEEGHYHKVLIFSQFTPVLD  725 (866)
T ss_pred             HHHHHHHCCHHHHCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHH
T ss_conf             99998721864430432111212444300011024555578861530568999998889986277723488866605999


Q ss_pred             HHHHC---------CCCCCC-HHHHHHHHHHHCCC-CCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             64100---------026533-44589987642458-85589984422111622001785999908998986864456666
Q gi|255764515|r  336 RLQKA---------FPQGRT-LDKDPCTIQEWNEG-KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERI  404 (458)
Q Consensus       336 ~i~~~---------~~~g~~-~~~r~~~i~~f~~~-~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi  404 (458)
                      .+...         ..+|++ ...|...++.|+++ ...|+++|++|||.||||+ +++++|++|++|||+...||++|+
T Consensus       726 il~~~l~~~~~~~~~ldG~~~~~~r~~~i~~f~~~~~~~vflls~kagg~glnLt-~a~~vi~~d~~wNp~~e~Qa~dRa  804 (866)
T COG0553         726 LLEDYLKALGIKYVRLDGSTPAKRRQELIDRFNADEEEKVFLLSLKAGGLGLNLT-GADTVILFDPWWNPAVELQAIDRA  804 (866)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCCCCCEEEEEHHCCCCCCCCC-CCCEEEECCCCCCHHHHHHHHHHH
T ss_conf             9999998558757987378752128899999864667757997530057661214-565246607763667999999878


Q ss_pred             HCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2022020378775289999858996899999999999999999855
Q gi|255764515|r  405 GVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA  450 (458)
Q Consensus       405 ~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~  450 (458)
                           ||+||+++|.||+++++||+||+|++.+..|..+.+.++++
T Consensus       805 -----~RigQ~~~v~v~r~i~~~tiEe~i~~~~~~K~~l~~~~~~~  845 (866)
T COG0553         805 -----HRIGQKRPVKVYRLITRGTIEEKILELQEKKQELLDSLIDA  845 (866)
T ss_pred             -----HHCCCEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             -----76078015999984113739999999998899899998601


No 15 
>PRK04914 ATP-dependent helicase HepA; Validated
Probab=100.00  E-value=0  Score=394.46  Aligned_cols=408  Identities=17%  Similarity=0.201  Sum_probs=252.3

Q ss_pred             CCCCHHHHHHHHHHHHC--CCEEEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCHHHHHHHHHHHH-HHCCCCCCE
Q ss_conf             98747899999999967--9809995889986899999999999759-9949999160465699999999-855888815
Q gi|255764515|r    1 MNLAPHQTKIVDWILDH--KRCAIWASMGSGKTVSVLTALSYIHLWG-EKSVLVIAPLRVAQSVWTSEVQ-RWSNFSHMN   76 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~--~~~ll~~~~G~GKT~~al~~~~~l~~~~-~~~~LIv~P~~l~~~~W~~Ei~-kf~~~~~~~   76 (458)
                      ..|.|||...+..+.+.  +|.|||||||+|||++|..++..+...| .+++|||||+++. .||..|+. ||.    +.
T Consensus       150 ~~l~pHQ~~ia~~v~~r~~PRvLLADEVGLGKTIEAGLIl~ell~rgra~RvLIvvP~~L~-~QW~~EL~~KF~----L~  224 (955)
T PRK04914        150 AGLIPHQLYIAHEVGRRHAPRVLLADEVGLGKTIEAGLIIHQQLLTGRAERVLIIVPETLQ-HQWLVEMLRRFN----LR  224 (955)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH-HHHHHHHHHHCC----CC
T ss_conf             4656379999999971458848970588886899999999999974877779999277998-999999999839----98


Q ss_pred             EEEEECCHHHHH--H--HHCCCCCEEEECCCCHHHHH--HHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             999858978988--8--73077986998064202334--42000113220440453100246543115677776654305
Q gi|255764515|r   77 ISVITGTVKQRT--K--VLKTPAVLYVINFENLGWLV--QELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE  150 (458)
Q Consensus        77 ~~~~~g~~~~r~--~--~~~~~~~i~i~s~e~~~~~~--~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~  150 (458)
                      ..++....-...  .  ........+|+|++.++...  .+.....+||+|||||||++.+... ..|+.++.+..++.+
T Consensus       225 f~i~D~~r~~~~~~~~~NpF~~~~~vI~Sld~l~~~~~~~e~l~~a~WDLVIVDEAHhL~~~~~-~~s~~y~lve~La~~  303 (955)
T PRK04914        225 FSLFDEERCAEAQADADNPFETEQLVICSLDFLRKNKKRLEQALDAEWDLLVVDEAHHLVWSEE-APSREYQVVEQLAEV  303 (955)
T ss_pred             CEEECCHHHHHHHCCCCCCCCCCCEEEEEHHHHCCCHHHHHHHHCCCCCEEEEHHHHHHCCCCC-CCCHHHHHHHHHHHH
T ss_conf             0995518888753357997545897998789960396789987338988899713445305887-888799999999851


Q ss_pred             CCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHH---HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98079965840231001013467751788877532778877736956403300002---455554558999997424543
Q gi|255764515|r  151 SERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAV---RYTAKETAQKEIEAQLSDCCL  227 (458)
Q Consensus       151 ~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~---~~~~~~~~~~~l~~~l~~~~~  227 (458)
                      ++++++|||||.+++..+.|+.+++|+|...  ..+..|..+..............   .... ......+...+.+...
T Consensus       304 ~~~lLLLTATP~QlG~e~~Fa~L~LLDPdrF--~d~~~F~~e~~~y~~va~~v~~L~~~~~l~-~~~~~~l~~~l~e~~~  380 (955)
T PRK04914        304 IPGVLLLTATPEQLGQESHFARLRLLDPDRF--HDYEAFVEEEQQYRPVADAVQALLDGEKLS-DDALNALGELLGEQDI  380 (955)
T ss_pred             CCCEEEEECCCCCCCCHHHHHHHHCCCCCCC--CCHHHHHHHHHHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHHHHH
T ss_conf             5976998479988986668988527794211--588889988875578999999863156688-8999999998644114


Q ss_pred             ------------------------------------HHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             ------------------------------------32000010010011000345245368998889999998510334
Q gi|255764515|r  228 ------------------------------------SLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE  271 (458)
Q Consensus       228 ------------------------------------~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~  271 (458)
                                                          +-.......+|.........+++........    ..       
T Consensus       381 ~~l~~~~~~~~~~~~~~r~~li~~Lldr~gtgrvlfRntRa~v~gfp~R~l~~~~l~~~~~~~~~~~----~~-------  449 (955)
T PRK04914        381 EPLLQAINSDSEDAQAARQELISELLDRHGTGRVLFRNTRAAVKGFPKRELHPYPLPLPEQYQTAIR----KS-------  449 (955)
T ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCHHHHHHCCCCCCCHHHHHHHH----HH-------
T ss_conf             4789875214445699999999999862321577776567774316554531056787156787654----32-------


Q ss_pred             CCHHHHHHHHHHHHH-HCCCCCC--CCCCCCCCHHCCCCCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHH---------
Q ss_conf             520223478888754-2035410--0022343000134333325665412488403422236788866410---------
Q gi|255764515|r  272 NIEAFNSASKTVKCL-QLANGAV--YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQK---------  339 (458)
Q Consensus       272 ~~~~~~~~~~~~~l~-q~~~~~~--~~~~~~~~~~~~~~k~~~l~~il~~~~~~kviif~~~~~~~~~i~~---------  339 (458)
                               ...... ++.....  ............++|+++|.+.++...++|++|||.+..+...+.+         
T Consensus       450 ---------~~~~~~~~l~~E~~~~~~~~~~~~~~~~D~rv~~Li~~Lk~~~~eKvLVFte~~~Ta~~L~~~Lr~~~Gi~  520 (955)
T PRK04914        450 ---------LEARARDMLYPEQIYQEFEGDNATWWNFDPRVEWLIDFLKSHRSEKVLVICAKAETALQLEQALREREGIR  520 (955)
T ss_pred             ---------HHHHHHHHHCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCC
T ss_conf             ---------32467875173566654565565542138899999999985779858999683899999999998755995


Q ss_pred             --CCCCCCCHHHHHHHHHHHCCCC--CCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCC
Q ss_conf             --0026533445899876424588--558998442211162200178599990899898686445666620220203787
Q gi|255764515|r  340 --AFPQGRTLDKDPCTIQEWNEGK--IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK  415 (458)
Q Consensus       340 --~~~~g~~~~~r~~~i~~f~~~~--~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~  415 (458)
                        .|++|.+..+|.+....|.+++  .+||||| .+||||+|||. |+++|+||+||||..++|||||+     ||+||+
T Consensus       521 ~avfh~gms~~ERdraaa~Fa~~e~gaqVLI~T-EagsEG~NLQF-~~~LVnyDLPWNP~rLEQRIGRl-----DRiGQ~  593 (955)
T PRK04914        521 AAVFHEGMSIIERDRAAAYFADEEDGAQVLLCS-EIGSEGRNFQF-ASHLVLFDLPFNPDLLEQRIGRL-----DRIGQK  593 (955)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEE-CCCCCCCCHHH-HHHHEECCCCCCHHHHHHHHHHH-----HHCCCC
T ss_conf             699709999899999999861767785199972-52124503777-43523525898765889985206-----542786


Q ss_pred             CCEEEEEEEECCCHHHHHHHHHHHHHHHH
Q ss_conf             75289999858996899999999999999
Q gi|255764515|r  416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQ  444 (458)
Q Consensus       416 ~~v~v~~li~~~tide~i~~~~~~K~~~~  444 (458)
                      ++|.||.-..+||..+.++.--.+-.+.+
T Consensus       594 ~dV~Ihvpy~~~s~q~~l~~wy~~gl~af  622 (955)
T PRK04914        594 HDIQIHVPYLEGTAQERLFRWYHEGLNAF  622 (955)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             75079862028988999999999888897


No 16 
>KOG1016 consensus
Probab=100.00  E-value=0  Score=351.09  Aligned_cols=434  Identities=21%  Similarity=0.303  Sum_probs=306.1

Q ss_pred             CCHHHHHHHHHHHHC-------------CCEEEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             747899999999967-------------98099958899868999999999997-5999499991604656999999998
Q gi|255764515|r    3 LAPHQTKIVDWILDH-------------KRCAIWASMGSGKTVSVLTALSYIHL-WGEKSVLVIAPLRVAQSVWTSEVQR   68 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~-------------~~~ll~~~~G~GKT~~al~~~~~l~~-~~~~~~LIv~P~~l~~~~W~~Ei~k   68 (458)
                      |+|||.-++.||.+|             .+|+||+.||+|||++.|.++..+.. ...+.+|+|+|-+.+.| |..||.+
T Consensus       255 ~kPHQiGGiRFlYDN~iESl~rykkSsGFGCILAHSMGLGKTlQVisF~diflRhT~AKtVL~ivPiNTlQN-WlsEfnm  333 (1387)
T KOG1016         255 LKPHQIGGIRFLYDNTIESLGRYKKSSGFGCILAHSMGLGKTLQVISFSDIFLRHTKAKTVLVIVPINTLQN-WLSEFNM  333 (1387)
T ss_pred             CCCCCCCCEEEEHHHHHHHHHHCCCCCCCCEEEEECCCCCCEEEEEEHHHHHHHCCCCCEEEEEEEHHHHHH-HHHHHHH
T ss_conf             581001757875031788876301467763200000256742588666677864276644899986078888-9998532


Q ss_pred             HCCCC---------CCEEEEEECCHH---HHH---HHHCCCCCEEEECCCCHHHHHHHC---------------------
Q ss_conf             55888---------815999858978---988---873077986998064202334420---------------------
Q gi|255764515|r   69 WSNFS---------HMNISVITGTVK---QRT---KVLKTPAVLYVINFENLGWLVQEL---------------------  112 (458)
Q Consensus        69 f~~~~---------~~~~~~~~g~~~---~r~---~~~~~~~~i~i~s~e~~~~~~~~~---------------------  112 (458)
                      |.+..         ..++.++.+..+   .|.   ..|-....|.++.||+++.+....                     
T Consensus       334 WiP~y~sD~~vrpR~F~vf~LnD~~KT~~~Rakvi~~Wv~~GGVlLvGYemfRLL~lk~~~~~grpkkt~kr~~~~~i~~  413 (1387)
T KOG1016         334 WIPKYFSDTGVRPRSFEVFLLNDGVKTFDQRAKVIEQWVQTGGVLLVGYEMFRLLILKTLPKKGRPKKTLKRISSGFIKD  413 (1387)
T ss_pred             HCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             06777666787653047898247304589999999987603978986189999998730233587420001467740377


Q ss_pred             ----------------CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHC
Q ss_conf             ----------------0011322044045310024654311567777665430598079965840231001013467751
Q gi|255764515|r  113 ----------------KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL  176 (458)
Q Consensus       113 ----------------~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l  176 (458)
                                      +..-..|+|||||+|++||.... .|.+.+++     ++++++.|||-|.+|++.|.|.|+.|+
T Consensus       414 d~eD~~qe~~~li~~AL~~PGPDlVICDEGHrIKN~~A~-iS~aLk~I-----rtrRRiVLTGYPLQNNLlEYwCMVDFV  487 (1387)
T KOG1016         414 DSEDQRQEAYSLIRSALLEPGPDLVICDEGHRIKNITAE-ISMALKAI-----RTRRRIVLTGYPLQNNLLEYWCMVDFV  487 (1387)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCEEEECCCCEECCCHHH-HHHHHHHH-----HHCEEEEEECCCCCCCHHHHHHHHEEC
T ss_conf             401468999999999843789976882588521332278-89999875-----431068874665531168775642001


Q ss_pred             CCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHH--HHHHHHHHHHHHHHHHHHHCCCC-CCCCCCCEEEEEEECCHHH
Q ss_conf             78887753277887773695640330000245555--45589999974245433200001-0010011000345245368
Q gi|255764515|r  177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAK--ETAQKEIEAQLSDCCLSLDIADY-QNIDKPILITKKVPLPQPV  253 (458)
Q Consensus       177 ~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~--~~~~~~l~~~l~~~~~~~~~~~~-~~l~~~~~~~~~v~l~~~~  253 (458)
                      .|. .||.. .+|...+-+....+....+.-...+  ......+...+..++.++.-.-. .-+|.....+..|.++..|
T Consensus       488 RP~-yLGTR-~eF~nmFErPI~NGQCvDStPdDvklmryRtHVLhsLl~GFVQRR~HtvLk~~LP~k~EyViLvr~s~iQ  565 (1387)
T KOG1016         488 RPK-YLGTR-KEFINMFERPIKNGQCVDSTPDDVKLMRYRTHVLHSLLKGFVQRRTHTVLKKILPEKKEYVILVRKSQIQ  565 (1387)
T ss_pred             CCC-CCCHH-HHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHCCCCCCEEEEEEHHHHH
T ss_conf             533-23308-9998886456547845568806889999999999999999988502255766455531148888688899


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCC---------------------------------------
Q ss_conf             99888999999851033452022347888875420354100---------------------------------------
Q gi|255764515|r  254 MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY---------------------------------------  294 (458)
Q Consensus       254 ~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~---------------------------------------  294 (458)
                      ++.|+.+..+...++.......+|.+..-.-++.|.+||-.                                       
T Consensus       566 R~LY~~Fm~d~~r~~~~~~~~~~NPLkAF~vCcKIWNHPDVLY~~l~k~~~a~e~dl~vee~~~ag~~~~~~P~~~~~~~  645 (1387)
T KOG1016         566 RQLYRNFMLDAKREIAANNDAVFNPLKAFSVCCKIWNHPDVLYRLLEKKKRAEEDDLRVEEMKFAGLQQQQSPFNSIPSN  645 (1387)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             99999999999876401466344728999999875078189999998764200321127887542001237988788899


Q ss_pred             ---------------------------CCCCCC------------------CHHCCCCCCCCHHHHHHCC--CCCEEEEH
Q ss_conf             ---------------------------022343------------------0001343333256654124--88403422
Q gi|255764515|r  295 ---------------------------YDEEKH------------------WKEVHDEKIKALEVIIEKA--NAAPIIVA  327 (458)
Q Consensus       295 ---------------------------~~~~~~------------------~~~~~~~k~~~l~~il~~~--~~~kviif  327 (458)
                                                 ++++..                  .....++|+..+.+++++.  -|.+++||
T Consensus       646 ~s~~laSs~~k~~n~t~kp~~s~~~p~f~ee~~e~~~y~~w~~el~~nYq~gvLen~pk~V~~~~~~des~~~g~kil~f  725 (1387)
T KOG1016         646 PSTPLASSTSKSANKTKKPRGSKKAPKFDEEDEEVEKYSDWTFELFENYQEGVLENGPKIVISLEILDESTQIGEKILIF  725 (1387)
T ss_pred             CCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCCCCEEEEE
T ss_conf             88755550445533567866676799722246651112157888876410111268986699876602201347458884


Q ss_pred             HHHHHHHHHHHHCCC---------------------------CCCC-HHHHHHHHHHHCCCC-C-CEEEEEHHHCCCCCC
Q ss_conf             236788866410002---------------------------6533-445899876424588-5-589984422111622
Q gi|255764515|r  328 YHFNSDLARLQKAFP---------------------------QGRT-LDKDPCTIQEWNEGK-I-PLLFAHPASCGHGLN  377 (458)
Q Consensus       328 ~~~~~~~~~i~~~~~---------------------------~g~~-~~~r~~~i~~f~~~~-~-~vli~s~~~~~~Gln  377 (458)
                      ++....++.|.+.++                           +|++ ...|.+.|++||+.. + ..+++|+++|+.|+|
T Consensus       726 Sq~l~~Ld~ieeil~krq~pc~~gdnG~~aqkW~~n~sy~rldG~t~a~~rekLinqfN~e~~lsWlfllstrag~lGin  805 (1387)
T KOG1016         726 SQNLTALDMIEEILKKRQIPCKDGDNGCPAQKWEKNRSYLRLDGTTSAADREKLINQFNSEPGLSWLFLLSTRAGSLGIN  805 (1387)
T ss_pred             ECCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCEECCCCCCCCCHHHHHHHHCCCCCCCEEEEEEHHCCCCCCCE
T ss_conf             02014889999997433166899988884154443023330468766524999998516887852443331025643202


Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00178599990899898686445666620220203787752899998589968999999999999999998554
Q gi|255764515|r  378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNAL  451 (458)
Q Consensus       378 L~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~~  451 (458)
                      |-.| +.+|.+|..|||....||+.|+     +|+||+++|+||+||+.+|+|..||+++..|..+.+.|+|..
T Consensus       806 LIsa-nr~~ifda~wnpchdaqavcRv-----yrYGQ~KpcfvYRlVmD~~lEkkIydRQIsKqGmsdRvVDd~  873 (1387)
T KOG1016         806 LISA-NRCIIFDACWNPCHDAQAVCRV-----YRYGQQKPCFVYRLVMDNSLEKKIYDRQISKQGMSDRVVDDA  873 (1387)
T ss_pred             EECC-CEEEEEEEECCCCCCCHHHHHH-----HHHCCCCCEEEEEEHHHHHHHHHHHHHHHHHCCCHHHHHCCC
T ss_conf             3216-6079997305740132012556-----641574761687530222567878888876624303311013


No 17 
>KOG1001 consensus
Probab=100.00  E-value=0  Score=340.25  Aligned_cols=403  Identities=17%  Similarity=0.219  Sum_probs=277.4

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHC--------CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHH
Q ss_conf             980999588998689999999999975--------999499991604656999999998558888159998589789888
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLW--------GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTK   89 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~--------~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~   89 (458)
                      .+|+++|+||+|||+++++++..-...        ..+..|||||.+++. ||..|+++......+.+.+++|  +....
T Consensus       153 ~ggIladd~glgkt~~ti~l~l~~~~~~~~~~~~~~~kttLivcp~s~~~-qW~~elek~~~~~~l~v~v~~g--r~kd~  229 (674)
T KOG1001         153 RGGILADDMGLGKTVKTIALILKQKLKSKEEDRQKEFKTTLIVCPTSLLT-QWKTELEKVTEEDKLSIYVYHG--RTKDK  229 (674)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHCCCCCCCHHHCCCCCCEEEECCHHHHH-HHHHHHHCCCCCCCEEEEEECC--CCCCC
T ss_conf             45067651014158999999996436771023302467436966658888-8888873358866469999616--42433


Q ss_pred             HHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCH
Q ss_conf             73077986998064202334420001132204404531002465431156777766543059807996584023100101
Q gi|255764515|r   90 VLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDL  169 (458)
Q Consensus        90 ~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el  169 (458)
                      .-...++++++||..+..   ..+....|-.||+||||+++|..+    +.++++.  ...+.++|.|||||++|+..|+
T Consensus       230 ~el~~~dvVltTy~il~~---~~l~~i~w~Riildea~~ikn~~t----q~~~a~~--~L~a~~RWcLtgtPiqn~~~~l  300 (674)
T KOG1001         230 SELNSYDVVLTTYDILKN---SPLVKIKWLRIVLDEAHTIKNKDT----QIFKAVC--QLDAKYRWCLTGTPIQNNLDEL  300 (674)
T ss_pred             CHHCCCCEEEEEHHHHHC---CCCCCEEEEEEEECCCCCCCCCCH----HHHHHHE--EECCCEEEEECCCHHHHHHHHH
T ss_conf             134177669933788515---350012578887012002678526----7665513--5314222540478256649999


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------CCCCCCCCCCEE
Q ss_conf             34677517888775327788777369564033000024555545589999974245433200------001001001100
Q gi|255764515|r  170 WGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI------ADYQNIDKPILI  243 (458)
Q Consensus       170 ~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~------~~~~~l~~~~~~  243 (458)
                      |+++.|+.-...  ..+..|............      +   ......+...+..++.++.+      .+...+|+....
T Consensus       301 ysl~~fl~~~p~--~~~~~~~~~i~~p~~~~~------~---~~~~k~l~~~L~~v~lrrtK~~~~~gk~i~~lppk~v~  369 (674)
T KOG1001         301 YSLFKFLEIHPY--CDQNYFKLLIQDPDERNK------Y---KEGVKTLQGILKKVMLRRTKEMEVDGKPILELPPKTVF  369 (674)
T ss_pred             HHHHHHHHCCCC--HHHHHHHHHHCCHHHHHH------H---HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEE
T ss_conf             999987603873--036789887137153124------8---88999999999998741563232357533346862268


Q ss_pred             EEEEECCHHHHHHHHHHHHHHHHHCCC------CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHH--------------
Q ss_conf             034524536899888999999851033------452022347888875420354100022343000--------------
Q gi|255764515|r  244 TKKVPLPQPVMKQYHKFQRELYCDLQG------ENIEAFNSASKTVKCLQLANGAVYYDEEKHWKE--------------  303 (458)
Q Consensus       244 ~~~v~l~~~~~~~y~~~~~~~~~~~~~------~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~--------------  303 (458)
                      ...+.........|.++.......+..      ......+.+..+.+++|.|+|+.+.-.......              
T Consensus       370 ~~~~~~~~~e~~~y~~l~~~~~~~~~~~~~~~~~~~~Y~~~l~~lLrlrq~c~h~~lv~~~~~~~~~~~~~~~~~~~~i~  449 (674)
T KOG1001         370 VTEVDLSKSERSAYKALKANSRNQFSNYANEGTVSSTYAFFLKNLLRLRQACDHSLLVMYEMDSLGDSGSAAALIIRLIV  449 (674)
T ss_pred             EEECCCCHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHH
T ss_conf             64123307678899987641456787776524244217889999999998635546541133133221235257899999


Q ss_pred             -C--------------------------------------------------------------------CCCCCCCHHH
Q ss_conf             -1--------------------------------------------------------------------3433332566
Q gi|255764515|r  304 -V--------------------------------------------------------------------HDEKIKALEV  314 (458)
Q Consensus       304 -~--------------------------------------------------------------------~~~k~~~l~~  314 (458)
                       .                                                                    .+.|+..+..
T Consensus       450 ~l~~~~~c~ic~~~~~~~it~c~h~~c~~c~~~~i~~~~~~~~~~cr~~l~~~~l~s~~~~~~~~~~~~~~s~ki~~~~~  529 (674)
T KOG1001         450 DLSVSHWCHICCDLDSFFITRCGHDFCVECLKKSIQQSENAPCPLCRNVLKEKKLLSANPLPSIINDLLPESSKIYAFLK  529 (674)
T ss_pred             HHHHCCCCCCCCCCCCCEEECCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHCCCHHHHHHHHHH
T ss_conf             97422654443454662443366448899987441655578783788888899886046653023321424566699999


Q ss_pred             HHH--CCCC-CEEEEHHHHHHHHHHHHHC----------CCCCCCHHHHHHHHHHHC-CCCCCEEEEEHHHCCCCCCCCC
Q ss_conf             541--2488-4034222367888664100----------026533445899876424-5885589984422111622001
Q gi|255764515|r  315 IIE--KANA-APIIVAYHFNSDLARLQKA----------FPQGRTLDKDPCTIQEWN-EGKIPLLFAHPASCGHGLNLQY  380 (458)
Q Consensus       315 il~--~~~~-~kviif~~~~~~~~~i~~~----------~~~g~~~~~r~~~i~~f~-~~~~~vli~s~~~~~~GlnL~~  380 (458)
                      ++.  +... .++++|++|...++.+.-.          +.+..+...|...+..|+ ++...|+++|.+||+.||||+.
T Consensus       530 ~l~~~~~s~~~kiiifsq~~~~l~l~~~~l~~~~~~~~~~dg~~~~~~r~~s~~~f~~~~~~~vll~SlKag~~glNlt~  609 (674)
T KOG1001         530 ILQAKEMSEQPKIVIFSQLIWGLALVCLRLFFKGFVFLRYDGEMLMKIRTKSFTDFPCDPLVTALLMSLKAGKVGLNLTA  609 (674)
T ss_pred             HHHHCCCCCCCCEEEEHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCHHH
T ss_conf             98653578898625533689988885223443144401011256788998765315667635699999885001202246


Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             785999908998986864456666202202037877528999985899689999999999999999985
Q gi|255764515|r  381 GGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN  449 (458)
Q Consensus       381 a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~  449 (458)
                      |+ +++.+|++|||+.++||++|+     ||+||+++|.|++|+..+|+||+|++++.+|+.+....++
T Consensus       610 A~-~v~~~dpwwnp~~eeQaidR~-----hrigq~k~V~V~r~~ikdtvEer~l~iq~kK~~~~~~a~~  672 (674)
T KOG1001         610 AS-HVLLMDPWWNPAVEEQAIDRA-----HRIGQTKPVKVSRFIIKDTVEERILKIQEKKREYNASAFG  672 (674)
T ss_pred             HH-HHHHCCHHCCCHHHHHHHHHH-----HHHCCCEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             67-888602221828899987789-----8856730589999751334699999988888877886416


No 18 
>pfam00176 SNF2_N SNF2 family N-terminal domain. This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1).
Probab=100.00  E-value=0  Score=324.86  Aligned_cols=276  Identities=22%  Similarity=0.312  Sum_probs=209.0

Q ss_pred             HHHHHHHHHHH----CCCEEEEECCCCCHHHHHHHHHHHHHHCC--CCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             89999999996----79809995889986899999999999759--9949999160465699999999855888815999
Q gi|255764515|r    6 HQTKIVDWILD----HKRCAIWASMGSGKTVSVLTALSYIHLWG--EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         6 ~Q~~~v~~~~~----~~~~ll~~~~G~GKT~~al~~~~~l~~~~--~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      ||.+||+||..    +.+|+||||||+|||+|+|+++..+...+  .+++|||||++++. +|.+|+++|++  ...+.+
T Consensus         1 yQ~~gv~wl~~~~~~~~ggiLaDeMGLGKTiq~ia~l~~~~~~~~~~~~~LIV~P~sl~~-~W~~Ei~~~~~--~~~~~~   77 (295)
T pfam00176         1 YQLEGVNWLISLYNNGLGGILADEMGLGKTLQTISLLAYLKELKPLAGPHLVVCPLSTLD-NWLNEFEKWAP--DLNIVV   77 (295)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECHHHHH-HHHHHHHHHCC--CCCEEE
T ss_conf             978899999998727999897227875799999999999998388999889997578887-67889998679--970799


Q ss_pred             EECCHHHHHHHH-----CCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEE
Q ss_conf             858978988873-----077986998064202334420001132204404531002465431156777766543059807
Q gi|255764515|r   80 ITGTVKQRTKVL-----KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERF  154 (458)
Q Consensus        80 ~~g~~~~r~~~~-----~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~  154 (458)
                      +.|+...+....     ...++++|+||+.+......+ ...+|++||+||||.+||+    .|++++++..+  +++++
T Consensus        78 ~~~~~~~r~~~~~~~~~~~~~~ivitsY~~~~~~~~~l-~~~~w~~vI~DEaH~iKN~----~s~~~~a~~~l--~~~~r  150 (295)
T pfam00176        78 YYGDGDSRSELLRNVLRTGKFDVLITSYEYIRRDKDEL-HKANWRYVILDEGHRIKNA----KSKLSLALKSL--KTNNR  150 (295)
T ss_pred             EEECHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHH-HCCCCCEEEEECCCCCCCH----HHHHHHHHHHC--CCCCE
T ss_conf             98470768999886774168859993099999759998-4087658998762012587----88999999952--35818


Q ss_pred             EEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHH--HHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9965840231001013467751788877532778877736956403300002--45555455899999742454332000
Q gi|255764515|r  155 IELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAV--RYTAKETAQKEIEAQLSDCCLSLDIA  232 (458)
Q Consensus       155 l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~--~~~~~~~~~~~l~~~l~~~~~~~~~~  232 (458)
                      |+|||||++|++.|+|++++||+|+. ++ .+..|...|......+......  ...........+...+.++++++.+.
T Consensus       151 ~~LTGTPiqN~l~el~~ll~fl~p~~-~~-~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~~~~~~lRR~K~  228 (295)
T pfam00176       151 LLLTGTPIQNNLAELWSLLNFLRPGI-FG-SFKEFDKWFVNPILNGGCSDATEKLEEAGLKLINRLHKILKPFLLRRLKK  228 (295)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHCCCC-CC-CHHHHHHHHCCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99868745588899999999958765-69-99999999723554277643205778889999999999988899861198


Q ss_pred             CCC-CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHC--CC---CCCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             010-010011000345245368998889999998510--33---45202234788887542035410
Q gi|255764515|r  233 DYQ-NIDKPILITKKVPLPQPVMKQYHKFQRELYCDL--QG---ENIEAFNSASKTVKCLQLANGAV  293 (458)
Q Consensus       233 ~~~-~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~--~~---~~~~~~~~~~~~~~l~q~~~~~~  293 (458)
                      +.. ++|+.....+.++|++.|.+.|+++........  ..   ........+..+.+|+|+|+||.
T Consensus       229 dv~~~LP~k~e~~i~v~ls~~q~~~Y~~~l~~~~~~~~~~~~~~~~~~~~~il~~l~rLRq~C~HP~  295 (295)
T pfam00176       229 DVEKSLPPKTEYVLFCNLSKLQKELYKKFLTSKDVKFINDGNGVKYGGKSRLLNLILELRKICNHPY  295 (295)
T ss_pred             HHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             7762489977999982899999999999998878999863037532439999999999999977999


No 19 
>PRK13766 Hef nuclease; Provisional
Probab=100.00  E-value=4.8e-42  Score=272.95  Aligned_cols=426  Identities=15%  Similarity=0.122  Sum_probs=240.4

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             98747899999999967980999588998689999999999975999499991604656999999998558888159998
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      |+.|.||.+.++..+. ++.+++.++|+|||+.|+.++........+++|++||+-.+..|+.+.|.+++..|..++..+
T Consensus        14 ie~R~YQ~el~~~Al~-~NtiVvLPTG~GKT~IA~lvi~~~l~~~~gKilFLaPT~pLV~Qq~~~~~~~l~i~~~~i~~l   92 (764)
T PRK13766         14 IEARLYQQLLAAKALK-GNTLVVLPTGLGKTAIALLVIAERLQKYGGKVLILAPTKPLVEQHAEFFRKFLNIDPEKIVVL   92 (764)
T ss_pred             CCCCHHHHHHHHHHHH-CCEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             7653879999999985-898999599866899999999999974898899985888899999999999709995528999


Q ss_pred             ECC--HHHHHHHHCCCCCEEEECCCCHHHHHHH-CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             589--7898887307798699806420233442-0001132204404531002465431156777766543059807996
Q gi|255764515|r   81 TGT--VKQRTKVLKTPAVLYVINFENLGWLVQE-LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIEL  157 (458)
Q Consensus        81 ~g~--~~~r~~~~~~~~~i~i~s~e~~~~~~~~-~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~L  157 (458)
                      +|.  +..|...|. ..+|+++|++.+.++... ......+.++|+||||+...  ...+....+..... .+.+++++|
T Consensus        93 tG~~~~~~r~~~w~-~~~Viv~TPQvl~ndL~~g~i~l~dv~lLVfDEaHha~G--nh~Y~~I~~~y~~~-~~~PrILGL  168 (764)
T PRK13766         93 TGEISPEKRAALWE-KAKVIVATPQVIENDLLAGRISLEDVSLLIFDEAHRAVG--NYAYVFIAERYHED-AKNPLVLGL  168 (764)
T ss_pred             ECCCCHHHHHHHHC-CCCEEEECCHHHHHHHHHCCCCHHHCCEEEEECCCCCCC--CCCHHHHHHHHHHC-CCCCEEEEE
T ss_conf             88878276899860-799999990899999982986788822899974666667--76289999999853-778558850


Q ss_pred             CCCCHHHHCCCHHHHHHHCCCCCC-CCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             584023100101346775178887-7532778877736956403300002455554558999997424543320000100
Q gi|255764515|r  158 TGTPSPNGLIDLWGQIWFLDKGKR-LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN  236 (458)
Q Consensus       158 TgTPi~n~~~el~~ll~~l~~~~~-l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~  236 (458)
                      ||||..+ ...+-..+.-|+-... .......-...|.............. .........+...+.+........... 
T Consensus       169 TASPGs~-~e~I~ev~~nL~i~~ie~rte~d~dv~~yv~~~~ie~i~V~l~-~~~~~i~~~l~~~l~~~l~~L~~~~~~-  245 (764)
T PRK13766        169 TASPGSD-EEKIKEVCENLGIEHVEVKTEDDPDVRPYVHKVKVEWIRVELP-EELKEIRDLLNEALKDRLKKLKELGVI-  245 (764)
T ss_pred             CCCCCCC-HHHHHHHHHHCCCCEEEEECCCCHHHHHHCCCCCEEEEEECCC-HHHHHHHHHHHHHHHHHHHHHHHCCCE-
T ss_conf             3688764-4899999986598728961444434454335673279980797-899999999999999999999966970-


Q ss_pred             CCCCCEEEEEEECCHHHHH----------------HHH------HHHH--HHHHHCCCCCCHHH-HHHHHHH--------
Q ss_conf             1001100034524536899----------------888------9999--99851033452022-3478888--------
Q gi|255764515|r  237 IDKPILITKKVPLPQPVMK----------------QYH------KFQR--ELYCDLQGENIEAF-NSASKTV--------  283 (458)
Q Consensus       237 l~~~~~~~~~v~l~~~~~~----------------~y~------~~~~--~~~~~~~~~~~~~~-~~~~~~~--------  283 (458)
                        ..    ....++.....                .|+      +..+  .+..-+.......+ +.+..+.        
T Consensus       246 --~~----~~~~~sk~~l~~~~~~~~~~i~~~~~~~~~~~~~~a~~~kl~~a~ell~tqg~~~~~~yl~~l~~~~~~~~~  319 (764)
T PRK13766        246 --VS----ISPDVSKKELLGLQKRIQQEIARGDPEGYEAISIHAEAMKLRHAVELLETQGVEALRRYLERLREEARSSGS  319 (764)
T ss_pred             --EC----CCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             --04----555468999999999999988646879999999999999999999999985189999999999973013332


Q ss_pred             -HHHHCCCCCCCCC--CCCCCHHCCCCCCCCHHHHHHC----CCCCEEEEHHHHHHHHHHHHHCC----------C----
Q ss_conf             -7542035410002--2343000134333325665412----48840342223678886641000----------2----
Q gi|255764515|r  284 -KCLQLANGAVYYD--EEKHWKEVHDEKIKALEVIIEK----ANAAPIIVAYHFNSDLARLQKAF----------P----  342 (458)
Q Consensus       284 -~l~q~~~~~~~~~--~~~~~~~~~~~k~~~l~~il~~----~~~~kviif~~~~~~~~~i~~~~----------~----  342 (458)
                       ...++..++....  ..........+|++.|.+++.+    .++.++|||+++..+...|...+          .    
T Consensus       320 k~~k~l~~d~~~~~~~~~~~~~~~~hPKl~kL~eiL~~~~~~~~~sRvIIFv~~R~Ta~~L~~~L~~~~ik~~~fVGq~s  399 (764)
T PRK13766        320 KASKRLVEDPRFKKAVRLLKELDIEHPKLEKLLEIVKEQLGKKPDSRIIVFTQYRDTAEKIVDLLNKNGIKAIRFVGQAS  399 (764)
T ss_pred             HHHHHHHHCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             67899875877899999876446789379999999999972699980899927679999999998658997228983689


Q ss_pred             ----CCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCE
Q ss_conf             ----6533445899876424588558998442211162200178599990899898686445666620220203787752
Q gi|255764515|r  343 ----QGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAV  418 (458)
Q Consensus       343 ----~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v  418 (458)
                          +|++..++.+++++|++|++++||+| .+|.||||+. +||.||+||+.-|+-+..|+.||        .|.+++-
T Consensus       400 ~~~~kGmsqkeQ~evL~~FR~Ge~NvLVAT-SV~EEGLDIP-~cdLVI~Yd~v~S~IR~IQR~GR--------TGR~r~G  469 (764)
T PRK13766        400 RDGDKGMSQKEQIETLDRFRAGEYNVLVAT-SVAEEGLDIP-SVDLVIFYEPVPSEIRSIQRKGR--------TGRQRGG  469 (764)
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCCEEEEC-CHHHCCCCCC-CCCEEEEECCCCCHHHHHHHCCC--------CCCCCCC
T ss_conf             878889898999999999857998889876-7664488887-78889993799619999997466--------5677897


Q ss_pred             EEEEEEECCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999858996899999999999999999855
Q gi|255764515|r  419 FVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA  450 (458)
Q Consensus       419 ~v~~li~~~tide~i~~~~~~K~~~~~~~~~~  450 (458)
                      .|+.|+++||.||.-+..-.+|..-+-..+..
T Consensus       470 ~v~vLi~~gt~de~~~~~~~~kek~m~~~l~~  501 (764)
T PRK13766        470 RVVVLIAKGTRDEAYYWSSRRKEKKMKEILKN  501 (764)
T ss_pred             EEEEEEECCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             49999956862677888511206899999999


No 20 
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]
Probab=100.00  E-value=1.2e-36  Score=240.14  Aligned_cols=427  Identities=16%  Similarity=0.156  Sum_probs=240.1

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHH-HHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             987478999999999679809995889986899999999-9997599949999160465699999999855888815999
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~-~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      ++-|.||...++..+.. ++|++.++|+|||++|...+. .|...+. ++|+++|+..+..|...-+.+++..|.-++..
T Consensus        14 ie~R~YQ~~i~a~al~~-NtLvvlPTGLGKT~IA~~V~~~~l~~~~~-kvlfLAPTKPLV~Qh~~~~~~v~~ip~~~i~~   91 (542)
T COG1111          14 IEPRLYQLNIAAKALFK-NTLVVLPTGLGKTFIAAMVIANRLRWFGG-KVLFLAPTKPLVLQHAEFCRKVTGIPEDEIAA   91 (542)
T ss_pred             CCHHHHHHHHHHHHHHC-CEEEEECCCCCHHHHHHHHHHHHHHHCCC-EEEEECCCCHHHHHHHHHHHHHHCCCHHHEEE
T ss_conf             25889999999998644-83899528750799999999999874588-48996589517999999999985898433231


Q ss_pred             EECC--HHHHHHHHCCCCCEEEECCCCHHHHHHH-CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             8589--7898887307798699806420233442-000113220440453100246543115677776654305980799
Q gi|255764515|r   80 ITGT--VKQRTKVLKTPAVLYVINFENLGWLVQE-LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIE  156 (458)
Q Consensus        80 ~~g~--~~~r~~~~~~~~~i~i~s~e~~~~~~~~-~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~  156 (458)
                      ++|.  +.+|...|. ...|++.|.+.+.++... ..+...+.++|+||||+-  .++..+...++...+. .+.+++++
T Consensus        92 ltGev~p~~R~~~w~-~~kVfvaTPQvveNDl~~Grid~~dv~~lifDEAHRA--vGnyAYv~Va~~y~~~-~k~~~ilg  167 (542)
T COG1111          92 LTGEVRPEEREELWA-KKKVFVATPQVVENDLKAGRIDLDDVSLLIFDEAHRA--VGNYAYVFVAKEYLRS-AKNPLILG  167 (542)
T ss_pred             ECCCCCHHHHHHHHH-HCCEEEECCHHHHHHHHCCCCCHHHCEEEEECHHHHC--CCCCHHHHHHHHHHHH-CCCCEEEE
T ss_conf             117778688999875-1778995638777687617667678058986235541--3760699999999982-56843798


Q ss_pred             ECCCCHHHHCCCHHHHHHHCCCCCCCC-CCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-------
Q ss_conf             658402310010134677517888775-327788777369564033000024555545589999974245433-------
Q gi|255764515|r  157 LTGTPSPNGLIDLWGQIWFLDKGKRLG-RVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLS-------  228 (458)
Q Consensus       157 LTgTPi~n~~~el~~ll~~l~~~~~l~-~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~-------  228 (458)
                      |||||-. ++..+-..+.-|+-....- .....=+..|........-  .+   .......+++..+.+..-.       
T Consensus       168 LTASPGs-~~ekI~eV~~nLgIe~vevrTE~d~DV~~Yv~~~kve~i--kV---~lp~e~~~ir~~l~~~l~~~Lk~L~~  241 (542)
T COG1111         168 LTASPGS-DLEKIQEVVENLGIEKVEVRTEEDPDVRPYVKKIKVEWI--KV---DLPEEIKEIRDLLRDALKPRLKPLKE  241 (542)
T ss_pred             EECCCCC-CHHHHHHHHHHCCCCEEEEECCCCCCHHHHHCCCEEEEE--EC---CCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7238999-879999999837954289845788517775140424899--63---68589999999999999999999997


Q ss_pred             ---------HHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHH---H--HHHHHCCCCCCHHH-HHHHHHHH---------
Q ss_conf             ---------200001001001100034524536899888999---9--99851033452022-34788887---------
Q gi|255764515|r  229 ---------LDIADYQNIDKPILITKKVPLPQPVMKQYHKFQ---R--ELYCDLQGENIEAF-NSASKTVK---------  284 (458)
Q Consensus       229 ---------~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~---~--~~~~~~~~~~~~~~-~~~~~~~~---------  284 (458)
                               ....+...+-........-+ +..-.+.+.-+.   +  .+..-+....+..+ +.+.++..         
T Consensus       242 ~g~~~~~~~~~~kdl~~~~~~~~~~a~~~-~~~~~~~l~~~a~~~kl~~a~elletqGi~~~~~Yl~~l~e~~~~~~sk~  320 (542)
T COG1111         242 LGVIESSSPVSKKDLLELRQIRLIMAKNE-DSDKFRLLSVLAEAIKLAHALELLETQGIRPFYQYLEKLEEEATKGGSKA  320 (542)
T ss_pred             CCCEECCCCCCHHHHHHHHHHHHHHCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHCCCCHHH
T ss_conf             69532357310768999999899863576-17888999999999888899999985086999999999998750352077


Q ss_pred             HHHCCCCCCCCC-----CCCCCHHCCCCCCCCHHHHHH----CCCCCEEEEHHHHHHHHHHHHHC-----------CC--
Q ss_conf             542035410002-----234300013433332566541----24884034222367888664100-----------02--
Q gi|255764515|r  285 CLQLANGAVYYD-----EEKHWKEVHDEKIKALEVIIE----KANAAPIIVAYHFNSDLARLQKA-----------FP--  342 (458)
Q Consensus       285 l~q~~~~~~~~~-----~~~~~~~~~~~k~~~l~~il~----~~~~~kviif~~~~~~~~~i~~~-----------~~--  342 (458)
                      ...+...+....     ..........+|++.+.+++.    ...+.++|||++|..+.+.|...           |.  
T Consensus       321 a~~l~~d~~~~~al~~~~~~~~~~v~HPKl~~l~eilke~~~k~~~~RvIVFT~yRdTae~i~~~L~~~~~~~~~rFiGQ  400 (542)
T COG1111         321 AKSLLADPYFKRALRLLIRADESGVEHPKLEKLREILKEQLEKNGDSRVIVFTEYRDTAEEIVNFLKKIGIKARVRFIGQ  400 (542)
T ss_pred             HHHHHCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEHHHHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             89875382047999999974003688961899999999997238985599996147589999999985287520688611


Q ss_pred             ------CCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCC
Q ss_conf             ------65334458998764245885589984422111622001785999908998986864456666202202037877
Q gi|255764515|r  343 ------QGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR  416 (458)
Q Consensus       343 ------~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~  416 (458)
                            .|++..++.++|++|++|+++||+++ ..|.||||+. .++.|||||+.-|+-+..|+.||-        |-++
T Consensus       401 a~r~~~~GMsQkeQ~eiI~~Fr~Ge~nVLVaT-SVgEEGLDIp-~vDlVifYEpvpSeIR~IQR~GRT--------GR~r  470 (542)
T COG1111         401 ASREGDKGMSQKEQKEIIDQFRKGEYNVLVAT-SVGEEGLDIP-EVDLVIFYEPVPSEIRSIQRKGRT--------GRKR  470 (542)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEC-CCCCCCCCCC-CCCEEEEECCCCHHHHHHHHHCCC--------CCCC
T ss_conf             45455666588899999999865785189981-2322467887-656799956885788999860744--------5577


Q ss_pred             CEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5289999858996899999999999999999855
Q gi|255764515|r  417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA  450 (458)
Q Consensus       417 ~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~  450 (458)
                      .-.||.|+++||.|+.-+..-.+|...+...+..
T Consensus       471 ~Grv~vLvt~gtrdeayy~~s~rke~~m~e~i~~  504 (542)
T COG1111         471 KGRVVVLVTEGTRDEAYYYSSRRKEQKMIESIRG  504 (542)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9749999965862789999999999999999998


No 21 
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]
Probab=100.00  E-value=6e-35  Score=229.95  Aligned_cols=349  Identities=17%  Similarity=0.199  Sum_probs=214.6

Q ss_pred             CCCCHHHHHHHHHHHH----CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             9874789999999996----798099958899868999999999997599949999160465699999999855888815
Q gi|255764515|r    1 MNLAPHQTKIVDWILD----HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN   76 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~----~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~   76 (458)
                      .+|+|||.+|++.+..    .+++++..++|+|||+.++.++..+.    .++|||||...+..||.+.+.++...+ -.
T Consensus        35 ~~lr~yQ~~al~a~~~~~~~~~~gvivlpTGaGKT~va~~~~~~~~----~~~Lvlv~~~~L~~Qw~~~~~~~~~~~-~~  109 (442)
T COG1061          35 FELRPYQEEALDALVKNRRTERRGVIVLPTGAGKTVVAAEAIAELK----RSTLVLVPTKELLDQWAEALKKFLLLN-DE  109 (442)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHC----CCEEEEECCHHHHHHHHHHHHHHCCCC-CC
T ss_conf             8885999999999996222578679996799988999999999826----988999782999999999999734886-76


Q ss_pred             EEEEECCHHHHHHHHCCCCCEEEECCCCHHHHH-HHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCE-E
Q ss_conf             999858978988873077986998064202334-42000113220440453100246543115677776654305980-7
Q gi|255764515|r   77 ISVITGTVKQRTKVLKTPAVLYVINFENLGWLV-QELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESER-F  154 (458)
Q Consensus        77 ~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~-~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~-~  154 (458)
                      ...+.|..+.-.    . ..|.+.||+++.... -.......|++||+||||++-++       .++.+.... .+.+ +
T Consensus       110 ~g~~~~~~~~~~----~-~~i~vat~qtl~~~~~l~~~~~~~~~liI~DE~Hh~~a~-------~~~~~~~~~-~~~~~~  176 (442)
T COG1061         110 IGIYGGGEKELE----P-AKVTVATVQTLARRQLLDEFLGNEFGLIIFDEVHHLPAP-------SYRRILELL-SAAYPR  176 (442)
T ss_pred             CCEECCCCCCCC----C-CCEEEEEEHHHHHHHHHHHHCCCCCCEEEEECCCCCCCH-------HHHHHHHHH-HCCCEE
T ss_conf             603368723357----7-748999838976415555403566675999752457847-------799999975-103104


Q ss_pred             EEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--
Q ss_conf             996584023100101346775178887753277887773695640330000245555455899999742454332000--
Q gi|255764515|r  155 IELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIA--  232 (458)
Q Consensus       155 l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~--  232 (458)
                      ++|||||.......+.-+...+.|                                              ........  
T Consensus       177 LGLTATp~R~D~~~~~~l~~~~g~----------------------------------------------~vy~~~~~~l  210 (442)
T COG1061         177 LGLTATPEREDGGRIGDLFDLIGP----------------------------------------------IVYEVSLKEL  210 (442)
T ss_pred             EEEECCCCCCCCCCHHHHHHHCCC----------------------------------------------EEEECCHHHH
T ss_conf             677148724487752487740575----------------------------------------------5673358998


Q ss_pred             -CCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCC
Q ss_conf             -0100100110003452453689988899999985103345202234788887542035410002234300013433332
Q gi|255764515|r  233 -DYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKA  311 (458)
Q Consensus       233 -~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~  311 (458)
                       +..-+.+.......+.++......|.+........+.....     .....             ...........++..
T Consensus       211 i~~g~Lap~~~~~i~~~~t~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~-------------~~~~~~~~~~~~~~~  272 (442)
T COG1061         211 IDEGYLAPYKYVEIKVTLTEDEEREYAKESARFRELLRARGT-----LRAEN-------------EARRIAIASERKIAA  272 (442)
T ss_pred             HHCCCCCCEEEEEEEECCCHHHHHHCCHHHHHHHHHHHHHCC-----HHHHH-------------HHHHHHHHHHHHHHH
T ss_conf             337875774999986236628777403155555555543100-----13456-------------777776642899999


Q ss_pred             HHHHHHCC-CCCEEEEHHHHHHHHHHHHHCC---------CCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCC
Q ss_conf             56654124-8840342223678886641000---------2653344589987642458855899844221116220017
Q gi|255764515|r  312 LEVIIEKA-NAAPIIVAYHFNSDLARLQKAF---------PQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYG  381 (458)
Q Consensus       312 l~~il~~~-~~~kviif~~~~~~~~~i~~~~---------~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a  381 (458)
                      +..++... .+.+++||+..+.....+...+         .+.++..+|..+++.|..++.++++.+ +.+.||+|+..+
T Consensus       273 ~~~~~~~~~~~~~~lif~~~~~~a~~i~~~~~~~~~~~~it~~t~~~eR~~il~~fr~g~~~~lv~~-~vl~EGvDiP~~  351 (442)
T COG1061         273 VRGLLLKHARGDKTLIFASDVEHAYEIAKLFLAPGIVEAITGETPKEEREAILERFRTGGIKVLVTV-KVLDEGVDIPDA  351 (442)
T ss_pred             HHHHHHHHCCCCCEEEEECCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEE-EEECCCCCCCCC
T ss_conf             9999875326886699975779999999986267742466578998899999999870895299996-141266578887


Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCC--EEEEEEEECCCHHHHHHHHH
Q ss_conf             859999089989868644566662022020378775--28999985899689999999
Q gi|255764515|r  382 GNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA--VFVYYLIAQNTIDELVLQRL  437 (458)
Q Consensus       382 ~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~--v~v~~li~~~tide~i~~~~  437 (458)
                       +++|...++=|+..+.|+.||+.|.    ...+..  +..|-++..++.+..+....
T Consensus       352 -~~~i~~~~t~S~~~~~Q~lGR~LR~----~~~k~~~~~~~~~~~~~~~~~~~~~~~~  404 (442)
T COG1061         352 -DVLIILRPTGSRRLFIQRLGRGLRP----AEGKEDTLALDYSLVPDDLGEEDIARRR  404 (442)
T ss_pred             -CEEEEECCCCCHHHHHHHHHHHHCC----CCCCCCEEEEEEECCCCCCCCCCHHHHH
T ss_conf             -5799977998799999996166347----8899965999996456764433266664


No 22 
>KOG0354 consensus
Probab=100.00  E-value=1.1e-32  Score=216.15  Aligned_cols=418  Identities=15%  Similarity=0.124  Sum_probs=221.3

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHH-HHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             987478999999999679809995889986899999999-9997599949999160465699999999855888815999
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~-~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      ++||+||.+.+...+ ..+.+++.++|+|||+.|..++. ++.-....+++..||+..+.+|-.+++..+.. | ..+..
T Consensus        61 ~~lR~YQ~eivq~AL-gkNtii~lPTG~GKTfIAa~Vm~nh~rw~p~~KiVF~aP~~pLv~QQ~a~~~~~~~-~-~~~T~  137 (746)
T KOG0354          61 LELRNYQEELVQPAL-GKNTIIALPTGSGKTFIAAVIMKNHFEWRPKGKVVFLAPTRPLVNQQIACFSIYLI-P-YSVTG  137 (746)
T ss_pred             CCCCHHHHHHHHHHH-CCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCCC-C-CCCEE
T ss_conf             656078999867862-68769995359986104799999997237764389960771178888988762067-6-01045


Q ss_pred             EECC---HHHHHHHHCCCCCEEEECCCCHHHHHHH-CCCC-CCCCEEECCCCCCC-CCCCCCCHHHHHHHHHHHHHCCCE
Q ss_conf             8589---7898887307798699806420233442-0001-13220440453100-246543115677776654305980
Q gi|255764515|r   80 ITGT---VKQRTKVLKTPAVLYVINFENLGWLVQE-LKGT-WPFATIVVDESTKL-KSFRLRQGSKTARALAKPAWESER  153 (458)
Q Consensus        80 ~~g~---~~~r~~~~~~~~~i~i~s~e~~~~~~~~-~~~~-~~~~~iIiDEaH~l-kn~~~~~~s~~~~~l~~~~~~~~~  153 (458)
                      ..|+   ...+..++ ...++++.|.+.+.+..+. .... -.|.++|+||||+- ||.   .++...+..........+
T Consensus       138 ~l~~~~~~~~r~~i~-~s~~vff~TpQil~ndL~~~~~~~ls~fs~iv~DE~Hra~kn~---~Y~~Vmr~~l~~k~~~~q  213 (746)
T KOG0354         138 QLGDTVPRSNRGEIV-ASKRVFFRTPQILENDLKSGLHDELSDFSLIVFDECHRTSKNH---PYNNIMREYLDLKNQGNQ  213 (746)
T ss_pred             ECCCCCCCCCHHHHH-CCCCEEEECHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCC---CHHHHHHHHHHHHHCCCC
T ss_conf             505756887624531-0263589672763433254334545517999972224455566---179999999986514661


Q ss_pred             EEEECCCCHHHHCCCH----HHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7996584023100101----346775178887753277887773695640330000245555455899999742454332
Q gi|255764515|r  154 FIELTGTPSPNGLIDL----WGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL  229 (458)
Q Consensus       154 ~l~LTgTPi~n~~~el----~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~  229 (458)
                      +++|||||- ++..+.    .+|+.-|+-.     ...+....|....+.......+... .......+...+.+.+...
T Consensus       214 ILgLTASpG-~~~~~v~~~I~~L~asldvr-----~~ssi~~~y~~lr~~~~i~v~~~~~-~~~~~~~f~~~i~p~l~~l  286 (746)
T KOG0354         214 ILGLTASPG-SKLEQVQNVIDNLCASLDVR-----TESSIKSNYEELREHVQIPVDLSLC-ERDIEDPFGMIIEPLLQQL  286 (746)
T ss_pred             EEEEECCCC-CCHHHHHHHHHHHHEECCCC-----HHHHHHHHHHHHHCCCCCCCCHHHH-HHHHHHHHHHHHHHHHHHH
T ss_conf             799855888-45899999998520332555-----0445654189872467524758876-4113436999999999999


Q ss_pred             HCCCCCCCCCCC-EEEE---------EEECCHHHH---HHHHHHH--HHHH-HH-CC-------CCCCHHHHHHHH----
Q ss_conf             000010010011-0003---------452453689---9888999--9998-51-03-------345202234788----
Q gi|255764515|r  230 DIADYQNIDKPI-LITK---------KVPLPQPVM---KQYHKFQ--RELY-CD-LQ-------GENIEAFNSASK----  281 (458)
Q Consensus       230 ~~~~~~~l~~~~-~~~~---------~v~l~~~~~---~~y~~~~--~~~~-~~-~~-------~~~~~~~~~~~~----  281 (458)
                      ....+..+-... ....         .-.....+.   .++.-..  ..+. .. +.       .++......+.+    
T Consensus       287 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~f~~~~~~~~~~~ll~~~gir~~~~l~~~~~f~~e~~~~k~~~~  366 (746)
T KOG0354         287 QEEGLIEISDKSTSYEQWVVQAEKAAAPNGPENQRNCFYALHLRKYNLALLISDGIRFVDALDYLEDFYEEVALKKYLKL  366 (746)
T ss_pred             HHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHH
T ss_conf             86385410243334444043300222368874320367899999878888763234037777655543000004678898


Q ss_pred             ---------HHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHHH----CCCCCEEEEHHHHHHHHHHHHHCCC------
Q ss_conf             ---------887542035410002234300013433332566541----2488403422236788866410002------
Q gi|255764515|r  282 ---------TVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE----KANAAPIIVAYHFNSDLARLQKAFP------  342 (458)
Q Consensus       282 ---------~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il~----~~~~~kviif~~~~~~~~~i~~~~~------  342 (458)
                               ..-+.+...+      ........++|+..+.+++.    ......+|||+.+...+..|...+.      
T Consensus       367 ~~e~~~~~~~~~~m~~~~~------l~~~~~~~npkle~l~~~l~e~f~~~~dsR~IIFve~R~sa~~l~~~l~~~~~~~  440 (746)
T KOG0354         367 ELEARLIRNFTENMNELEH------LSLDPPKENPKLEKLVEILVEQFEQNPDSRTIIFVETRESALALKKWLLQLHELG  440 (746)
T ss_pred             HHCCHHHHHHHHHHHHHHH------HHCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEHHHHHHHHHHHHHHHHHCC
T ss_conf             7422106778898876443------2027876684699999999998605988507999732889999999997540135


Q ss_pred             ---------------CCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCC
Q ss_conf             ---------------65334458998764245885589984422111622001785999908998986864456666202
Q gi|255764515|r  343 ---------------QGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVT  407 (458)
Q Consensus       343 ---------------~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~  407 (458)
                                     .|++..++.+.++.|++|+.+|||++ ..|.||||.. .|+.||-||..-||-.+.|+.||.   
T Consensus       441 ir~~~fiGq~~s~~~~gmtqk~Q~evl~~Fr~G~~NvLVAT-SV~EEGLDI~-ec~lVIcYd~~snpIrmIQrrGRg---  515 (746)
T KOG0354         441 IKAEIFIGQGKSTQSTGMTQKEQKEVLDKFRDGEINVLVAT-SVAEEGLDIG-ECNLVICYDYSSNPIRMVQRRGRG---  515 (746)
T ss_pred             CCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEE-CCHHCCCCCC-CCCEEEEECCCCCHHHHHHHHCCC---
T ss_conf             44021560354454444578999999999857980279981-0100467742-112899965776688999986310---


Q ss_pred             CCHHCCCCCCEEEEEEEECCCHHHHHHH-HHHHHHHHHHHHHHHH
Q ss_conf             2020378775289999858996899999-9999999999998554
Q gi|255764515|r  408 RQRQAGFKRAVFVYYLIAQNTIDELVLQ-RLRTKSTIQDLLLNAL  451 (458)
Q Consensus       408 r~hR~Gq~~~v~v~~li~~~tide~i~~-~~~~K~~~~~~~~~~~  451 (458)
                      |      ++.=.++.+.+  +.++.-++ ....|..+++..+..+
T Consensus       516 R------a~ns~~vll~t--~~~~~~~E~~~~~~e~lm~~~i~~~  552 (746)
T KOG0354         516 R------ARNSKCVLLTT--GSEVIEFERNNLAKEKLMNQTISKI  552 (746)
T ss_pred             C------CCCCEEEEEEC--CHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             1------01876999972--5168899888876999999999888


No 23 
>KOG0298 consensus
Probab=100.00  E-value=1.7e-33  Score=221.10  Aligned_cols=151  Identities=20%  Similarity=0.177  Sum_probs=109.2

Q ss_pred             CCEEEEECCCCCHHHHHHHHHH------------HHHHCC-----CCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             9809995889986899999999------------999759-----99499991604656999999998558888159998
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALS------------YIHLWG-----EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~------------~l~~~~-----~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      .++.++++||+|||...++...            .+...+     .+.+|||||.+++. ||-.||.+|.... +++..+
T Consensus       375 ~~~~~ade~~~qk~~~~l~~~l~~~~k~~~~~cS~~~~e~~n~~~tgaTLII~P~aIl~-QW~~EI~kH~~~~-lKv~~Y  452 (1394)
T KOG0298         375 KRVQCADEMGWQKTSEKLILELSDLPKLCPSCCSELVKEGENLVETGATLIICPNAILM-QWFEEIHKHISSL-LKVLLY  452 (1394)
T ss_pred             CCEEEHHHHHCCCHHHHHHHHHHCCCCCCHHHHHHHHHCCCCEEECCCEEEECCHHHHH-HHHHHHHHHCCCC-CEEEEE
T ss_conf             41230544410104788888774245433155458776156422037559988378799-9999999755665-227877


Q ss_pred             ECCHHHHH--HHHCCCCCEEEECCCCHHHHHHHC---------------------CCCCCCCEEECCCCCCCCCCCCCCH
Q ss_conf             58978988--873077986998064202334420---------------------0011322044045310024654311
Q gi|255764515|r   81 TGTVKQRT--KVLKTPAVLYVINFENLGWLVQEL---------------------KGTWPFATIVVDESTKLKSFRLRQG  137 (458)
Q Consensus        81 ~g~~~~r~--~~~~~~~~i~i~s~e~~~~~~~~~---------------------~~~~~~~~iIiDEaH~lkn~~~~~~  137 (458)
                      .|-.+.-.  ..-...++|++|||+.++...-+-                     +....|..||+|||+.+.+    ..
T Consensus       453 ~Girk~~~~~~~el~~yDIVlTtYdiLr~El~hte~~~~~R~lR~qsr~~~~~SPL~~v~wWRIclDEaQMves----ss  528 (1394)
T KOG0298         453 FGIRKTFWLSPFELLQYDIVLTTYDILRNELYHTEDFGSDRQLRHQSRYMRPNSPLLMVNWWRICLDEAQMVES----SS  528 (1394)
T ss_pred             ECHHHHCCCCCHHHHCCCEEEEEHHHHHHHHHCCCCCCCHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC----HH
T ss_conf             51544156672244246779854588776752031248726664036777999835877789885538876211----37


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCC
Q ss_conf             5677776654305980799658402310010134677517
Q gi|255764515|r  138 SKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD  177 (458)
Q Consensus       138 s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~  177 (458)
                      |..++.+.++  .+.++|+.||||+++ +.|+|+++.||.
T Consensus       529 S~~a~M~~rL--~~in~W~VTGTPiq~-Iddl~~Ll~fLk  565 (1394)
T KOG0298         529 SAAAEMVRRL--HAINRWCVTGTPIQK-IDDLFPLLEFLK  565 (1394)
T ss_pred             HHHHHHHHHH--HHHCEEEECCCCHHH-HHHHHHHHHHHC
T ss_conf             7999999975--330244504870332-451688999856


No 24 
>KOG0383 consensus
Probab=100.00  E-value=2.8e-36  Score=238.04  Aligned_cols=347  Identities=20%  Similarity=0.252  Sum_probs=243.6

Q ss_pred             CCHHHHHHHHHHHH----CCCEEEEECCCCCHHHHHHHHHHHHHHCCC--CCEEEEECCHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             74789999999996----798099958899868999999999997599--949999160465699999999855888815
Q gi|255764515|r    3 LAPHQTKIVDWILD----HKRCAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRWSNFSHMN   76 (458)
Q Consensus         3 L~p~Q~~~v~~~~~----~~~~ll~~~~G~GKT~~al~~~~~l~~~~~--~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~   76 (458)
                      |.|||.++++|+.-    ...+++||+||+|||++++.+...+...+.  .+.|+++|.+.+. .|.+|++.|.+  ...
T Consensus       296 L~~~qleGln~L~~~ws~~~~~ilADEmgLgktVqsi~fl~sl~~~~~~~~P~Lv~ap~sT~~-nwe~e~~~wap--~~~  372 (696)
T KOG0383         296 LHPYQLEGLNWLRISWSPGVDAILADEMGLGKTVQSIVFLYSLPKEIHSPGPPLVVAPLSTIV-NWEREFELWAP--SFY  372 (696)
T ss_pred             CCCCCHHHHHHHHCCCCCCCCCCCCHHHCCCCEEEEEEEEEECCCCCCCCCCCEEECCCCCCC-CCCCCHHCCCC--CCC
T ss_conf             440156666553142236888655310158711457888852134557889954656676645-78874100588--753


Q ss_pred             EEEEECCHHHHHHHHCC------------------------CCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCC
Q ss_conf             99985897898887307------------------------798699806420233442000113220440453100246
Q gi|255764515|r   77 ISVITGTVKQRTKVLKT------------------------PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSF  132 (458)
Q Consensus        77 ~~~~~g~~~~r~~~~~~------------------------~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~  132 (458)
                      +..+.|+.+.|.-+...                        ...+..++|+.... ...+...+.|.++|+||+|++||.
T Consensus       373 vv~~~G~~k~r~iirepe~s~ed~~~~~~~~i~~~~~~s~~k~~vl~~s~~~~~~-~~~il~~v~w~~livde~~rlkn~  451 (696)
T KOG0383         373 VVPYPGTAKSRAIIREPEFSFEDSSIKSSPKISEMKTESSAKFHVLLPSYETIEI-DQSILFSVQWGLLIVDEAHRLKNK  451 (696)
T ss_pred             CCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCHHHCCC-CHHHHHHHHCCEEEEECHHHCCCC
T ss_conf             3368887122456624433455420003775332121321135667886554026-788774310213675000102564


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHH
Q ss_conf             54311567777665430598079965840231001013467751788877532778877736956403300002455554
Q gi|255764515|r  133 RLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKE  212 (458)
Q Consensus       133 ~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~  212 (458)
                          .|++++.+..  ....++++|||||.+|++.+||++|+|+.|+..-.  ...|.+++.+             ....
T Consensus       452 ----~s~~f~~l~~--~~~~~~~lltgtPlqnn~~el~~ll~flt~~~~~~--~~~f~e~~~d-------------~~~~  510 (696)
T KOG0383         452 ----QSKRFRVLTA--YPIDSKLLLTGTPLQNNLEELFNLLNFLTPGRFNS--LEWFLEEFHD-------------ISCE  510 (696)
T ss_pred             ----HHHHHHHCCC--CCCCHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCC--HHHHHHHCCH-------------HHHH
T ss_conf             ----4444432355--53200000468820002677521136567011352--2333221001-------------3489


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCC-CCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             558999997424543320000100-1001100034524536899888999999851033452022347888875420354
Q gi|255764515|r  213 TAQKEIEAQLSDCCLSLDIADYQN-IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG  291 (458)
Q Consensus       213 ~~~~~l~~~l~~~~~~~~~~~~~~-l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~  291 (458)
                      ...+.+...+.+++.++.+.|+.+ +|...+....+.+++-|.+.|.+.....+.-+.. ..........++.+++.|+|
T Consensus       511 ~~~~~l~~l~~p~~lrr~k~d~l~~~P~Kte~i~~~~~~~~Q~~~yk~~~t~n~~~l~~-~~~~~s~~n~~mel~K~~~h  589 (696)
T KOG0383         511 EQIKKLHLLLCPHMLRRLKLDVLKPMPLKTELIGRVELSPCQKKYYKKILTRNWQGLLA-GVHQYSLLNIVMELRKQCNH  589 (696)
T ss_pred             HHHHHHCCCCCCHHHHHHHHHHCCCCCCCCEEEEEEECCHHHHHHHHHHHCCCHHHHHH-CCHHHHHHHHHHHHHHHHCC
T ss_conf             99976354557345635406541689865215788733789999999987277277752-00568999999999986347


Q ss_pred             CCCCCCCCCCHH----------CCCCCCCCHHHHHH--CCCCCEEEEHHHHHHHHHHHHH---------CCCCCCCHHHH
Q ss_conf             100022343000----------13433332566541--2488403422236788866410---------00265334458
Q gi|255764515|r  292 AVYYDEEKHWKE----------VHDEKIKALEVIIE--KANAAPIIVAYHFNSDLARLQK---------AFPQGRTLDKD  350 (458)
Q Consensus       292 ~~~~~~~~~~~~----------~~~~k~~~l~~il~--~~~~~kviif~~~~~~~~~i~~---------~~~~g~~~~~r  350 (458)
                      |..++.......          ..++|+..|..++.  ...|++|+||+++..+++.+..         ++-|+.+...|
T Consensus       590 py~~~~~e~~~~~~~~~~~~l~k~~~k~~~l~~~~~~l~~~ghrvl~~~q~~~~ldlled~~~~~~~~~r~dG~~~~~~r  669 (696)
T KOG0383         590 PYLSPLEEPLEENGEYLGSALIKASGKLTLLLKMLKKLKSSGHRVLIFSQMIHMLDLLEDYLTYEGKYERIDGPITGPER  669 (696)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCHHH
T ss_conf             55376312012006889999999877899999999987734324689999999998868887406741011487666056


Q ss_pred             HHHHHHHCCCC--CCEEEEEHHHCCCC
Q ss_conf             99876424588--55899844221116
Q gi|255764515|r  351 PCTIQEWNEGK--IPLLFAHPASCGHG  375 (458)
Q Consensus       351 ~~~i~~f~~~~--~~vli~s~~~~~~G  375 (458)
                      +.+|++||.+.  --+++.|++|||.|
T Consensus       670 q~ai~~~n~~~~~~~cfllstra~g~g  696 (696)
T KOG0383         670 QAAIDRFNAPGSNQFCFLLSTRAGGLG  696 (696)
T ss_pred             HHHCCCCCCCCCCCEEEEEECCCCCCC
T ss_conf             652256679975412888511456689


No 25 
>TIGR00603 rad25 DNA repair helicase rad25; InterPro: IPR001161   Xeroderma pigmentosum (XP)  is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. People's skin cells with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-G is one of the most rare and phenotypically heterogeneous of XP, showing anything from slight to extreme dysfunction in DNA excision repair , . XP-G can be corrected by a 133 Kd nuclear protein, XPGC . XPGC is an acidic protein that confers normal UV resistance in expressing cells . It is a magnesium-dependent, single-strand DNA endonuclease that makes structure-specific endonucleolytic incisions in a DNA substrate containing a duplex region and single-stranded arms , . XPGC cleaves one strand of the duplex at the border with the single-stranded region .   XPG belongs to a family of proteins that includes RAD2 from Saccharomyces cerevisiae (Baker's yeast) and rad13 from Schizosaccharomyces pombe (Fission yeast), which are single-stranded DNA endonucleases , ; mouse and human FEN-1, a structure-specific endonuclease; RAD2 from fission yeast and RAD27 from budding yeast; fission yeast exo1, a 5'-3' double-stranded DNA exonuclease that may act in a pathway that corrects mismatched base pairs; yeast DHS1, and yeast DIN7. Sequence alignment of this family of proteins reveals that similarities are largely confined to two regions. The first is located at the N-terminal extremity (N-region) and corresponds to the first 95 to 105 amino acids. The second region is internal (I-region) and found towards the C-terminus; it spans about 140 residues and contains a highly conserved core of 27 amino acids that includes a conserved pentapeptide (E-A-[DE]-A-[QS]). It is possible that the conserved acidic residues are involved in the catalytic mechanism of DNA excision repair in XPG. The amino acids linking the N- and I-regions are not conserved.   This entry represents XP group B (XP-B) give rise to both XP and Cockayne syndrome . The DNA/RNA helicase domain IPR001650 from INTERPRO is also present in this group of proteins.; GO: 0003677 DNA binding, 0004003 ATP-dependent DNA helicase activity, 0005524 ATP binding, 0006289 nucleotide-excision repair, 0005634 nucleus.
Probab=100.00  E-value=1.6e-34  Score=227.34  Aligned_cols=335  Identities=19%  Similarity=0.279  Sum_probs=236.7

Q ss_pred             CCCHHHHHHHH-HHHHCCC---EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             87478999999-9996798---0999588998689999999999975999499991604656999999998558888159
Q gi|255764515|r    2 NLAPHQTKIVD-WILDHKR---CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         2 ~L~p~Q~~~v~-~~~~~~~---~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~   77 (458)
                      .|||||+..+. +|-+|||   |+|..|+|.||||.-+.|+...    .+++||+|..++-..||...|..|.......+
T Consensus       269 ~~RPYQEKSLrsKMFGNGRARSGiIVLPCGAGKsLVGvTAACTv----kKs~lVLctS~VSV~QW~~QFk~WSti~d~~I  344 (756)
T TIGR00603       269 VLRPYQEKSLRSKMFGNGRARSGIIVLPCGAGKSLVGVTAACTV----KKSVLVLCTSAVSVEQWKQQFKLWSTIDDSQI  344 (756)
T ss_pred             CCCCCHHHHCCCCCCCCCCCCCCCEECCCCCCCCHHHHHHHEEE----EEEEEEEECCCHHHHHHHHHHHHCCCCCCCCC
T ss_conf             88975111044456678611055177677888311225442023----10078972671008899988752268873551


Q ss_pred             EEEECCHHHHHHHHCCCCCEEEECCCCHHHHH---------HHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             99858978988873077986998064202334---------420001132204404531002465431156777766543
Q gi|255764515|r   78 SVITGTVKQRTKVLKTPAVLYVINFENLGWLV---------QELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA  148 (458)
Q Consensus        78 ~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~---------~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~  148 (458)
                      ..+|.+.|++   +.+...|+|+||.++.+-.         =+++....|++||+||.|.+       .++.+|......
T Consensus       345 crFTSD~Ke~---~~~~~gv~vsTYsMva~t~kRS~es~k~m~~l~~rEWGl~~LDEVHvv-------PA~mFRrVlt~~  414 (756)
T TIGR00603       345 CRFTSDAKEK---FHGEAGVVVSTYSMVAHTGKRSYESEKVMEWLTNREWGLILLDEVHVV-------PAAMFRRVLTIV  414 (756)
T ss_pred             CCCCCCCCCC---CCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCC-------CCCCCCCHHHHH
T ss_conf             1025213576---266533588733000247543188999999970687317986110103-------500166010144


Q ss_pred             HCCCEEEEECCCCHH--HHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             059807996584023--100101346775178887753277887773695640330000245555455899999742454
Q gi|255764515|r  149 WESERFIELTGTPSP--NGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCC  226 (458)
Q Consensus       149 ~~~~~~l~LTgTPi~--n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~  226 (458)
                       +|--+|+||||-+-  ..+.|    ||||-..       .-|.++|++..+.|.                        +
T Consensus       415 -~aHcKLGLTATLvREDdKI~D----LNFLIGP-------KLYEANWleL~~~Gf------------------------I  458 (756)
T TIGR00603       415 -QAHCKLGLTATLVREDDKIQD----LNFLIGP-------KLYEANWLELQKKGF------------------------I  458 (756)
T ss_pred             -HHHHCCCCCEEEECCCCCCCC----CCCCCCC-------HHHHHHHHHHHCCCE------------------------E
T ss_conf             -332001432110011143031----2213572-------134532698820883------------------------6


Q ss_pred             HHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCC
Q ss_conf             33200001001001100034524536899888999999851033452022347888875420354100022343000134
Q gi|255764515|r  227 LSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHD  306 (458)
Q Consensus       227 ~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~  306 (458)
                      -++   .|.        .++++|+++-.+.|-....      .++...                   +|       ..+-
T Consensus       459 A~V---qCA--------EVWCPMt~EFY~EYL~~~~------~~Kr~L-------------------LY-------~MNP  495 (756)
T TIGR00603       459 ANV---QCA--------EVWCPMTPEFYREYLREKS------RKKRML-------------------LY-------VMNP  495 (756)
T ss_pred             EEE---EEC--------CCCCCCCHHHHHHHHHHHC------CCCCEE-------------------EE-------ECCC
T ss_conf             887---412--------1017887778999985511------244303-------------------12-------0386


Q ss_pred             CCCCCHHHHH---HCCCCCEEEEHHHHHHHHHHHH-----HCCCCCCCHHHHHHHHHHHC-CCCCCEEEEEHHHCCCCCC
Q ss_conf             3333256654---1248840342223678886641-----00026533445899876424-5885589984422111622
Q gi|255764515|r  307 EKIKALEVII---EKANAAPIIVAYHFNSDLARLQ-----KAFPQGRTLDKDPCTIQEWN-EGKIPLLFAHPASCGHGLN  377 (458)
Q Consensus       307 ~k~~~l~~il---~~~~~~kviif~~~~~~~~~i~-----~~~~~g~~~~~r~~~i~~f~-~~~~~vli~s~~~~~~Gln  377 (458)
                      .|+++=.-++   |+..|.|||||+..+--+....     .-|.|+++..||..+++.|+ |++++-+++| ++|-+.||
T Consensus       496 ~KFrACqFLI~fHE~~RgDKIIVFsDNVfAL~~YA~kl~KpfIYGpTsq~ER~~IL~nF~~n~~vnTIF~S-KVGDtSiD  574 (756)
T TIGR00603       496 NKFRACQFLIRFHERQRGDKIIVFSDNVFALKEYAIKLGKPFIYGPTSQQERMQILQNFKHNPKVNTIFLS-KVGDTSID  574 (756)
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHCCCCEEECCCCHHHHHHHHHHCCCCCCCCEEEEE-EECCCCCC
T ss_conf             44357789888854148885899424478999999873896540798713799998621558864568984-30277514


Q ss_pred             CCCCCCEEEEECCCC-CHHHHHHHHHHHHCCCCHHCC-----CC-CCEEEEEEEECCCHHH
Q ss_conf             001785999908998-986864456666202202037-----87-7528999985899689
Q gi|255764515|r  378 LQYGGNILVFFSLWW-DLEEHQQMIERIGVTRQRQAG-----FK-RAVFVYYLIAQNTIDE  431 (458)
Q Consensus       378 L~~a~~~iI~~~~~w-n~~~~~Q~~gRi~~~r~hR~G-----q~-~~v~v~~li~~~tide  431 (458)
                      |+.| |++|-.+.|. |-.-.-||-|||.|..-.-.+     .+ =+-.-|=||++||.|-
T Consensus       575 lPEA-nvlIQiSSH~GSRRQEAQRLGRILRAK~~~~~r~aggkE~YNAFFYSLVS~DTqEm  634 (756)
T TIGR00603       575 LPEA-NVLIQISSHYGSRRQEAQRLGRILRAKKKSDARMAGGKEEYNAFFYSLVSKDTQEM  634 (756)
T ss_pred             CCCC-CEEEEEEECCCCHHHHHHHCCCCCCCCCCCHHHHCCCCCCCCEEEEECCCCCCEEE
T ss_conf             2214-26776532677403687641320167875133313776442201210134451465


No 26 
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional
Probab=99.96  E-value=7.4e-26  Score=174.89  Aligned_cols=322  Identities=18%  Similarity=0.242  Sum_probs=203.9

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHH-----HCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             874789999999996798099958899868999-99999999-----759994999916046569999999985588881
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIH-----LWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~-----~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      ++.|-|..++-.+++++..++.+++|+|||+.- |-++..+.     ..+...+|||||+.-+..|-.+++.++.....+
T Consensus        25 ~pT~IQ~~aIp~il~g~dvl~~A~TGSGKTlaylLPil~~l~~~~~~~~~~~~~LIl~PTrELa~Qi~~~~~~l~~~~~i  104 (417)
T PRK11192         25 RPTAIQAEAIPPALDGRDVLGSAPTGTGKTAAFLLPALQHLLDFPRRKSGPPRILILTPTRELAMQVADQARELAKHTHL  104 (417)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99999999999997799889989998679999999999998752103689964999947199999999999986400573


Q ss_pred             EEEEEECCH--HHHHHHHCCCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             599985897--8988873077986998064202334420-0011322044045310024654311567777665430598
Q gi|255764515|r   76 NISVITGTV--KQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESE  152 (458)
Q Consensus        76 ~~~~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~  152 (458)
                      ++..+.|..  ......+....+|+|.|...+....... .....-.++|+||||++-+.+-   ......+.......+
T Consensus       105 ~~~~i~Gg~~~~~q~~~l~~~~dIlV~TPgRL~~~l~~~~~~l~~l~~lVlDEAD~mld~gF---~~~i~~I~~~~~~~~  181 (417)
T PRK11192        105 DIATITGGVAYMNHAEVFSENQDIVVATPGRLLQYIKEENFDCRAVETLILDEADRMLDMGF---AQDVEHIAAETRWRK  181 (417)
T ss_pred             CEEEEECCCCHHHHHHHHHCCCCEEEECCCHHHHHHHHCCCCCCCCCEEEEECCCCCCCCCC---HHHHHHHHHHCCCCC
T ss_conf             05998568787999999836999899786077778863670104574899967552111354---789999986476772


Q ss_pred             EEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             07996584023100101346775178887753277887773695640330000245555455899999742454332000
Q gi|255764515|r  153 RFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIA  232 (458)
Q Consensus       153 ~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~  232 (458)
                      ..+++|||.-.+...+                    |...+....                           ..+.....
T Consensus       182 Q~llfSATl~~~~v~~--------------------l~~~~l~~p---------------------------~~i~~~~~  214 (417)
T PRK11192        182 QTLLFSATLEGDGVQD--------------------FAERLLNDP---------------------------VEVDAEPS  214 (417)
T ss_pred             EEEEEEEECCHHHHHH--------------------HHHHHCCCC---------------------------EEEEECCC
T ss_conf             3899973268478999--------------------999836798---------------------------89996467


Q ss_pred             CCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCH
Q ss_conf             01001001100034524536899888999999851033452022347888875420354100022343000134333325
Q gi|255764515|r  233 DYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKAL  312 (458)
Q Consensus       233 ~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l  312 (458)
                      .   ..... ....+...                                                    .....|...|
T Consensus       215 ~---~~~~~-i~q~~~~~----------------------------------------------------~~~~~k~~~L  238 (417)
T PRK11192        215 R---RERKK-IHQWYYRA----------------------------------------------------DDLEHKTALL  238 (417)
T ss_pred             C---CCCCC-EEEEEEEE----------------------------------------------------CCHHHHHHHH
T ss_conf             6---66674-36999993----------------------------------------------------7689999999


Q ss_pred             HHHHHCCCCCEEEEHHHHHHHHHHHHHC----------CCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCC
Q ss_conf             6654124884034222367888664100----------026533445899876424588558998442211162200178
Q gi|255764515|r  313 EVIIEKANAAPIIVAYHFNSDLARLQKA----------FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGG  382 (458)
Q Consensus       313 ~~il~~~~~~kviif~~~~~~~~~i~~~----------~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~  382 (458)
                      ..++......++||||+-....+.+...          ++++.+.++|..+++.|++|+++||++| ++++-|||+.. .
T Consensus       239 ~~ll~~~~~~k~iIF~~t~~~~~~l~~~L~~~g~~~~~lhg~l~q~~R~~~l~~F~~g~~~vLVaT-DvaaRGiDi~~-V  316 (417)
T PRK11192        239 CHLLKQEEVTRSIVFVRTRERVHELAGWLRKAGINCCYLEGEMVQKKRNEAIKRLTDGRVNVLVAT-DVAARGIDIDD-I  316 (417)
T ss_pred             HHHHHCCCCCCCEEEECCHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHCCCCCEEEEC-CHHHCCCCCCC-C
T ss_conf             999853476652153112466768988653148835754001799999999999976999899981-24346777046-9


Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             5999908998986864456666202202037877528999985899689999999999
Q gi|255764515|r  383 NILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       383 ~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
                      ++||+||+|-++..+.|++||..     |.|++-  .++-|++++  |..++..+++-
T Consensus       317 ~~VInyd~P~~~~~YvHRiGRTG-----R~G~~G--~ait~v~~~--d~~~~~~ie~~  365 (417)
T PRK11192        317 SHVINFDMPRSADTYLHRIGRTG-----RAGKKG--TAISLVEAH--DHLLLGKIERY  365 (417)
T ss_pred             CEEEEECCCCCHHHHHHHCCHHH-----CCCCCE--EEEEEECHH--HHHHHHHHHHH
T ss_conf             88999799998889233067723-----489954--899987489--99999999999


No 27 
>PRK13767 ATP-dependent helicase; Provisional
Probab=99.95  E-value=1e-25  Score=173.99  Aligned_cols=321  Identities=19%  Similarity=0.246  Sum_probs=189.2

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCCC-------CCEEEEECC-HHHHHHHH------HHH
Q ss_conf             874789999999996798099958899868999-999999997599-------949999160-46569999------999
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLWGE-------KSVLVIAPL-RVAQSVWT------SEV   66 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~~-------~~~LIv~P~-~l~~~~W~------~Ei   66 (458)
                      ++.|||.+|+..+++.+++|+..++|+|||+.| +.++..+...+.       -.+|+|+|. +|..+++.      +++
T Consensus        32 ~p~~~Q~~a~~~i~~G~~~Li~ApTGsGKTlAaflp~l~~l~~~~~~~~~~~~~~~LyIsPLkAL~~D~~r~L~~pl~~i  111 (878)
T PRK13767         32 TFTPPQRYAIPLIHEGKNVLISSPTGSGKTLAAFLGIIDELFRLAEEGELEDSVYCIYVSPLRALNNDIHRNLEEPLEEI  111 (878)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHH
T ss_conf             99989999999996799889989998139999999999999850003677887289996847988999999888699999


Q ss_pred             HHHC-----CCCCCEEEEEECCH--HHHHHHHCCCCCEEEECCCCHHHHHH-----HCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             9855-----88881599985897--89888730779869980642023344-----200011322044045310024654
Q gi|255764515|r   67 QRWS-----NFSHMNISVITGTV--KQRTKVLKTPAVLYVINFENLGWLVQ-----ELKGTWPFATIVVDESTKLKSFRL  134 (458)
Q Consensus        67 ~kf~-----~~~~~~~~~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~~-----~~~~~~~~~~iIiDEaH~lkn~~~  134 (458)
                      ..+.     ..+.+.+.+-+|+.  .+|.++.....+|++||.|++..+..     ..+..  -..||+||+|.+-+  +
T Consensus       112 ~~~~~~~g~~~~~i~v~vr~GDT~~~er~r~~~~pp~ILiTTPEsL~lll~~~~~~~~l~~--l~~VIvDE~H~l~~--~  187 (878)
T PRK13767        112 REIAKERGIELPEIRHAVRTGDTSSYEKQKMLRKPPHILITTPETLAILLNSPKFREKLRT--VKWVIVDEIHSLAE--N  187 (878)
T ss_pred             HHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHCC--CCEEEECCCHHHHC--C
T ss_conf             9998752788777447763699999999999748998798798999999549679998558--99999817167524--7


Q ss_pred             CCHHHHHHH---HHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHH
Q ss_conf             311567777---66543059807996584023100101346775178887753277887773695640330000245555
Q gi|255764515|r  135 RQGSKTARA---LAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAK  211 (458)
Q Consensus       135 ~~~s~~~~~---l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~  211 (458)
                      ..+++..-.   +..+......+|+||||-  .+|.++   ..+|.+....                 +.. ....    
T Consensus       188 kRG~~l~l~L~RL~~~~~~~~~riglSATv--~~~~~~---a~~L~g~~~~-----------------g~~-r~~~----  240 (878)
T PRK13767        188 KRGVHLSLSLERLEELVGGEFVRIGLSATI--EPLEEV---AKFLVGYNDD-----------------GEP-RDCE----  240 (878)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEEEECCC--CCHHHH---HHHHCCCCCC-----------------CCC-CCEE----
T ss_conf             745899999999998668998799996464--899999---9985155667-----------------999-8528----


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             45589999974245433200001001001100034524536899888999999851033452022347888875420354
Q gi|255764515|r  212 ETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG  291 (458)
Q Consensus       212 ~~~~~~l~~~l~~~~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~  291 (458)
                                    ++....      ..+.......+.... .            ...      .....           
T Consensus       241 --------------iv~~~~------~k~~~~~~~~p~~~~-~------------~~~------~~~~~-----------  270 (878)
T PRK13767        241 --------------IVDTRF------AKPIDIKVLCPVDDL-I------------HTP------AEEIS-----------  270 (878)
T ss_pred             --------------EECCCC------CCCCEEEEECCCCCC-C------------CCC------HHHHH-----------
T ss_conf             --------------954687------787426884456212-4------------588------55689-----------


Q ss_pred             CCCCCCCCCCHHCCCCCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHHC----------------CCCCCCHHHHHHHHH
Q ss_conf             1000223430001343333256654124884034222367888664100----------------026533445899876
Q gi|255764515|r  292 AVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA----------------FPQGRTLDKDPCTIQ  355 (458)
Q Consensus       292 ~~~~~~~~~~~~~~~~k~~~l~~il~~~~~~kviif~~~~~~~~~i~~~----------------~~~g~~~~~r~~~i~  355 (458)
                                    ..-++.+.+++++  ++..+||+|.....+.+...                .+++.+.+.|.++-+
T Consensus       271 --------------~~~~~~l~~~i~~--~~~tLvF~NtR~~aE~~~~~L~~~~~~~~~~~~i~~HHgSls~e~R~~vE~  334 (878)
T PRK13767        271 --------------EALYETLDELIQE--HRTTLIFTNTRSGAERVVYKLRKRYPEEYDEDNIGAHHSSLSREVRLEVEE  334 (878)
T ss_pred             --------------HHHHHHHHHHHHH--CCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHH
T ss_conf             --------------9999999999983--897799915589999999999985343067543222017789999999999


Q ss_pred             HHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCC
Q ss_conf             4245885589984422111622001785999908998986864456666202202037877528999985899
Q gi|255764515|r  356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNT  428 (458)
Q Consensus       356 ~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~t  428 (458)
                      .|++|+.++++|| .+...|||... -+.||.+..|.+.+.+.|++||--    ||.|.....   +++..+.
T Consensus       335 ~lk~G~l~~vV~T-sSLELGIDiG~-Vd~Viq~gsP~svarllQR~GRsG----H~~g~~s~g---~~vp~~~  398 (878)
T PRK13767        335 KLKRGELKVVVSS-TSLELGIDIGY-IDLVVLLGSPKSVSRLLQRIGRAG----HRLGEVSKG---RIIVVDR  398 (878)
T ss_pred             HHHCCCCCEEEEE-CHHHCCCCCCC-CCEEEECCCCHHHHHHHHHHCCCC----CCCCCEEEE---EEEECCC
T ss_conf             9857998689982-73650777775-258997589611899999833578----999980469---9997981


No 28 
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional
Probab=99.95  E-value=5.7e-25  Score=169.49  Aligned_cols=320  Identities=17%  Similarity=0.204  Sum_probs=200.7

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCC-----CC--CEEEEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             874789999999996798099958899868999-99999999759-----99--49999160465699999999855888
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLWG-----EK--SVLVIAPLRVAQSVWTSEVQRWSNFS   73 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~-----~~--~~LIv~P~~l~~~~W~~Ei~kf~~~~   73 (458)
                      +.-|-|..++-.+++.+..++.+++|+|||+.- |-++..+....     ..  .+||+||+.-+..|-.+++..+....
T Consensus        23 ~PTpIQ~~aIP~iL~GrDvl~~A~TGSGKTlAflLPil~~l~~~~~~~~~~~~~~aLIL~PTRELA~Qi~~~~~~l~~~~  102 (457)
T PRK10590         23 EPTPIQQQAIPAVLEGRDLMASAQTGTGKTAGFTLPLLQHLITRQPHAKGRRPVRALILTPTRELAAQIGENVRDYSKYL  102 (457)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999997799889988981189999999999998636765445688249997687999999999999742558


Q ss_pred             CCEEEEEECCH--HHHHHHHCCCCCEEEECCCCHHHHHHH-CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             81599985897--898887307798699806420233442-000113220440453100246543115677776654305
Q gi|255764515|r   74 HMNISVITGTV--KQRTKVLKTPAVLYVINFENLGWLVQE-LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE  150 (458)
Q Consensus        74 ~~~~~~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~~~-~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~  150 (458)
                      .+++.++.|..  ......+....+|+|.|...+..+... ......-.++|+|||++|-+.+-.  ... +.+......
T Consensus       103 ~~~~~~~~Gg~~~~~q~~~l~~~~dIlVaTPGRLldl~~~~~~~l~~v~~lVlDEAD~mLd~gF~--~di-~~Il~~lp~  179 (457)
T PRK10590        103 NIRSLVVFGGVSINPQMMKLRGGVDVLVATPGRLLDLEHQNAVKLDQVEILVLDEADRMLDMGFI--HDI-RRVLAKLPA  179 (457)
T ss_pred             CCEEEEEECCCCHHHHHHHHCCCCCEEEECCHHHHHHHHCCCCCCCCCEEEEEECCHHHHCCCCH--HHH-HHHHHHCCC
T ss_conf             94599997997775999986189998998928889888626776575239998370565156653--668-999863876


Q ss_pred             CCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98079965840231001013467751788877532778877736956403300002455554558999997424543320
Q gi|255764515|r  151 SERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLD  230 (458)
Q Consensus       151 ~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~  230 (458)
                      ....++.|||- ++.+.+                    +...+....                           ..+.. 
T Consensus       180 ~rQ~llfSAT~-~~~v~~--------------------l~~~~l~~p---------------------------~~i~v-  210 (457)
T PRK10590        180 KRQNLLFSATF-SDDIKA--------------------LAEKLLHNP---------------------------LEIEV-  210 (457)
T ss_pred             CCEEEEEECCC-CHHHHH--------------------HHHHHCCCC---------------------------EEEEE-
T ss_conf             52689995048-889999--------------------999976898---------------------------89996-


Q ss_pred             CCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCC
Q ss_conf             00010010011000345245368998889999998510334520223478888754203541000223430001343333
Q gi|255764515|r  231 IADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIK  310 (458)
Q Consensus       231 ~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~  310 (458)
                       ........ . ....+...                                                     ....|.+
T Consensus       211 -~~~~~~~~-~-i~q~~~~v-----------------------------------------------------~~~~k~~  234 (457)
T PRK10590        211 -ARRNTASE-Q-VTQHVHFV-----------------------------------------------------DKKRKRE  234 (457)
T ss_pred             -CCCCCCCC-C-EEEEEEEE-----------------------------------------------------CHHHHHH
T ss_conf             -36766561-3-04899995-----------------------------------------------------6678999


Q ss_pred             CHHHHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCC
Q ss_conf             25665412488403422236788866410----------00265334458998764245885589984422111622001
Q gi|255764515|r  311 ALEVIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQY  380 (458)
Q Consensus       311 ~l~~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~  380 (458)
                      .|..++.+....++||||+.....+.+..          .++++.+..+|..+++.|++|+.+|||+| +.++=|||+..
T Consensus       235 ~L~~ll~~~~~~~~iIF~~tk~~a~~l~~~L~~~g~~~~~lHg~~sq~~R~~~l~~F~~g~~~vLVaT-DvaaRGiDi~~  313 (457)
T PRK10590        235 LLSQMIGKGNWQQVLVFTRTKHGANHLAEQLNKDGIRSAAIHGNKSQGARTRALADFKSGDIRVLVAT-DIAARGLDIEE  313 (457)
T ss_pred             HHHHHHHHCCCCCEEEEECHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHCCCCCEEEEC-CCCCCCCCCCC
T ss_conf             99999861586633588411999999999985569982323247899999999999986998299957-70115566356


Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             785999908998986864456666202202037877528999985899689999999999
Q gi|255764515|r  381 GGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       381 a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
                       .++||+||+|-++..+..++||..     |.|.+  =..+-|++++  |...++.+++-
T Consensus       314 -V~~VInyD~P~~~e~YvHRiGRTG-----RaG~~--G~ait~v~~~--e~~~~~~ie~~  363 (457)
T PRK10590        314 -LPHVVNYELPNVPEDYVHRIGRTG-----RAAAT--GEALSLVCVD--EHKLLRDIEKL  363 (457)
T ss_pred             -CCEEEEECCCCCHHHEECCCCCCC-----CCCCC--EEEEEEECHH--HHHHHHHHHHH
T ss_conf             -887999389997445002267060-----58995--3699986689--99999999999


No 29 
>KOG1123 consensus
Probab=99.95  E-value=1.6e-26  Score=178.85  Aligned_cols=334  Identities=19%  Similarity=0.266  Sum_probs=222.5

Q ss_pred             CCCHHHHHHHHHHHHCCC---EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             874789999999996798---09995889986899999999999759994999916046569999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKR---CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~---~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~   78 (458)
                      +++|||...+.+|..|+|   |+|..++|.|||+.-+.++...    .+++||+|..++-..||...|..|.....-.+.
T Consensus       302 ~iRpYQEksL~KMFGNgRARSGiIVLPCGAGKtLVGvTAa~ti----kK~clvLcts~VSVeQWkqQfk~wsti~d~~i~  377 (776)
T KOG1123         302 QIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGVTAACTI----KKSCLVLCTSAVSVEQWKQQFKQWSTIQDDQIC  377 (776)
T ss_pred             CCCCHHHHHHHHHHCCCCCCCCEEEEECCCCCCEEEEEEEEEE----CCCEEEEECCCCCHHHHHHHHHHHHCCCCCCEE
T ss_conf             5575378789997378854476189856998742545555455----142799955756699999998745016855457


Q ss_pred             EEECCHHHHHHHHCCCCCEEEECCCCHHHHH---------HHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9858978988873077986998064202334---------4200011322044045310024654311567777665430
Q gi|255764515|r   79 VITGTVKQRTKVLKTPAVLYVINFENLGWLV---------QELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        79 ~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~---------~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                      .++.+.+++   +.....++|+||.++..-.         -++.....|.++++||.|.+       .++.+|...... 
T Consensus       378 rFTsd~Ke~---~~~~~gvvvsTYsMva~t~kRS~eaek~m~~l~~~EWGllllDEVHvv-------PA~MFRRVlsiv-  446 (776)
T KOG1123         378 RFTSDAKER---FPSGAGVVVTTYSMVAYTGKRSHEAEKIMDFLRGREWGLLLLDEVHVV-------PAKMFRRVLSIV-  446 (776)
T ss_pred             EEECCCCCC---CCCCCCEEEEEEEHHHHCCCCCHHHHHHHHHHHCCEEEEEEEEHHCCC-------HHHHHHHHHHHH-
T ss_conf             720244545---789885799873131105664277999999984371016884211112-------699999999999-


Q ss_pred             CCCEEEEECCCCHHH--HCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             598079965840231--001013467751788877532778877736956403300002455554558999997424543
Q gi|255764515|r  150 ESERFIELTGTPSPN--GLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCL  227 (458)
Q Consensus       150 ~~~~~l~LTgTPi~n--~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~  227 (458)
                      ++--+++||||-+..  .+.|    |+||-..       .-|.++|.+..+.+                        ++.
T Consensus       447 ~aHcKLGLTATLvREDdKI~D----LNFLIGP-------KlYEAnWmdL~~kG------------------------hIA  491 (776)
T KOG1123         447 QAHCKLGLTATLVREDDKITD----LNFLIGP-------KLYEANWMDLQKKG------------------------HIA  491 (776)
T ss_pred             HHHHHCCCEEEEEECCCCCCC----CCEEECC-------HHHHCCHHHHHHCC------------------------CEE
T ss_conf             987612651478512663333----3000054-------32112489897478------------------------046


Q ss_pred             HHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCC
Q ss_conf             32000010010011000345245368998889999998510334520223478888754203541000223430001343
Q gi|255764515|r  228 SLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDE  307 (458)
Q Consensus       228 ~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~  307 (458)
                         ...|        ..++++|+++..+.|-.....       +.           .++               ...+-.
T Consensus       492 ---~VqC--------aEVWCpMt~eFy~eYL~~~t~-------kr-----------~lL---------------yvMNP~  527 (776)
T KOG1123         492 ---KVQC--------AEVWCPMTPEFYREYLRENTR-------KR-----------MLL---------------YVMNPN  527 (776)
T ss_pred             ---EEEE--------EEEECCCCHHHHHHHHHHHHH-------HH-----------HEE---------------EECCCC
T ss_conf             ---7765--------314557788999999853145-------44-----------122---------------441740


Q ss_pred             CCCCHHHHHH--CCCCCEEEEHHHHHHHHHHH----H-HCCCCCCCHHHHHHHHHHHC-CCCCCEEEEEHHHCCCCCCCC
Q ss_conf             3332566541--24884034222367888664----1-00026533445899876424-588558998442211162200
Q gi|255764515|r  308 KIKALEVIIE--KANAAPIIVAYHFNSDLARL----Q-KAFPQGRTLDKDPCTIQEWN-EGKIPLLFAHPASCGHGLNLQ  379 (458)
Q Consensus       308 k~~~l~~il~--~~~~~kviif~~~~~~~~~i----~-~~~~~g~~~~~r~~~i~~f~-~~~~~vli~s~~~~~~GlnL~  379 (458)
                      |+.+-.-++.  +..|.|+|||+..+--+...    . .-+.++++..+|..+++.|+ ++.++-+++| ++|.+.++|.
T Consensus       528 KFraCqfLI~~HE~RgDKiIVFsDnvfALk~YAikl~KpfIYG~Tsq~ERm~ILqnFq~n~~vNTIFlS-KVgDtSiDLP  606 (776)
T KOG1123         528 KFRACQFLIKFHERRGDKIIVFSDNVFALKEYAIKLGKPFIYGPTSQNERMKILQNFQTNPKVNTIFLS-KVGDTSIDLP  606 (776)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEECCCCHHHHHHHHHHCCCCCCCCEEEEE-ECCCCCCCCC
T ss_conf             337889999999864983899825088999999970896377888555899999853448733348875-0357655677


Q ss_pred             CCCCEEEEECCCC-CHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHH
Q ss_conf             1785999908998-9868644566662022020378775289999858996899
Q gi|255764515|r  380 YGGNILVFFSLWW-DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDEL  432 (458)
Q Consensus       380 ~a~~~iI~~~~~w-n~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~  432 (458)
                      .| +++|-.+.+. +-...-|+.|||.|.. .|.-..-+++.|-||+++|.|-.
T Consensus       607 EA-nvLIQISSH~GSRRQEAQRLGRILRAK-k~~de~fnafFYSLVS~DTqEM~  658 (776)
T KOG1123         607 EA-NVLIQISSHGGSRRQEAQRLGRILRAK-KRNDEEFNAFFYSLVSKDTQEMY  658 (776)
T ss_pred             CC-CEEEEECCCCCCHHHHHHHHHHHHHHH-HCCCCCCCEEEEEEEECCHHHHH
T ss_conf             66-089997245662278999988998776-33760200024443106418877


No 30 
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional
Probab=99.95  E-value=1e-24  Score=168.02  Aligned_cols=318  Identities=18%  Similarity=0.227  Sum_probs=201.6

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHHCC-CCCCEEE
Q ss_conf             874789999999996798099958899868999-9999999975-999499991604656999999998558-8881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW-GEKSVLVIAPLRVAQSVWTSEVQRWSN-FSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~-~~~~~LIv~P~~l~~~~W~~Ei~kf~~-~~~~~~~   78 (458)
                      ++.|-|.+++-.+++.+..++.+++|+|||+.- |-++..+... ....+||+||+.-+..|-.+++.++.. .+.+++.
T Consensus        26 ~pTpIQ~~aIP~il~G~Dvi~~A~TGSGKTlAfllPil~~l~~~~~~~qaLIL~PTRELa~QV~~~~~~l~~~~~~ikv~  105 (459)
T PRK11776         26 EMTPIQAQSLPAILAGKDVIAQAKTGSGKTAAFGLGLLQKLDVKRFRVQALVLCPTRELADQVAKEIRRLARFIPNIKVL  105 (459)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEECHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99989999999997799889988998589999999999841136789859999675999999999999998505882599


Q ss_pred             EEECCH--HHHHHHHCCCCCEEEECCCCHHHHHHH-CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             985897--898887307798699806420233442-00011322044045310024654311567777665430598079
Q gi|255764515|r   79 VITGTV--KQRTKVLKTPAVLYVINFENLGWLVQE-LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFI  155 (458)
Q Consensus        79 ~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~~~-~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l  155 (458)
                      .+.|..  ......+....+++|.|...+....+. ......-.++|+|||+++-+.+-   ......+.......+..+
T Consensus       106 ~l~GG~~~~~q~~~L~~~~~IvV~TPGRl~d~l~~~~l~l~~v~~lVlDEAD~mLd~gF---~~~i~~Il~~~p~~rQ~~  182 (459)
T PRK11776        106 TLCGGVPMGPQIGSLEHGAHIIVGTPGRILDHLRKGTLDLDALNTLVLDEADRMLDMGF---QDAIDAIIRQAPARRQTL  182 (459)
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCHHHHHHHHCCCCCCCCEEEEEEECCHHHHCCCC---HHHHHHHHHHCCCCCEEE
T ss_conf             99899327999999746999999895899988751663223103899706245432786---688999998688130268


Q ss_pred             EECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             96584023100101346775178887753277887773695640330000245555455899999742454332000010
Q gi|255764515|r  156 ELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ  235 (458)
Q Consensus       156 ~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~  235 (458)
                      +.|||- +..+                    ..+...|....                           ..+..  ....
T Consensus       183 lfSAT~-p~~i--------------------~~l~~~~l~~p---------------------------~~i~v--~~~~  212 (459)
T PRK11776        183 LFSATY-PEGI--------------------AAISARFQRDP---------------------------VEVKV--ESTH  212 (459)
T ss_pred             EEECCC-CHHH--------------------HHHHHHHCCCC---------------------------EEEEE--CCCC
T ss_conf             884568-9899--------------------99999977898---------------------------99996--7877


Q ss_pred             CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHH
Q ss_conf             01001100034524536899888999999851033452022347888875420354100022343000134333325665
Q gi|255764515|r  236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI  315 (458)
Q Consensus       236 ~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~i  315 (458)
                      ..  +.+....+.                                                      .....|.+.|..+
T Consensus       213 ~~--~~I~q~~~~------------------------------------------------------v~~~~K~~~L~~l  236 (459)
T PRK11776        213 DD--STIEQRFYE------------------------------------------------------VDPDERLPALQRL  236 (459)
T ss_pred             CC--CCCEEEEEE------------------------------------------------------ECHHHHHHHHHHH
T ss_conf             79--863799999------------------------------------------------------7718789999999


Q ss_pred             HHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEE
Q ss_conf             412488403422236788866410----------0026533445899876424588558998442211162200178599
Q gi|255764515|r  316 IEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNIL  385 (458)
Q Consensus       316 l~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~i  385 (458)
                      +...+..++||||+.....+.+..          .++++.+..+|...++.|++|+.+||++| +.++-|||+.. .++|
T Consensus       237 l~~~~~~~~IIFcntk~~v~~l~~~L~~~g~~~~~lHg~m~q~~R~~~l~~F~~g~~~iLVaT-DvaaRGIDi~~-V~~V  314 (459)
T PRK11776        237 LLHYRPESCVVFCNTKKECQEVADALNAQGFSALALHGDLEQRDRDQVLVRFANRSCSVLVAT-DVAARGLDIKS-LEAV  314 (459)
T ss_pred             HHHCCCCCEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEH-HHHHCCCCCCC-CCEE
T ss_conf             973687660376174899999999998679968998799999999999999977999799881-04347677135-9889


Q ss_pred             EEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHH
Q ss_conf             990899898686445666620220203787752899998589968999999999
Q gi|255764515|r  386 VFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRT  439 (458)
Q Consensus       386 I~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~  439 (458)
                      |+||+|-++..+.+|+||..     |.|.+  =..+-|++++  |.+.++.+++
T Consensus       315 InyDlP~~~e~YvHRiGRTG-----RaG~~--G~ait~vt~~--e~~~l~~ie~  359 (459)
T PRK11776        315 INYELARDPEVHVHRIGRTG-----RAGSK--GLALSLVAPE--EMQRAAAIED  359 (459)
T ss_pred             EEECCCCCHHHHHHCCCHHH-----CCCCC--EEEEEEECHH--HHHHHHHHHH
T ss_conf             99789897455202052513-----78996--5799998689--9999999999


No 31 
>PRK00254 ski2-like helicase; Provisional
Probab=99.95  E-value=2.6e-25  Score=171.62  Aligned_cols=165  Identities=19%  Similarity=0.210  Sum_probs=113.0

Q ss_pred             CCCHHHHHHHHH-HHHCCCEEEEECCCCCHHHHHHHHH-HHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             874789999999-9967980999588998689999999-99997599949999160465699999999855888815999
Q gi|255764515|r    2 NLAPHQTKIVDW-ILDHKRCAIWASMGSGKTVSVLTAL-SYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         2 ~L~p~Q~~~v~~-~~~~~~~ll~~~~G~GKT~~al~~~-~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      +|+|+|.+++.. ++++++.+++.++|+|||+.|-.++ ..+.. ..++++.++|-..+.++=..+|.+|. ..+.++..
T Consensus        23 ~l~p~Q~e~l~~g~~~g~NllvsaPT~sGKTlvAElail~~~l~-~~~k~iyi~P~kALa~EK~~~f~~~~-~~g~~V~~  100 (717)
T PRK00254         23 ELYPPQAEALTSGVLEGKNLLIAIPTASGKTLIAEIAMVNKLLR-EGGKAVYLVPLKALAEEKFREFKDWE-VLGLRVAM  100 (717)
T ss_pred             CCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHH-CCCEEEEECCHHHHHHHHHHHHHHHH-HCCCEEEE
T ss_conf             26899999987423369818998998874899999999999985-29929999267999999999998777-44988989


Q ss_pred             EECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCC-CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             8589789888730779869980642023344200-011322044045310024654311567777665430598079965
Q gi|255764515|r   80 ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK-GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELT  158 (458)
Q Consensus        80 ~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~-~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LT  158 (458)
                      .+|+...... +...++++|+|+|.+..+.+... .....++||+||.|.+....  ++...=-.+.++. ...+.++||
T Consensus       101 ~tGd~~~~~~-~l~~~dIiV~T~Ek~dsl~r~~~~~l~~i~lvViDEiH~igD~~--RG~~lE~~l~~l~-~~~qiIgLS  176 (717)
T PRK00254        101 ATGDYDSKDE-WLGKYDIIIATAEKFDSLLRHGSSWIKDVKLLVADEIHLIGSRD--RGATLEFILTHML-GRAQIIGLS  176 (717)
T ss_pred             EECCCCCCCC-CCCCCCEEEECHHHHHHHHHCCHHHHHCCCEEEEECEEECCCCC--CHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             7489888701-04689999988899999997162565326989997607888987--4099999999510-036699996


Q ss_pred             CCCHHHHCCCHHHHHHHCC
Q ss_conf             8402310010134677517
Q gi|255764515|r  159 GTPSPNGLIDLWGQIWFLD  177 (458)
Q Consensus       159 gTPi~n~~~el~~ll~~l~  177 (458)
                      || ++| +.|+   ..||+
T Consensus       177 AT-i~N-~~~l---a~WL~  190 (717)
T PRK00254        177 AT-IGN-PEEL---AEWLN  190 (717)
T ss_pred             EE-CCC-HHHH---HHHHC
T ss_conf             33-499-8999---99828


No 32 
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional
Probab=99.95  E-value=5.3e-24  Score=163.62  Aligned_cols=310  Identities=15%  Similarity=0.205  Sum_probs=197.2

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC--------CCCCEEEEECCHHHHHHHHHHHHHHCCC
Q ss_conf             874789999999996798099958899868999-9999999975--------9994999916046569999999985588
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW--------GEKSVLVIAPLRVAQSVWTSEVQRWSNF   72 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~--------~~~~~LIv~P~~l~~~~W~~Ei~kf~~~   72 (458)
                      +.-|-|..++-.+++.+..++..++|+|||+.- |-++..+...        ....+||+||+.-+..|-.+++.++...
T Consensus        31 ~PTpIQ~~aIP~iL~GkDvi~~A~TGSGKTLAYlLPiL~~Ll~~~~l~~~~~~~p~aLILvPTRELA~QI~~~~~~l~~~  110 (574)
T PRK04537         31 RCTPIQALTLPVALPGGDVAGQAQTGTGKTLAFLVAVMNRLLSRPALADRKPEDPRALILAPTRELAIQIHKDAVKFGAD  110 (574)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHCC
T ss_conf             89999999999995799889984898889999999999999837443457789961999779899999999999998645


Q ss_pred             CCCEEEEEECCH--HHHHHHHCCCCCEEEECCCCHHHHHHH--CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             881599985897--898887307798699806420233442--0001132204404531002465431156777766543
Q gi|255764515|r   73 SHMNISVITGTV--KQRTKVLKTPAVLYVINFENLGWLVQE--LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA  148 (458)
Q Consensus        73 ~~~~~~~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~~~--~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~  148 (458)
                      ..+++.++.|..  ......+....+|+|.|...+......  ......-.++|+|||..|-+.+-  .......+..+.
T Consensus       111 ~~lr~~~l~GG~~~~~q~~~L~~g~dIVVaTPGRLld~L~~~~~~~L~~vk~LVLDEAD~LLd~gF--~~di~~IL~~lP  188 (574)
T PRK04537        111 LGLRFALVYGGVDYDKQRELLQQGVDVIIATPGRLIDYVKQHKVVSLHACEICVLDEADRMFDLGF--IKDIRFLLRRMP  188 (574)
T ss_pred             CCCEEEEEECCCCHHHHHHHHCCCCCEEEECHHHHHHHHHHCCCCCCCCEEEEEECCCHHHHCCCC--HHHHHHHHHHCC
T ss_conf             897799997996688999987359998998989999999817986533315899627326542877--999999999666


Q ss_pred             HC-CCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             05-98079965840231001013467751788877532778877736956403300002455554558999997424543
Q gi|255764515|r  149 WE-SERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCL  227 (458)
Q Consensus       149 ~~-~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~  227 (458)
                      .+ ....++.|||- ++...++                    ...+++...                           .+
T Consensus       189 ~~~~rQ~iLfSATl-~~~V~~l--------------------a~~~l~~P~---------------------------~i  220 (574)
T PRK04537        189 ERGTRQTLLFSATL-SHRVLEL--------------------AYEHMNEPE---------------------------KL  220 (574)
T ss_pred             CCCCCEEEEEEECC-CHHHHHH--------------------HHHHCCCCE---------------------------EE
T ss_conf             55685589998327-7799999--------------------999779986---------------------------99


Q ss_pred             HHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCC
Q ss_conf             32000010010011000345245368998889999998510334520223478888754203541000223430001343
Q gi|255764515|r  228 SLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDE  307 (458)
Q Consensus       228 ~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~  307 (458)
                      ......   ..... ....+..                                                     .....
T Consensus       221 ~v~~~~---~~~~~-I~Q~~~~-----------------------------------------------------~~~~~  243 (574)
T PRK04537        221 VVETET---ITAAR-VRQRIYF-----------------------------------------------------PSDEE  243 (574)
T ss_pred             EECCCC---CCCCC-EEEEEEE-----------------------------------------------------CCHHH
T ss_conf             965665---45776-0389997-----------------------------------------------------77789


Q ss_pred             CCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCC
Q ss_conf             33325665412488403422236788866410----------00265334458998764245885589984422111622
Q gi|255764515|r  308 KIKALEVIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN  377 (458)
Q Consensus       308 k~~~l~~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~Gln  377 (458)
                      |...|..++......++||||+.....+.+..          .++++.+..+|...++.|++++.+|||+| +.++=|||
T Consensus       244 K~~~L~~LL~~~~~~k~IIF~nT~~~ve~l~~~L~~~g~~v~~LHG~lsQ~eR~~~L~~Fk~G~~~VLVaT-DVAARGID  322 (574)
T PRK04537        244 KQTLLLGLLSRSEGARTMVFVNTKAFVERVARTLERHGYRVGVLSGDVPQKKRESLLNRFQKGQLEILVAT-DVAARGLH  322 (574)
T ss_pred             HHHHHHHHHHHCCCCCCEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEC-CCCCCCCC
T ss_conf             99999999972677651153341899999999999779968997099999999999999976999799773-50023357


Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECC
Q ss_conf             00178599990899898686445666620220203787752899998589
Q gi|255764515|r  378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN  427 (458)
Q Consensus       378 L~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~  427 (458)
                      +.. .++||+||+|.++..+.+++||..     |.|.+  =..+-|++++
T Consensus       323 Ip~-V~~VINYDlP~~~e~YVHRIGRTG-----RaGr~--G~AITfv~~~  364 (574)
T PRK04537        323 IDG-VKYVYNYDLPFDAEDYVHRIGRTA-----RLGEE--GDAISFACER  364 (574)
T ss_pred             CCC-CCEEEEECCCCCHHHHHCCCCHHH-----CCCCC--EEEEEEECHH
T ss_conf             146-997999579698214112453503-----78993--3599987779


No 33 
>PRK01172 ski2-like helicase; Provisional
Probab=99.95  E-value=1.6e-25  Score=172.87  Aligned_cols=167  Identities=17%  Similarity=0.191  Sum_probs=112.6

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             98747899999999967980999588998689999999999975999499991604656999999998558888159998
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      .+|+|||.+++..+.+.++.+++.++|+|||+.|-.++...... .++++.++|--.+.++...++.+|.. .+.++...
T Consensus        21 ~~l~p~Q~ea~~~~~~gkNllvsaPTgsGKTlvAe~ai~~~l~~-~~k~iyi~P~kAL~~EK~~~~~~~~~-~g~~v~~~   98 (674)
T PRK01172         21 FELYDHQRMAIEQLRKGENVIVSVPTAAGKTLIAYSAIYETFLA-GLKSIYIVPLRSLAMEKYEELSRLRS-LGMRVKIS   98 (674)
T ss_pred             CCCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHH-CCCEEEECCHHHHHHHHHHHHHHHHC-CCCEEEEE
T ss_conf             98898999999999779959997899986999999999999985-89799987789999999999998873-79827788


Q ss_pred             ECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCC-CCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH--HCCCEEEEE
Q ss_conf             5897898887307798699806420233442000-1132204404531002465431156777766543--059807996
Q gi|255764515|r   81 TGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG-TWPFATIVVDESTKLKSFRLRQGSKTARALAKPA--WESERFIEL  157 (458)
Q Consensus        81 ~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~-~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~--~~~~~~l~L  157 (458)
                      +|+...... ....++++|+|+|.+..+...... ....++||+||.|.+.+..  ++...--.+.++.  ....++++|
T Consensus        99 tGd~~~~~~-~~~~~~I~V~T~Ek~~sl~~~~~~~l~~v~~vViDEiH~i~d~~--RG~~lE~~l~kl~~l~~~~qiIgL  175 (674)
T PRK01172         99 IGDYDDPPD-FIKRYDVVILTSEKADSLIHHDPYIINDVGLIVADEIHIIGDED--RGPTLETVLSSARYVNPDARILAL  175 (674)
T ss_pred             ECCCCCCCC-CCCCCCEEEECHHHHHHHHHCCCHHHCCCCEEEEECCEECCCCC--CHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             538889801-02558999987899999986495022136989982652506877--249999999999853866079971


Q ss_pred             CCCCHHHHCCCHHHHHHHCC
Q ss_conf             58402310010134677517
Q gi|255764515|r  158 TGTPSPNGLIDLWGQIWFLD  177 (458)
Q Consensus       158 TgTPi~n~~~el~~ll~~l~  177 (458)
                      ||| ++ ++.|+   ..||+
T Consensus       176 SAT-i~-N~~~l---a~WL~  190 (674)
T PRK01172        176 SAT-VS-NANEL---AQWLN  190 (674)
T ss_pred             CCC-CC-CHHHH---HHHHC
T ss_conf             578-68-99999---98838


No 34 
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional
Probab=99.94  E-value=7.5e-26  Score=174.85  Aligned_cols=350  Identities=15%  Similarity=0.139  Sum_probs=178.0

Q ss_pred             CCCCHHHHHHHHHHH-----HCCCEEEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             987478999999999-----679809995889986899999999999759-99499991604656999999998558888
Q gi|255764515|r    1 MNLAPHQTKIVDWIL-----DHKRCAIWASMGSGKTVSVLTALSYIHLWG-EKSVLVIAPLRVAQSVWTSEVQRWSNFSH   74 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~-----~~~~~ll~~~~G~GKT~~al~~~~~l~~~~-~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~   74 (458)
                      +-|||||.+|+..+.     +++++||++.+|+|||.+|++++..|...+ .+++|-+|=.+.+..|=..+|..+...+.
T Consensus       415 i~lR~YQ~~AI~~v~~a~~~~~rraLl~MATGTGKTrtaial~~rLlk~~~~kRILFLvDR~~L~~QA~~~F~~~~~~~~  494 (1126)
T PRK11448        415 LGLRYYQEDAIQAVEKALANGQREILLAMATGTGKTRTAIALMYRLLKAKRFKRILFLVDRRALGEQALDAFKDTKIEGN  494 (1126)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCC
T ss_conf             77868899999999999980985468872488858989999999999658767257985658999999998754345456


Q ss_pred             CEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHH-----HCCCCCCCCEEECCCCCCCCCCC------------CCCH
Q ss_conf             159998589789888730779869980642023344-----20001132204404531002465------------4311
Q gi|255764515|r   75 MNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQ-----ELKGTWPFATIVVDESTKLKSFR------------LRQG  137 (458)
Q Consensus        75 ~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~-----~~~~~~~~~~iIiDEaH~lkn~~------------~~~~  137 (458)
                      ..+.-+.+..............|++.||+++.....     .......||+||+||||+=-+..            -...
T Consensus       495 ~~~~~~~~v~~l~~~~~~~~~rv~isT~q~m~~~i~~~~~~~~~~~~~FDlIIiDEaHRgy~ld~em~e~e~~~rd~~s~  574 (1126)
T PRK11448        495 QTFASIYDIKGLTDKFPEDETKVHVATVQSMVKRILQSDDSEPPPVGQYDCIVVDEAHRGYTLDKEMTEGELQFRDQLDY  574 (1126)
T ss_pred             CCCCHHHHHHHCCCCCCCCCCEEEEECHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHCCCCHHHH
T ss_conf             66400220010256787877719997307899875235767799998513798977878874332311000102320247


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             56777766543059807996584023100101346775178887753277887773695640330000245555455899
Q gi|255764515|r  138 SKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKE  217 (458)
Q Consensus       138 s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~  217 (458)
                      -...+.+.....  -..++|||||-.| --++|+        .+.  +-+++..-..+..-..... .+..         
T Consensus       575 ~skyr~IldYFD--A~~iGLTATP~~~-T~~~Fg--------~P~--~~Ys~~eAV~DG~LVd~~~-P~~i---------  631 (1126)
T PRK11448        575 VSKYRRVLDYFD--AVKIGLTATPALH-TTEIFG--------EPV--YTYSYREAVIDGYLIDHEP-PIRI---------  631 (1126)
T ss_pred             HHHHHHHHHHHH--HHHHCCCCCCCCC-HHHHHC--------CCC--EEECHHHHHCCCCCCCCCC-CEEE---------
T ss_conf             778999987621--5540476799955-567709--------973--0005888730475568868-8799---------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHH-HHCCCC-CCHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             999742454332000010010011000345245368998889999998-510334-520223478888754203541000
Q gi|255764515|r  218 IEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELY-CDLQGE-NIEAFNSASKTVKCLQLANGAVYY  295 (458)
Q Consensus       218 l~~~l~~~~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~-~~~~~~-~~~~~~~~~~~~~l~q~~~~~~~~  295 (458)
                       ...+....+...                   ..++...++......- ..+.+. ....    ....+  .+.+     
T Consensus       632 -~T~l~~~Gi~~~-------------------~~e~~~~~~~~~~~~~~~~~~de~~~~~----~~fnr--~v~~-----  680 (1126)
T PRK11448        632 -ETKLAKEGIHFE-------------------KGEQVEVINTQTGEIDNDTLEDELDFEV----EDFNR--RVIT-----  680 (1126)
T ss_pred             -EEEEECCCCCCC-------------------CCCHHHHCCCHHHHHHCCCCCCCCCCCH----HHHCC--HHCC-----
T ss_conf             -756510460358-------------------7643442030000020255873133788----88273--2038-----


Q ss_pred             CCCCCCHHCCCCCCCCHHHHHHCCCCCEEEEHHHHHHHHH----HHHHCCCC--------------CCCHHHHHHHHHHH
Q ss_conf             2234300013433332566541248840342223678886----64100026--------------53344589987642
Q gi|255764515|r  296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLA----RLQKAFPQ--------------GRTLDKDPCTIQEW  357 (458)
Q Consensus       296 ~~~~~~~~~~~~k~~~l~~il~~~~~~kviif~~~~~~~~----~i~~~~~~--------------g~~~~~r~~~i~~f  357 (458)
                       +     .....-++.+.+-+......|-||||......+    .+.+.|..              +. .+.-...|+.|
T Consensus       681 -~-----~~nr~v~~~l~~~~~~~~~gKTiIFA~~~~HAd~Iv~~l~e~F~~~y~~~~~~~~~~It~~-~~~~~~lI~~F  753 (1126)
T PRK11448        681 -E-----SFNRVVCEELAKYLDPTGEGKTLIFCVTDAHADMVVRLLKEAFKKKYGQVEDDAIIKITGD-ADKVQQLIRRF  753 (1126)
T ss_pred             -H-----HHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECC-CCCHHHHHHHH
T ss_conf             -3-----4799999999984588999876999278699999999999998864787678448997088-84478999972


Q ss_pred             CCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCC
Q ss_conf             45885589984422111622001785999908998986864456666202202037
Q gi|255764515|r  358 NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG  413 (458)
Q Consensus       358 ~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~G  413 (458)
                      ++.+.+.+.+|.+-..+|++....+| +||+=+.-|...++|.+||..|.+-+ +|
T Consensus       754 kn~~~P~IAVTVDmL~TGiDVPei~n-LVF~R~V~S~i~F~QMiGRGTRlc~~-i~  807 (1126)
T PRK11448        754 KNERLPNIVVTVDLLTTGIDVPSICN-LVFLRRVKSRILYEQMKGRATRLCPD-IG  807 (1126)
T ss_pred             CCCCCCEEEEEECCCCCCCCCCCCEE-EEEEEECCCHHHHHHHHCCCCCCCCC-CC
T ss_conf             57899838998562104766642016-88766756677866541675543766-68


No 35 
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional
Probab=99.94  E-value=4.8e-23  Score=157.83  Aligned_cols=320  Identities=17%  Similarity=0.264  Sum_probs=197.9

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC--------CCCCEEEEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             74789999999996798099958899868999-9999999975--------99949999160465699999999855888
Q gi|255764515|r    3 LAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW--------GEKSVLVIAPLRVAQSVWTSEVQRWSNFS   73 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~--------~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~   73 (458)
                      .-|-|..++-.+++++..++..++|+|||+.- |-++..+...        +..++|||||+.-+..|-.+++..+....
T Consensus       107 PTpIQ~~aIP~iL~GkDvi~~A~TGSGKTlAyLLPil~~ll~~~~~~~~~~~~p~aLIL~PTRELa~QI~~~~~~L~~~~  186 (472)
T PRK01297        107 CTPIQAQVLGYTLAGHDAIGRAQTGTGKTAAFLISIINQLLQTPPPKERYMGEPRALIIAPTRELVVQIAKDAAALTKYT  186 (472)
T ss_pred             CCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCHHCCCCCCEEEEECCCHHHHHHHHHHHHHHHCCC
T ss_conf             99999999999976998899899986799999999999997177510113689529998799999999999999974627


Q ss_pred             CCEEEEEECCH--HHHHHHHC-CCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             81599985897--89888730-77986998064202334420-0011322044045310024654311567777665430
Q gi|255764515|r   74 HMNISVITGTV--KQRTKVLK-TPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        74 ~~~~~~~~g~~--~~r~~~~~-~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                      .+++..+.|..  ....+.+. ...+|+|.|...+..+.... .....-..+|+|||+++-+.+-.  ....+.+..+..
T Consensus       187 ~l~v~~~~GG~~~~~q~~~l~~~~~dIvVaTPGRL~~l~~~~~~~l~~v~~lVlDEAD~LLd~gf~--~~v~~Il~~~p~  264 (472)
T PRK01297        187 GLNVMTFVGGMDFDKQLKQLEARFCDILVATPGRLLDFNQRGEVHLDMVEVMVLDEADRMLDMGFI--PQVRQIIRQTPR  264 (472)
T ss_pred             CCEEEEEECCCCHHHHHHHHHCCCCCEEEECHHHHHHHHCCCCEECCCCEEEEEECHHHHHCCCCH--HHHHHHHHHCCC
T ss_conf             976999978988799999985589988997979999874348254255229999873121025759--999999996898


Q ss_pred             CC-CEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             59-80799658402310010134677517888775327788777369564033000024555545589999974245433
Q gi|255764515|r  150 ES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLS  228 (458)
Q Consensus       150 ~~-~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~  228 (458)
                      +. ...++.|||-- ....+                    +...|....                           ..+.
T Consensus       265 ~~~rQ~~lfSATl~-~~v~~--------------------l~~~~~~~p---------------------------~~v~  296 (472)
T PRK01297        265 KEERQTLLFSATFT-DDVMN--------------------LAKQWTTDP---------------------------AIVE  296 (472)
T ss_pred             CCCCEEEEEECCCC-HHHHH--------------------HHHHHCCCC---------------------------EEEE
T ss_conf             55716999852577-89999--------------------999977998---------------------------8999


Q ss_pred             HHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCC
Q ss_conf             20000100100110003452453689988899999985103345202234788887542035410002234300013433
Q gi|255764515|r  229 LDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEK  308 (458)
Q Consensus       229 ~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k  308 (458)
                      ......   ....+. ..+..                                                     .....|
T Consensus       297 i~~~~~---~~~~v~-q~~~~-----------------------------------------------------~~~~dk  319 (472)
T PRK01297        297 IEPENV---ASDTVE-QHVYA-----------------------------------------------------VAGSDK  319 (472)
T ss_pred             ECCCCC---CCCCEE-EEEEE-----------------------------------------------------CCHHHH
T ss_conf             657766---777602-89998-----------------------------------------------------188899


Q ss_pred             CCCHHHHHHCCCCCEEEEHHHHHHHHHHHHHC----------CCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCC
Q ss_conf             33256654124884034222367888664100----------02653344589987642458855899844221116220
Q gi|255764515|r  309 IKALEVIIEKANAAPIIVAYHFNSDLARLQKA----------FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNL  378 (458)
Q Consensus       309 ~~~l~~il~~~~~~kviif~~~~~~~~~i~~~----------~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL  378 (458)
                      ...|.+++......++||||+.....+.+...          ++++.+..+|...++.|++|+.+|||+| +.++=|||+
T Consensus       320 ~~~L~~ll~~~~~~k~IIF~nt~~~~~~l~~~L~~~g~~~~~lhg~l~q~~R~~~l~~F~~g~~~iLVaT-DvaaRGLDi  398 (472)
T PRK01297        320 YKLLYNLVTQNPWERVMVFANRKDEVRRIEERLVKDGINAAQLSGDVPQHKRIKTLEGFREGKIRVLVAT-DVAGRGIHI  398 (472)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEC-CHHHCCCCC
T ss_conf             9999999984798736896174999999998765449616864377899999999999976999699886-613366775


Q ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             01785999908998986864456666202202037877528999985899689999999999
Q gi|255764515|r  379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       379 ~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
                      . ..++||+||+|-++..+.+|+||..     |.|++-  .++-|++++  |..++..++..
T Consensus       399 ~-~V~~VInyD~P~~~~~YIHRiGRTG-----RaG~~G--~aisfv~~~--d~~~~~~ie~~  450 (472)
T PRK01297        399 D-GISHVINFTLPEDPDDYVHRIGRTG-----RAGASG--VSISFAGED--DAFQLPEIEEL  450 (472)
T ss_pred             C-CCCEEEEECCCCCHHHHHHCCCHHH-----CCCCCE--EEEEEECHH--HHHHHHHHHHH
T ss_conf             7-8888999689897676010265312-----689963--799986388--99999999999


No 36 
>PRK02362 ski2-like helicase; Provisional
Probab=99.94  E-value=1.1e-23  Score=161.79  Aligned_cols=165  Identities=24%  Similarity=0.226  Sum_probs=110.9

Q ss_pred             CCCHHHHHHHHH-HHHCCCEEEEECCCCCHHHHHH-HHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             874789999999-9967980999588998689999-99999997599949999160465699999999855888815999
Q gi|255764515|r    2 NLAPHQTKIVDW-ILDHKRCAIWASMGSGKTVSVL-TALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         2 ~L~p~Q~~~v~~-~~~~~~~ll~~~~G~GKT~~al-~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      +|+|+|.+++.. ++++++.+++.++|+|||+.|- +++..+ ..+ ++++.++|--.+.++=..++.+|.+ .++++..
T Consensus        23 ~Lyp~Q~eal~~gl~~g~NlvvsaPTgsGKTlvAElail~~l-~~g-~k~vYi~P~kALa~EK~~~~~~~~~-~gi~V~~   99 (736)
T PRK02362         23 ELYPPQAEAVEAGLLEGKNLLAAIPTASGKTLLAELAMLKAI-AEG-GKALYIVPLRALASEKFEEFSEFSE-LGLRVGI   99 (736)
T ss_pred             CCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHH-HHC-CEEEEECCHHHHHHHHHHHHHHHHC-CCCEEEE
T ss_conf             578999999986435698189979999858999999999999-839-9799985879999999999998745-7998999


Q ss_pred             EECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCC-CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH--CCCEEEE
Q ss_conf             8589789888730779869980642023344200-011322044045310024654311567777665430--5980799
Q gi|255764515|r   80 ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK-GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW--ESERFIE  156 (458)
Q Consensus        80 ~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~-~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~--~~~~~l~  156 (458)
                      .+|+...+... ...++++|+|+|.+..+.+... .....++||+||.|.+....  ++...=-.+.++..  ...++++
T Consensus       100 ~tGd~~~~~~~-l~~~dIiV~T~EK~dsl~r~~~~~l~~v~lVViDEiHli~d~~--RG~~lE~~lskl~~~~~~iqiIg  176 (736)
T PRK02362        100 STGDYDRRDEY-LGRNDIIVATSEKTDSLLRNGAPWIDDISCVVADEVHLIDSPN--RGPTLEVTLAKLRRLNPDMQVIA  176 (736)
T ss_pred             EECCCCCCHHH-CCCCCEEEECHHHHHHHHHCCCHHHHCCCEEEEECCEEECCCC--CHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             80898878314-3689999999799999984481676508989981767866887--24999999999973387743898


Q ss_pred             ECCCCHHHHCCCHHHHHHHCC
Q ss_conf             658402310010134677517
Q gi|255764515|r  157 LTGTPSPNGLIDLWGQIWFLD  177 (458)
Q Consensus       157 LTgTPi~n~~~el~~ll~~l~  177 (458)
                      |||| ++ ++.|   +..||+
T Consensus       177 LSAT-l~-N~~~---la~WL~  192 (736)
T PRK02362        177 LSAT-IG-NADE---LAAWLD  192 (736)
T ss_pred             EECC-CC-CHHH---HHHHHC
T ss_conf             6245-58-9999---999838


No 37 
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional
Probab=99.94  E-value=4.3e-23  Score=158.13  Aligned_cols=309  Identities=16%  Similarity=0.185  Sum_probs=193.2

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCC--------CCCEEEEECCHHHHHHHHHHHHHHCCC
Q ss_conf             874789999999996798099958899868999-99999999759--------994999916046569999999985588
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLWG--------EKSVLVIAPLRVAQSVWTSEVQRWSNF   72 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~--------~~~~LIv~P~~l~~~~W~~Ei~kf~~~   72 (458)
                      +.-|-|..++-.+++.+..++.+++|+|||+.= +.++..+....        ...+||+||+.-+..|-.+++..+...
T Consensus        31 ~pTpIQ~~aIP~il~G~Dvi~~A~TGSGKTlAfllPil~~ll~~~~~~~~~~~~p~aLIL~PTRELa~Qi~~~~~~l~~~  110 (423)
T PRK04837         31 YCTPIQALALPLTLAGRDVAGQAQTGTGKTMAFLTATFHHLLSHPAPEGRKVNQPRALIMAPTRELAVQIHADAEPLAQA  110 (423)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHCC
T ss_conf             99999999999996799889989998749999999999999837453345567861899938899999999999997432


Q ss_pred             CCCEEEEEECCH--HHHHHHHCCCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             881599985897--8988873077986998064202334420-0011322044045310024654311567777665430
Q gi|255764515|r   73 SHMNISVITGTV--KQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        73 ~~~~~~~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                      ..+++..+.|..  ......+....+|+|.|...+....+.. ........+|+|||+++-+.+-   ..-.+.+.+...
T Consensus       111 ~~l~~~~~~GG~~~~~q~~~l~~~~dIlV~TPgRL~d~~~~~~~~l~~i~~lVlDEAD~lld~gF---~~~i~~i~~~~p  187 (423)
T PRK04837        111 TGLKLGLAYGGEGYDKQLKVLESGVDILIGTTGRLIDYAKQNHINLGAIQVVVLDEADRMFDLGF---IKDIRWLFRRMP  187 (423)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHCCCCEEEECHHHHHHHHHHCCCCCCCCEEEEEECHHHHHHCCC---HHHHHHHHHHCC
T ss_conf             58459999899887999998717999899891899999864221236642899634465430263---999999999689


Q ss_pred             CCCE--EEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5980--79965840231001013467751788877532778877736956403300002455554558999997424543
Q gi|255764515|r  150 ESER--FIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCL  227 (458)
Q Consensus       150 ~~~~--~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~  227 (458)
                      ..+.  .++.|||- +..+.++                    ...+....                           ..+
T Consensus       188 ~~~~r~~~lfSATl-~~~v~~l--------------------a~~~l~~p---------------------------~~i  219 (423)
T PRK04837        188 PANQRLNMLFSATL-SYRVREL--------------------AFEHMNNP---------------------------EYV  219 (423)
T ss_pred             CCHHEEEEEEECCC-CHHHHHH--------------------HHHHCCCC---------------------------EEE
T ss_conf             62210899970368-8899999--------------------99977898---------------------------799


Q ss_pred             HHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCC
Q ss_conf             32000010010011000345245368998889999998510334520223478888754203541000223430001343
Q gi|255764515|r  228 SLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDE  307 (458)
Q Consensus       228 ~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~  307 (458)
                      ..  .........  ....+-.                                                     .....
T Consensus       220 ~v--~~~~~~~~~--i~~~~~~-----------------------------------------------------~~~~~  242 (423)
T PRK04837        220 EV--EPEQKTGHR--IKEELFY-----------------------------------------------------PSNEE  242 (423)
T ss_pred             EE--CCCCCCCCC--EEEEEEE-----------------------------------------------------ECHHH
T ss_conf             96--577656654--2699999-----------------------------------------------------17277


Q ss_pred             CCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCC
Q ss_conf             33325665412488403422236788866410----------00265334458998764245885589984422111622
Q gi|255764515|r  308 KIKALEVIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN  377 (458)
Q Consensus       308 k~~~l~~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~Gln  377 (458)
                      |+..|..++++....++||||+.....+.+..          .++++.+..+|...++.|++|+.+|||+| +.++=|||
T Consensus       243 K~~~L~~ll~~~~~~k~iIF~nt~~~~~~l~~~L~~~g~~~~~lhg~~~q~~R~~~l~~F~~g~~~vLVaT-DvaaRGLD  321 (423)
T PRK04837        243 KMRLLQTLIEEEWPDRAIIFANTKHRCEEIWGHLAADGHRVGLLTGDVPQKKRLRILEQFTRGDLDILVAT-DVAARGLH  321 (423)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCCCEEEEH-HHHHCCCC
T ss_conf             99999999984088746886162888999999997659817872254579999999999976999899870-04327777


Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECC
Q ss_conf             00178599990899898686445666620220203787752899998589
Q gi|255764515|r  378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN  427 (458)
Q Consensus       378 L~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~  427 (458)
                      ++. .++||+||+|-++..+..|+||..     |.|.+  -..+-|++++
T Consensus       322 i~~-V~~VInyD~P~~~~~YiHRiGRTg-----RaG~~--G~aitf~~~~  363 (423)
T PRK04837        322 IPD-VTHVFNYDLPDDCEDYVHRIGRTG-----RAGAS--GHSISFACEE  363 (423)
T ss_pred             CCC-CCEEEEECCCCCHHHEECCCCHHH-----CCCCC--EEEEEEECHH
T ss_conf             267-988999699897455100465412-----78994--6899987399


No 38 
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional
Probab=99.93  E-value=3.6e-23  Score=158.60  Aligned_cols=308  Identities=17%  Similarity=0.214  Sum_probs=192.2

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHHCC-CCCCEEE
Q ss_conf             874789999999996798099958899868999-9999999975-999499991604656999999998558-8881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW-GEKSVLVIAPLRVAQSVWTSEVQRWSN-FSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~-~~~~~LIv~P~~l~~~~W~~Ei~kf~~-~~~~~~~   78 (458)
                      +.-|-|..++-.+++.+..++.+++|+|||+.= |-++..+... ....+|||||+.-+..|-.+++..+.. .+.+.+.
T Consensus        28 ~PTpIQ~~aIP~iL~GkDvi~~AqTGSGKTlAFlLPiL~~l~~~~~~pqaLIL~PTRELA~QV~~~~~~l~~~~~~i~v~  107 (629)
T PRK11634         28 KPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFSLPLLHNLDPELKAPQILVLAPTRELAVQVAEAMTDFSKHMRGVNVV  107 (629)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99999999999996799889978884789999999999986623689868997899899999999999997217997799


Q ss_pred             EEECCHH--HHHHHHCCCCCEEEECCCCHHHHHHH-CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             9858978--98887307798699806420233442-00011322044045310024654311567777665430598079
Q gi|255764515|r   79 VITGTVK--QRTKVLKTPAVLYVINFENLGWLVQE-LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFI  155 (458)
Q Consensus        79 ~~~g~~~--~r~~~~~~~~~i~i~s~e~~~~~~~~-~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l  155 (458)
                      .+.|...  .-...+....+|+|.|...+..+.+. ........++|+|||..+-+.+-.   .-...+..........+
T Consensus       108 ~l~GG~~~~~q~~~L~~g~~IVVgTPGRL~d~l~~~~l~L~~l~~lVLDEAD~mL~~gF~---~di~~Il~~lp~~~Qt~  184 (629)
T PRK11634        108 ALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLDLSKLSGLVLDEADEMLRMGFI---EDVETIMAQIPEGHQTA  184 (629)
T ss_pred             EEECCCCHHHHHHHHCCCCCEEEECHHHHHHHHHCCCCCHHHCCEEEEECHHHHCCCCCH---HHHHHHHHHCCCCCEEE
T ss_conf             998997789999986279999996989999999729641200767898671553363659---99999998674031446


Q ss_pred             EECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             96584023100101346775178887753277887773695640330000245555455899999742454332000010
Q gi|255764515|r  156 ELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ  235 (458)
Q Consensus       156 ~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~  235 (458)
                      +.|||. +..+                    ..+...|.....                           .+.+... . 
T Consensus       185 LfSATm-p~~i--------------------~~la~~~l~~P~---------------------------~i~i~~~-~-  214 (629)
T PRK11634        185 LFSATM-PEAI--------------------RRITRRFMKEPQ---------------------------EVRIQSS-V-  214 (629)
T ss_pred             EEECCC-CHHH--------------------HHHHHHHCCCCE---------------------------EEEECCC-C-
T ss_conf             663146-5999--------------------999998756987---------------------------9740455-5-


Q ss_pred             CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHH
Q ss_conf             01001100034524536899888999999851033452022347888875420354100022343000134333325665
Q gi|255764515|r  236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI  315 (458)
Q Consensus       236 ~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~i  315 (458)
                       ...+.+.....                                                      ......|.++|..+
T Consensus       215 -~t~~~i~q~~~------------------------------------------------------~v~~~~K~~aL~~~  239 (629)
T PRK11634        215 -TTRPDISQSYW------------------------------------------------------TVWGMRKNEALVRF  239 (629)
T ss_pred             -CCCCCCEEEEE------------------------------------------------------EECCHHHHHHHHHH
T ss_conf             -55776305999------------------------------------------------------96524579999999


Q ss_pred             HHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEE
Q ss_conf             412488403422236788866410----------0026533445899876424588558998442211162200178599
Q gi|255764515|r  316 IEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNIL  385 (458)
Q Consensus       316 l~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~i  385 (458)
                      ++.....++||||+.......+..          .++++.+..+|..+++.|++|+.+|||+| ++++=|||+.. .++|
T Consensus       240 L~~~~~~~~IIF~~Tk~~~~~l~~~L~~~g~~~~~LHgdm~q~~R~~~l~~Fr~g~~~ILVaT-DvaARGLDi~~-V~~V  317 (629)
T PRK11634        240 LEAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLKDGRLDILIAT-DVAARGLDVER-ISLV  317 (629)
T ss_pred             HHHCCCCEEEEEEECHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEC-CCCCCCCCCCC-CCEE
T ss_conf             861588848999822788999999999769965765689999999999999975999889878-62105577256-8889


Q ss_pred             EEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEEC
Q ss_conf             99089989868644566662022020378775289999858
Q gi|255764515|r  386 VFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQ  426 (458)
Q Consensus       386 I~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~  426 (458)
                      |+||+|.++..+..++||.-     |.|.+  =..+-||++
T Consensus       318 INyDlP~d~e~YVHRiGRTG-----RaGr~--G~Aitfv~~  351 (629)
T PRK11634        318 VNYDIPMDSESYVHRIGRTG-----RAGRA--GRALLFVEN  351 (629)
T ss_pred             EEECCCCCHHHCCCCCCCCC-----CCCCC--EEEEEEECH
T ss_conf             99689897434010258331-----68996--469998888


No 39 
>COG1201 Lhr Lhr-like helicases [General function prediction only]
Probab=99.93  E-value=7.6e-23  Score=156.62  Aligned_cols=318  Identities=19%  Similarity=0.207  Sum_probs=193.3

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCC--C----CCEEEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             874789999999996798099958899868999-99999999759--9----9499991604656999999998558888
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLWG--E----KSVLVIAPLRVAQSVWTSEVQRWSNFSH   74 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~--~----~~~LIv~P~~l~~~~W~~Ei~kf~~~~~   74 (458)
                      ++.|+|..|+..+.+..+.|+.+++|+|||..| +.++..+...+  .    =.+|.|+|-..+-+--..-++.|...-+
T Consensus        22 ~~t~~Q~~a~~~i~~G~nvLiiAPTGsGKTeAAfLpil~~l~~~~~~~~~~~i~~lYIsPLkALn~Di~~rL~~~~~~~G  101 (814)
T COG1201          22 SLTPPQRYAIPEIHSGENVLIIAPTGSGKTEAAFLPVINELLSLGKGKLEDGIYALYISPLKALNNDIRRRLEEPLRELG  101 (814)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCC
T ss_conf             99878999999985898469986899973799999999999860688888856999957078887899999999999759


Q ss_pred             CEEEEEECCH--HHHHHHHCCCCCEEEECCCCHHHHH-----HHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             1599985897--8988873077986998064202334-----42000113220440453100246543115677776654
Q gi|255764515|r   75 MNISVITGTV--KQRTKVLKTPAVLYVINFENLGWLV-----QELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKP  147 (458)
Q Consensus        75 ~~~~~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~-----~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~  147 (458)
                      +.+.+-+|+.  .+|........+|++||.|++.-+.     ...+...  ..||+||.|.+.+  ++++++.+-.+.++
T Consensus       102 ~~v~vRhGDT~~~er~r~~~~PPdILiTTPEsL~lll~~~~~r~~l~~v--r~VIVDEiHel~~--sKRG~~Lsl~LeRL  177 (814)
T COG1201         102 IEVAVRHGDTPQSEKQKMLKNPPHILITTPESLAILLNSPKFRELLRDV--RYVIVDEIHALAE--SKRGVQLALSLERL  177 (814)
T ss_pred             CCCCEECCCCCHHHHHHCCCCCCCEEEECHHHHHHHHCCHHHHHHHCCC--CEEEEEHHHHHHC--CCCCHHHHHHHHHH
T ss_conf             8444422878867763046999968995834899983688899986078--0999512545434--56531343329999


Q ss_pred             HHCC--CEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3059--80799658402310010134677517888775327788777369564033000024555545589999974245
Q gi|255764515|r  148 AWES--ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDC  225 (458)
Q Consensus       148 ~~~~--~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~  225 (458)
                      ..-+  ..+++||||=-  .|.+   ..+||.+.                  ..                       ...
T Consensus       178 ~~l~~~~qRIGLSATV~--~~~~---varfL~g~------------------~~-----------------------~~~  211 (814)
T COG1201         178 RELAGDFQRIGLSATVG--PPEE---VAKFLVGF------------------GD-----------------------PCE  211 (814)
T ss_pred             HHHCCCCEEEEEHHCCC--CHHH---HHHHHCCC------------------CC-----------------------CEE
T ss_conf             85175537975402158--8899---99985478------------------98-----------------------429


Q ss_pred             HHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCC
Q ss_conf             43320000100100110003452453689988899999985103345202234788887542035410002234300013
Q gi|255764515|r  226 CLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVH  305 (458)
Q Consensus       226 ~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~  305 (458)
                      +.....      ..+..+...++-.  ......                                            ...
T Consensus       212 Iv~~~~------~k~~~i~v~~p~~--~~~~~~--------------------------------------------~~~  239 (814)
T COG1201         212 IVDVSA------AKKLEIKVISPVE--DLIYDE--------------------------------------------ELW  239 (814)
T ss_pred             EEECCC------CCCCEEEEEECCC--CCCCCC--------------------------------------------CHH
T ss_conf             997456------7753179980477--500026--------------------------------------------246


Q ss_pred             CCCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHHCC-----------CCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCC
Q ss_conf             433332566541248840342223678886641000-----------265334458998764245885589984422111
Q gi|255764515|r  306 DEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAF-----------PQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH  374 (458)
Q Consensus       306 ~~k~~~l~~il~~~~~~kviif~~~~~~~~~i~~~~-----------~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~  374 (458)
                      ...++.+.+++++..  ..+||+|.....+.+...+           ++..+.+.|..+-++|.+|+.++++|| .+...
T Consensus       240 ~~~~~~i~~~v~~~~--ttLIF~NTR~~aE~l~~~L~~~~~~~i~~HHgSlSre~R~~vE~~lk~G~lravV~T-SSLEL  316 (814)
T COG1201         240 AALYERIAELVKKHR--TTLIFTNTRSGAERLAFRLKKLGPDIIEVHHGSLSRELRLEVEERLKEGELKAVVAT-SSLEL  316 (814)
T ss_pred             HHHHHHHHHHHHHCC--CEEEEEECHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEEEEC-CCHHH
T ss_conf             789999999996168--589997272789999999987268755653166657789999999866886299980-64220


Q ss_pred             CCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHH
Q ss_conf             62200178599990899898686445666620220203787752899998589968999
Q gi|255764515|r  375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV  433 (458)
Q Consensus       375 GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i  433 (458)
                      |||.- .-+.||++..|-+.+.+.|++||.-    ||.|....   .++++.+ .|+.+
T Consensus       317 GIDiG-~vdlVIq~~SP~sV~r~lQRiGRsg----Hr~~~~Sk---g~ii~~~-r~dll  366 (814)
T COG1201         317 GIDIG-DIDLVIQLGSPKSVNRFLQRIGRAG----HRLGEVSK---GIIIAED-RDDLL  366 (814)
T ss_pred             CCCCC-CCEEEEEECCCHHHHHHHHHCCCCC----CCCCCCCC---EEEEECC-HHHHH
T ss_conf             50247-7429998179388888868503146----65688642---7998167-99999


No 40 
>PTZ00110 helicase; Provisional
Probab=99.93  E-value=4.7e-22  Score=151.82  Aligned_cols=309  Identities=18%  Similarity=0.240  Sum_probs=193.3

Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCHHHH-HHHHHHHHHHCC-----C-CCEEEEECCHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             478999999999679809995889986899-999999999759-----9-949999160465699999999855888815
Q gi|255764515|r    4 APHQTKIVDWILDHKRCAIWASMGSGKTVS-VLTALSYIHLWG-----E-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMN   76 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~-al~~~~~l~~~~-----~-~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~   76 (458)
                      -|-|.+++=-++..+..+-.+++|+|||+. .|-++.++..+.     . ..+||+||+.-+..|-.+|+.+|.....++
T Consensus       206 TPIQ~qaIPiaLsGrDvIgiAqTGSGKTLAFlLP~l~hi~~q~~~~~~~gP~aLILaPTRELA~QI~~e~~~~~~~~~ir  285 (602)
T PTZ00110        206 TPIQVQGWPIALSGRDMIGIAETGSGKTLAFLLPAIVHINAQPLLRPGDGPIVLVLAPTRELAEQIREQALQFGRSSKLK  285 (602)
T ss_pred             CHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             98999998798569867998789788999999999999851634367899769997383999999999999971547854


Q ss_pred             EEEEECC-HH-HHHHHHCCCCCEEEECCCCHHHHHHH-CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCE
Q ss_conf             9998589-78-98887307798699806420233442-000113220440453100246543115677776654305980
Q gi|255764515|r   77 ISVITGT-VK-QRTKVLKTPAVLYVINFENLGWLVQE-LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESER  153 (458)
Q Consensus        77 ~~~~~g~-~~-~r~~~~~~~~~i~i~s~e~~~~~~~~-~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~  153 (458)
                      +..+.|. +. .-...+....+|+|.|...+-.+.+. ......-..+|+|||-+|-+.+-   ..-.+.|.......+.
T Consensus       286 ~~~i~GG~~~~~Q~~~L~~G~dIvVATPGRLiDlL~~~~~~L~~v~yLVLDEADRMLDmGF---e~qI~~Il~~i~pdRQ  362 (602)
T PTZ00110        286 NSVAYGGVPKRFQTYALRRGVEILIACPGRLIDFLESNVTNLRRVTYLVLDEADRMLDMGF---EPQIRKIVSQIRPDRQ  362 (602)
T ss_pred             EEEEECCCCHHHHHHHHCCCCCEEEECCHHHHHHHHCCCCCCCCEEEEEEECHHHHHCCCC---HHHHHHHHHHCCCCCE
T ss_conf             9999799687999998716999999792389999964998743102899875776635462---9999999985897877


Q ss_pred             EEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             79965840231001013467751788877532778877736956403300002455554558999997424543320000
Q gi|255764515|r  154 FIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD  233 (458)
Q Consensus       154 ~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~  233 (458)
                      .++.|||- +..+.+                    +...++...                          +..+.+...+
T Consensus       363 TlLFSAT~-p~~V~~--------------------LA~~~L~~~--------------------------Pv~I~Vg~~~  395 (602)
T PTZ00110        363 TLMWSATW-PKEVQS--------------------LARDLCKEE--------------------------PVHVNVGSLD  395 (602)
T ss_pred             EEEEECCC-CHHHHH--------------------HHHHHHCCC--------------------------CEEEEECCCC
T ss_conf             99995589-989999--------------------999982069--------------------------8899936888


Q ss_pred             CCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHH
Q ss_conf             10010011000345245368998889999998510334520223478888754203541000223430001343333256
Q gi|255764515|r  234 YQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE  313 (458)
Q Consensus       234 ~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~  313 (458)
                         +....-+...+...                                                     ....|...|.
T Consensus       396 ---~~a~~~I~Q~v~vv-----------------------------------------------------~~~eK~~~L~  419 (602)
T PTZ00110        396 ---LTTCHNIKQEVFVI-----------------------------------------------------EEHEKRAKLK  419 (602)
T ss_pred             ---CCCCCCCEEEEEEE-----------------------------------------------------CHHHHHHHHH
T ss_conf             ---77778705899996-----------------------------------------------------5188999999


Q ss_pred             HHHHC-CCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCC
Q ss_conf             65412-488403422236788866410----------0026533445899876424588558998442211162200178
Q gi|255764515|r  314 VIIEK-ANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGG  382 (458)
Q Consensus       314 ~il~~-~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~  382 (458)
                      .++.+ ..+.++||||+.+...+.+..          .++++.+..+|..++++|++++.+|||+| +.++=|||+.. -
T Consensus       420 ~lL~~~~~~~kvIIFvnTK~~ad~L~~~L~~~G~~a~~LHGd~~Q~eR~~~L~~Fr~G~~~ILVAT-DVAARGLDI~d-V  497 (602)
T PTZ00110        420 ELLGQIMDGGKILIFSETKKGADTLTKELRLDGWPALCIHGDKKQEERTWVLNEFKTGKHPIMIAT-DVASRGLDVRD-V  497 (602)
T ss_pred             HHHHHCCCCCCEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEC-CHHHCCCCCCC-C
T ss_conf             999852789968999297389999999998679957982088999999999999976999889882-22331555157-9


Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECC
Q ss_conf             599990899898686445666620220203787752899998589
Q gi|255764515|r  383 NILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN  427 (458)
Q Consensus       383 ~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~  427 (458)
                      ++||+||+|-++..+.-|+||-.     |.|.+  =..|-|++++
T Consensus       498 ~~VINYD~P~~~edYVHRIGRTG-----RAG~k--G~A~TF~Tpd  535 (602)
T PTZ00110        498 KYVINFDFPNQIEDYVHRIGRTG-----RAGAK--GASYTFLTPD  535 (602)
T ss_pred             CEEEEECCCCCCCCCCCCCCCCC-----CCCCC--EEEEEEECCC
T ss_conf             87999589798022101356150-----68993--1699997777


No 41 
>COG1204 Superfamily II helicase [General function prediction only]
Probab=99.92  E-value=2.5e-23  Score=159.58  Aligned_cols=168  Identities=23%  Similarity=0.191  Sum_probs=114.9

Q ss_pred             CCCHHHHHHHHHH-HHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             8747899999999-967980999588998689999999999975999499991604656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWI-LDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~-~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      +|+|+|.+++... .++++.+++.++|+|||++|+.++..-...+..+++.|||..-+.++=.+|+.+|. ..+++|...
T Consensus        31 el~~~qq~av~~~~~~~~N~li~aPTgsGKTlIA~lai~~~l~~~~~k~vYivPlkALa~Ek~~~~~~~~-~~GirV~~~  109 (766)
T COG1204          31 ELFNPQQEAVEKGLLSDENVLISAPTGSGKTLIALLAILSTLLEGGGKVVYIVPLKALAEEKYEEFSRLE-ELGIRVGIS  109 (766)
T ss_pred             HHHHHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHHHHHHHH-HCCCEEEEE
T ss_conf             7557899874111257986799767888669999999999998559838999075999999999866688-659779996


Q ss_pred             ECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCC-CCCCCEEECCCCCCCCCC-CCCCHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             5897898887307798699806420233442000-113220440453100246-54311567777665430598079965
Q gi|255764515|r   81 TGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG-TWPFATIVVDESTKLKSF-RLRQGSKTARALAKPAWESERFIELT  158 (458)
Q Consensus        81 ~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~-~~~~~~iIiDEaH~lkn~-~~~~~s~~~~~l~~~~~~~~~~l~LT  158 (458)
                      +|+..... .+...++|+|+|||++..+.+.... ....++||+||.|.+... ++.........+.... ...+.++||
T Consensus       110 TgD~~~~~-~~l~~~~ViVtT~EK~Dsl~R~~~~~~~~V~lvViDEiH~l~d~~RG~~lE~iv~r~~~~~-~~~rivgLS  187 (766)
T COG1204         110 TGDYDLDD-ERLARYDVIVTTPEKLDSLTRKRPSWIEEVDLVVIDEIHLLGDRTRGPVLESIVARMRRLN-ELIRIVGLS  187 (766)
T ss_pred             CCCCCCCH-HHHCCCCEEEECHHHHHHHHHCCCCHHHCCCEEEEEEEEECCCCCCCCEEHHHHHHHHHHC-CCEEEEEEE
T ss_conf             48865553-3414588799746786676506753334016899942101487565864022798888527-551798873


Q ss_pred             CCCHHHHCCCHHHHHHHCC
Q ss_conf             8402310010134677517
Q gi|255764515|r  159 GTPSPNGLIDLWGQIWFLD  177 (458)
Q Consensus       159 gTPi~n~~~el~~ll~~l~  177 (458)
                      || ++| +.|+   ..||+
T Consensus       188 AT-lpN-~~ev---A~wL~  201 (766)
T COG1204         188 AT-LPN-AEEV---ADWLN  201 (766)
T ss_pred             EE-CCC-HHHH---HHHHC
T ss_conf             11-688-8999---99858


No 42 
>TIGR00643 recG ATP-dependent DNA helicase RecG; InterPro: IPR004609 The ATP-dependent DNA helicase RecG 3.6.1 from EC plays a critical role in recombination and DNA repair. It helps to process Holliday junction intermediates to mature products by catalysing branch migration. RecG has DNA unwinding activity characteristic of a DNA helicase with 3' to 5' polarity.; GO: 0004003 ATP-dependent DNA helicase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=99.92  E-value=2e-22  Score=154.07  Aligned_cols=314  Identities=16%  Similarity=0.237  Sum_probs=181.0

Q ss_pred             CCCHHHHHHHHHHHH-----CC-CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             874789999999996-----79-809995889986899999999999759994999916046569999999985588881
Q gi|255764515|r    2 NLAPHQTKIVDWILD-----HK-RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~-----~~-~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      +|-+=|..+|.-+..     .+ +-||-.|||+|||+.|+.++......| ..+..+||+.++..|..+.+.+|++..++
T Consensus       307 ~LT~aQ~r~v~EI~~DL~~~~pMnRLlQGDVGSGKT~VA~la~l~~i~~G-YQ~ALMAPTEiLA~QHy~~~~~~l~p~~~  385 (721)
T TIGR00643       307 ELTRAQKRVVKEILQDLKSDVPMNRLLQGDVGSGKTLVAALAMLAAIESG-YQVALMAPTEILAEQHYDSLRNLLAPLGI  385 (721)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             77677899999999861478753222110106638999999999998469-80999177689999999999996235485


Q ss_pred             EEEEEECCHHH--HHH----HHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             59998589789--888----730779869980642023344200011322044045310024654311567777665430
Q gi|255764515|r   76 NISVITGTVKQ--RTK----VLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        76 ~~~~~~g~~~~--r~~----~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                      .+..++|+-+.  |..    +-.+..+++|=|+-.+.    +.-......+|||||=|++      +..||.+...|...
T Consensus       386 ~vaLLTGs~k~~~r~~~~e~i~~G~~~~~vGTHALiq----e~vef~~L~lVIiDEQHRF------GV~QR~~L~~KG~~  455 (721)
T TIGR00643       386 EVALLTGSLKGKQRKELLETIASGEIHLVVGTHALIQ----EKVEFKRLGLVIIDEQHRF------GVEQRKKLREKGQE  455 (721)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCCEEEEHHHHHHH----HHHHHHCCCEEEEECCCCC------HHHHHHHHHHHHHC
T ss_conf             7888615667878999999986395205733135545----2144314774899323356------07899999986220


Q ss_pred             C-----CCEEEEECCCCHHHHCC-CHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5-----98079965840231001-01346775178887753277887773695640330000245555455899999742
Q gi|255764515|r  150 E-----SERFIELTGTPSPNGLI-DLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLS  223 (458)
Q Consensus       150 ~-----~~~~l~LTgTPi~n~~~-el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~  223 (458)
                      .     .+++|.||||||+-.+- -+|+=                                                   
T Consensus       456 ~~~~G~~PH~L~MtATPIPRTLALt~yGD---------------------------------------------------  484 (721)
T TIGR00643       456 GSMIGFAPHVLVMTATPIPRTLALTVYGD---------------------------------------------------  484 (721)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHC---------------------------------------------------
T ss_conf             68867777764663788147899776500---------------------------------------------------


Q ss_pred             HHHHHHHCCCCCCCC--CCCEEEEEEECCHH---HHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             454332000010010--01100034524536---8998889999998510334520223478888754203541000223
Q gi|255764515|r  224 DCCLSLDIADYQNID--KPILITKKVPLPQP---VMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEE  298 (458)
Q Consensus       224 ~~~~~~~~~~~~~l~--~~~~~~~~v~l~~~---~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~  298 (458)
                           ...+-.-++|  +.++.+..+.-...   .-+.|+...+++...   ....-            +  .|.     
T Consensus       485 -----ld~S~I~elP~GR~pi~T~~~~~~~~~aW~~~v~~~~~~E~~~G---rQaYv------------v--~Pl-----  537 (721)
T TIGR00643       485 -----LDVSIIDELPPGRKPITTYLIKHKEKGAWIDIVYEFIEEEIAKG---RQAYV------------V--YPL-----  537 (721)
T ss_pred             -----CEEEEECCCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHCC---CCEEE------------E--ECC-----
T ss_conf             -----00334316854593389988842788775689999999998328---90899------------9--644-----


Q ss_pred             CCCHHCCCCCCCCHHHHHHCCCCCEEEEHHHHHHHH-HHHHHC-CCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCC
Q ss_conf             430001343333256654124884034222367888-664100-026533445899876424588558998442211162
Q gi|255764515|r  299 KHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDL-ARLQKA-FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGL  376 (458)
Q Consensus       299 ~~~~~~~~~k~~~l~~il~~~~~~kviif~~~~~~~-~~i~~~-~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~Gl  376 (458)
                          ...|++++-+....+.        |...+... ..+... +++-.+.++++++++.|.+++++|||+| .+.-+|+
T Consensus       538 ----I~ESE~lp~lk~A~~~--------~~~l~~~f~~~~~v~LlHGrm~~~eK~~vm~~F~~~~~~ILVsT-TVIEVGV  604 (721)
T TIGR00643       538 ----IEESEKLPDLKAAEAL--------YERLKKAFLPKYNVGLLHGRMKSDEKEAVMEEFREGEVDILVST-TVIEVGV  604 (721)
T ss_pred             ----CCCCCCCCHHHHHHHH--------HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEE-EEEEEEE
T ss_conf             ----0320047168999999--------99988861221001133068984789999998521583699997-6899986


Q ss_pred             CCCCCCCEEEEECCC-CCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEEC
Q ss_conf             200178599990899-89868644566662022020378775289999858
Q gi|255764515|r  377 NLQYGGNILVFFSLW-WDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQ  426 (458)
Q Consensus       377 nL~~a~~~iI~~~~~-wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~  426 (458)
                      |...| +++|.++.. +=-+.+.|-.||+-     |-.-+..|   .|+++
T Consensus       605 DVPnA-tvMVIe~AeRFGLSQLHQLRGRVG-----RG~~~SyC---~L~~k  646 (721)
T TIGR00643       605 DVPNA-TVMVIEDAERFGLSQLHQLRGRVG-----RGDHQSYC---LLVYK  646 (721)
T ss_pred             ECCCC-CEEEEECCCHHHHHHHHHHCEEEC-----CCCCCCEE---EEECC
T ss_conf             17977-278886655103688876350012-----68975079---98125


No 43 
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional
Probab=99.91  E-value=3.5e-21  Score=146.59  Aligned_cols=295  Identities=17%  Similarity=0.248  Sum_probs=182.4

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160-4656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      .++|.|.+++..+++.+-.+..+++|.|||+.=  -+-.+..  .+.+|||.|. +|+.+| ...+..    .++....+
T Consensus        25 ~Fr~~Q~e~i~~~l~g~D~l~~mpTG~GKSlcy--QlPal~~--~g~tiVisPLisLm~DQ-v~~L~~----~gi~a~~l   95 (607)
T PRK11057         25 QFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCY--QIPALVL--DGLTLVVSPLISLMKDQ-VDQLLA----NGVAAACL   95 (607)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHH--HHHHHHC--CCCEEEECCHHHHHHHH-HHHHHH----CCCCEEEE
T ss_conf             345769999999986998899878995597999--9999877--99889986879999999-999997----89929995


Q ss_pred             ECC--HHHHHH----HHCCCCCEEEECCCCHHHHH-HHCCCCCCCCEEECCCCCCCCCCCC-CCHHHHHHHHHHHHH--C
Q ss_conf             589--789888----73077986998064202334-4200011322044045310024654-311567777665430--5
Q gi|255764515|r   81 TGT--VKQRTK----VLKTPAVLYVINFENLGWLV-QELKGTWPFATIVVDESTKLKSFRL-RQGSKTARALAKPAW--E  150 (458)
Q Consensus        81 ~g~--~~~r~~----~~~~~~~i~i~s~e~~~~~~-~~~~~~~~~~~iIiDEaH~lkn~~~-~~~s~~~~~l~~~~~--~  150 (458)
                      .++  ..++..    +..+...++.++.|.+.... .+.....+..+++|||||.+..++- -+.+  ++.+..+..  .
T Consensus        96 ~s~~~~~e~~~~~~~~~~g~~~llyvtPErl~~~~~~~~l~~~~i~~~viDEAHcvs~WGhdFRp~--Y~~l~~l~~~~~  173 (607)
T PRK11057         96 NSTQTREQQLEVMAGCRTGQIKLLYIAPERLMMDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPE--YAALGQLRQRFP  173 (607)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCEEEECHHHHCCHHHHHHHHHCCCCEEEEEHHHHHHHCCCCCHHH--HHHHHHHHHHCC
T ss_conf             699999999999999975998799988558569789999971886648853066675415500388--999999999769


Q ss_pred             CCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98079965840231001013467751788877532778877736956403300002455554558999997424543320
Q gi|255764515|r  151 SERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLD  230 (458)
Q Consensus       151 ~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~  230 (458)
                      ..-+++||||-.+.--.|+..+|.+-+|....+                                               
T Consensus       174 ~~p~~AlTATAt~~v~~di~~~L~l~~~~~~~~-----------------------------------------------  206 (607)
T PRK11057        174 TLPFMALTATADDTTRQDIVRLLGLNDPLIQIS-----------------------------------------------  206 (607)
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHCCCCCCEEEC-----------------------------------------------
T ss_conf             997489996368789999999708999807825-----------------------------------------------


Q ss_pred             CCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCC
Q ss_conf             00010010011000345245368998889999998510334520223478888754203541000223430001343333
Q gi|255764515|r  231 IADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIK  310 (458)
Q Consensus       231 ~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~  310 (458)
                           ...+|.+....++-.                                                        .+.+
T Consensus       207 -----~f~RpNl~~~v~~~~--------------------------------------------------------~~~~  225 (607)
T PRK11057        207 -----SFDRPNIRYMLMEKF--------------------------------------------------------KPLD  225 (607)
T ss_pred             -----CCCCCCCEEEEEECC--------------------------------------------------------CHHH
T ss_conf             -----778887414555447--------------------------------------------------------7399


Q ss_pred             CHHHHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCC
Q ss_conf             25665412488403422236788866410----------00265334458998764245885589984422111622001
Q gi|255764515|r  311 ALEVIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQY  380 (458)
Q Consensus       311 ~l~~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~  380 (458)
                      .+.+.++...++.-||||......+.+..          .++.|.+.++|....+.|.+++.+|++++ .|-|.|||-..
T Consensus       226 ~~~~~~~~~~~~sgIIYc~trk~~e~la~~L~~~G~~~~~YHagl~~~~R~~~q~~f~~~~~~vivAT-~AFGMGIdk~d  304 (607)
T PRK11057        226 QLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSRGISAAAYHAGLDNDVRADVQEAFQRDDLQIVVAT-VAFGMGINKPN  304 (607)
T ss_pred             HHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHCCCCCEEEEE-HHHHCCCCCCC
T ss_conf             99999870689977999692899999999998579754530589997899999998756887589975-01105767777


Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             785999908998986864456666202202037877528999
Q gi|255764515|r  381 GGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       381 a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                       .+.|||+++|-|...+.|=+||.     .|.|+...|..+|
T Consensus       305 -VR~ViH~~~P~s~e~yyQE~GRA-----GRDG~~a~c~l~y  340 (607)
T PRK11057        305 -VRFVVHFDIPRNIESYYQETGRA-----GRDGLPAEAMLFY  340 (607)
T ss_pred             -CCEEEECCCCCCHHHHHHHHHHC-----CCCCCCCEEEEEE
T ss_conf             -66799778999999999988635-----2589854189985


No 44 
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=99.90  E-value=2e-22  Score=154.08  Aligned_cols=159  Identities=21%  Similarity=0.234  Sum_probs=110.9

Q ss_pred             CCCHHHHHHHHHHHHC-CCEEEEECCCCCHHHHHHHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHHCCCCC-CEEE
Q ss_conf             8747899999999967-980999588998689999999999975-999499991604656999999998558888-1599
Q gi|255764515|r    2 NLAPHQTKIVDWILDH-KRCAIWASMGSGKTVSVLTALSYIHLW-GEKSVLVIAPLRVAQSVWTSEVQRWSNFSH-MNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~-~~~ll~~~~G~GKT~~al~~~~~l~~~-~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~-~~~~   78 (458)
                      .++|||.+++.++.+. +.+++.++||+|||++++..+...... ...++||++|...+..||.+++.++..... ....
T Consensus         8 ~~~~~Q~~~~~~~~~~~~~~~i~~~tGsGKT~~~~~~~~~~~~~~~~~~~li~~P~~~l~~q~~~~~~~~~~~~~~~~~~   87 (201)
T smart00487        8 PLRPYQKEAIEALLSGLRDVILAAPTGSGKTLAALLPALEALKRGKGKRVLVLVPTRELAEQWAEELKKLGPSLGLKVVG   87 (201)
T ss_pred             CCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             99988999999998389988998999960999999999998633899759999085999999998860102102044556


Q ss_pred             EEECCH-H-HHHHHHCCCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             985897-8-988873077986998064202334420-0011322044045310024654311567777665430598079
Q gi|255764515|r   79 VITGTV-K-QRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFI  155 (458)
Q Consensus        79 ~~~g~~-~-~r~~~~~~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l  155 (458)
                      .+.|.. . ..........+++++|++.+....... ....+|++||+||||++.+.  ...... ..+.....+..+++
T Consensus        88 ~~~~~~~~~~~~~~~~~~~~i~i~t~~~l~~~~~~~~~~~~~~~~vIiDE~H~~~~~--~~~~~~-~~~~~~~~~~~~~i  164 (201)
T smart00487       88 LYGGDSKREQLRKLESGKTDILVTTPGRLLDLLENDLLELSNVDLVILDEAHRLLDG--GFGDQL-EKLLKLLPKNVQLL  164 (201)
T ss_pred             EECCCCHHHHHHHHHCCCCCEEEECHHHHHHHHHHCCCCCCCCEEEEEECHHHHHCC--CCHHHH-HHHHHHCCCCCCEE
T ss_conf             524773799999997599989995589999999727545254319999896775125--709999-99999679999789


Q ss_pred             EECCCCHH
Q ss_conf             96584023
Q gi|255764515|r  156 ELTGTPSP  163 (458)
Q Consensus       156 ~LTgTPi~  163 (458)
                      +|||||..
T Consensus       165 ~lSAT~~~  172 (201)
T smart00487      165 LLSATPPE  172 (201)
T ss_pred             EECCCCCH
T ss_conf             99248986


No 45 
>PRK10917 ATP-dependent DNA helicase RecG; Provisional
Probab=99.90  E-value=2.2e-20  Score=141.67  Aligned_cols=307  Identities=17%  Similarity=0.252  Sum_probs=173.5

Q ss_pred             CCCHHHHHHHHHHHHC-----C-CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             8747899999999967-----9-809995889986899999999999759994999916046569999999985588881
Q gi|255764515|r    2 NLAPHQTKIVDWILDH-----K-RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~-----~-~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      +|-+-|..+++-+...     + +-||..|||+|||+.|+.++......| ..+.++||+.++..|....+.++....++
T Consensus       257 ~LT~~Q~~~~~ei~~dl~~~~~m~rllqGDVGsGKT~va~~a~~~~~~~g-~q~a~maPTeiLa~Qh~~~~~~~~~~~~i  335 (677)
T PRK10917        257 ELTGAQKRVVAEILADLASPKPMNRLLQGDVGSGKTVVAALAALAAIEAG-YQAALMAPTEILAEQHYRNLKKWLEPLGI  335 (677)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHC-CEEEEECCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             88988999999999876599542777328767888999999999999819-94899876799999999999987763498


Q ss_pred             EEEEEECCHH--HHHHH----HCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             5999858978--98887----30779869980642023344200011322044045310024654311567777665430
Q gi|255764515|r   76 NISVITGTVK--QRTKV----LKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        76 ~~~~~~g~~~--~r~~~----~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                      ++..++|+.+  .+..+    -.+..+++|-|+-.+...    ....+-.++|+||-|++      +..++.....+.  
T Consensus       336 ~v~lltg~~~~~~~~~~~~~~~~g~~~i~iGTHal~~~~----v~f~~LglvviDEQHrF------GV~QR~~l~~k~--  403 (677)
T PRK10917        336 RVALLTGSLKGKERREILEALASGEADIVIGTHALIQDD----VEFHNLGLVIIDEQHRF------GVHQRLALREKG--  403 (677)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHCCCCCEEEEHHHHHHCC----CCCCCCCEEEECHHHHH------HHHHHHHHHHCC--
T ss_conf             899840774177899999998579977897307877355----64466656995305776------399999998439--


Q ss_pred             CCCEEEEECCCCHHHHCC-CHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             598079965840231001-0134677517888775327788777369564033000024555545589999974245433
Q gi|255764515|r  150 ESERFIELTGTPSPNGLI-DLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLS  228 (458)
Q Consensus       150 ~~~~~l~LTgTPi~n~~~-el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~  228 (458)
                      ..++.+.||||||+-.+. -+|+-+++-                                                    
T Consensus       404 ~~~~~L~mtATPIPRtla~~~~g~~d~s----------------------------------------------------  431 (677)
T PRK10917        404 ENPHVLVMTATPIPRTLAMTAYGDLDVS----------------------------------------------------  431 (677)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHCCCCEE----------------------------------------------------
T ss_conf             9972999836884388999873576666----------------------------------------------------


Q ss_pred             HHCCCCCCCCC--CCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCC
Q ss_conf             20000100100--1100034524536899888999999851033452022347888875420354100022343000134
Q gi|255764515|r  229 LDIADYQNIDK--PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHD  306 (458)
Q Consensus       229 ~~~~~~~~l~~--~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~  306 (458)
                          -..++|+  ..+.+..+.. ....+.|+.+.++...   +....             +. +|.. ++        |
T Consensus       432 ----~i~~~P~~r~~i~T~~~~~-~~~~~~~~~i~~~~~~---g~q~y-------------~v-~p~i-ee--------s  480 (677)
T PRK10917        432 ----VIDELPPGRKPITTVVIPD-SRRDEVYERIREEIAK---GRQAY-------------VV-CPLI-EE--------S  480 (677)
T ss_pred             ----ECCCCCCCCCCCEEEEECH-HHHHHHHHHHHHHHHC---CCEEE-------------EE-ECCC-CC--------C
T ss_conf             ----6677999998726999762-5689999999999975---99289-------------99-4131-12--------3


Q ss_pred             CCCC--CHHH---HH-HCCCCCEEEEHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCC
Q ss_conf             3333--2566---54-1248840342223678886641000265334458998764245885589984422111622001
Q gi|255764515|r  307 EKIK--ALEV---II-EKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQY  380 (458)
Q Consensus       307 ~k~~--~l~~---il-~~~~~~kviif~~~~~~~~~i~~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~  380 (458)
                      ++++  .+.+   .+ +...+.++-              .+++.++.+++..++++|.+|+.+||+++ ....+|+|...
T Consensus       481 e~~~~~~~~~~~~~l~~~~~~~~v~--------------~~hG~m~~~ek~~~m~~F~~g~~~iLvsT-tviEvGvdvpn  545 (677)
T PRK10917        481 EKLDLQSAEETYEELQKALPELRVG--------------LLHGRMKPAEKDAVMAAFKAGEIDILVAT-TVIEVGVDVPN  545 (677)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCEEE--------------EECCCCCHHHHHHHHHHHHCCCCCEEEEC-CEEECCCCCCC
T ss_conf             3201777999999998448997599--------------83078987899999999983999999989-89755867888


Q ss_pred             CCCEEEEECC-CCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCC
Q ss_conf             7859999089-98986864456666202202037877528999985899
Q gi|255764515|r  381 GGNILVFFSL-WWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNT  428 (458)
Q Consensus       381 a~~~iI~~~~-~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~t  428 (458)
                      | +++|..+. -+-.+.+.|-.||+-     |-+.+.  ++| |++.+.
T Consensus       546 a-~~mvi~~aerfGlsqLhQLRGRVg-----Rg~~~~--~c~-l~~~~~  585 (677)
T PRK10917        546 A-TVMVIENAERFGLAQLHQLRGRVG-----RGAAQS--YCV-LLYKDP  585 (677)
T ss_pred             C-CEEEEECCCCCCHHHHHHHCCCCC-----CCCCCE--EEE-EEECCC
T ss_conf             8-589997701053678877427436-----788845--899-983899


No 46 
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]
Probab=99.90  E-value=6.1e-20  Score=139.04  Aligned_cols=324  Identities=17%  Similarity=0.236  Sum_probs=200.6

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHH--CCCCC-EEEEECCHHHHHHHHHHHHHHCCCC-CCE
Q ss_conf             874789999999996798099958899868999-999999997--59994-9999160465699999999855888-815
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHL--WGEKS-VLVIAPLRVAQSVWTSEVQRWSNFS-HMN   76 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~--~~~~~-~LIv~P~~l~~~~W~~Ei~kf~~~~-~~~   76 (458)
                      +.-|.|..++-.++..+..+..+.+|+|||+.= |-.+..+..  ..... +||++|+.-+..|-.+++.++.... .+.
T Consensus        51 ~pt~IQ~~~iP~~l~g~Dvi~~A~TGsGKT~Af~lP~l~~i~~~~~~~~~~aLil~PTRELA~Qi~~~~~~~~~~~~~~~  130 (513)
T COG0513          51 EPTPIQLAAIPLILAGRDVLGQAQTGTGKTAAFLLPLLQKILKSVERKYVSALILAPTRELAVQIAEELRKLGKNLGGLR  130 (513)
T ss_pred             CCCHHHHHHCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             98989996587763699979986898717899999999997400455777569977999999999999999986245842


Q ss_pred             EEEEECC-H-HHHHHHHCCCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCE
Q ss_conf             9998589-7-8988873077986998064202334420-00113220440453100246543115677776654305980
Q gi|255764515|r   77 ISVITGT-V-KQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESER  153 (458)
Q Consensus        77 ~~~~~g~-~-~~r~~~~~~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~  153 (458)
                      +..+.|. + ......+....+++|.|.-.+-.+.... +.......+|+|||-++-+.+-   ..-...+.........
T Consensus       131 ~~~i~GG~~~~~q~~~l~~g~~ivVaTPGRllD~i~~~~l~l~~v~~lVlDEADrmld~gf---~~~i~~I~~~~p~~~q  207 (513)
T COG0513         131 VAVVYGGVSIRKQIEALKRGVDIVVATPGRLLDLIKRGKLDLSGVETLVLDEADRMLDMGF---IDDIEKILKALPPDRQ  207 (513)
T ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCHHHHHHHCCCCCCCCEEEEEECCHHHHCCCCC---HHHHHHHHHHCCCCCE
T ss_conf             9999899898999998724998999796089999864885546501899676176638876---8999999973897748


Q ss_pred             EEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             79965840231001013467751788877532778877736956403300002455554558999997424543320000
Q gi|255764515|r  154 FIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD  233 (458)
Q Consensus       154 ~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~  233 (458)
                      .++-|||.-. ..                    ..+..++...                           +..+.+....
T Consensus       208 tllfSAT~~~-~i--------------------~~l~~~~l~~---------------------------p~~i~v~~~~  239 (513)
T COG0513         208 TLLFSATMPD-DI--------------------RELARRYLND---------------------------PVEIEVSVEK  239 (513)
T ss_pred             EEEEEECCCH-HH--------------------HHHHHHHCCC---------------------------CCEEEECCCC
T ss_conf             9999824898-99--------------------9999997368---------------------------8079964322


Q ss_pred             CCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHH
Q ss_conf             10010011000345245368998889999998510334520223478888754203541000223430001343333256
Q gi|255764515|r  234 YQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE  313 (458)
Q Consensus       234 ~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~  313 (458)
                      ... ....+....+...                                                     ....|++.|.
T Consensus       240 ~~~-~~~~i~q~~~~v~-----------------------------------------------------~~~~k~~~L~  265 (513)
T COG0513         240 LER-TLKKIKQFYLEVE-----------------------------------------------------SEEEKLELLL  265 (513)
T ss_pred             CCC-CCCCCEEEEEEEC-----------------------------------------------------CHHHHHHHHH
T ss_conf             335-3004707999808-----------------------------------------------------5677999999


Q ss_pred             HHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCC
Q ss_conf             65412488403422236788866410----------00265334458998764245885589984422111622001785
Q gi|255764515|r  314 VIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN  383 (458)
Q Consensus       314 ~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~  383 (458)
                      .+++.....++||||+-+...+.+..          .++++.+.++|...++.|++|+.+|||+| ++++-||++.. -+
T Consensus       266 ~ll~~~~~~~~IVF~~tk~~~~~l~~~l~~~g~~~~~lhG~l~q~~R~~~l~~F~~g~~~iLVaT-DvaaRGiDi~~-v~  343 (513)
T COG0513         266 KLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEKFKDGELRVLVAT-DVAARGLDIPD-VS  343 (513)
T ss_pred             HHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCCEEEEE-CHHHCCCCCCC-CC
T ss_conf             99827888839999576776999999999789659997388998899999999975998989980-65446899666-74


Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             999908998986864456666202202037877528999985899689999999999
Q gi|255764515|r  384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       384 ~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
                      +||+||+|.++..+..++||-.     |.|.+  -..+-|+++ .-|...+..+++.
T Consensus       344 ~VinyD~p~~~e~yvHRiGRTg-----RaG~~--G~ai~fv~~-~~e~~~l~~i~~~  392 (513)
T COG0513         344 HVINYDLPLDPEDYVHRIGRTG-----RAGRK--GVAISFVTE-EEEVKKLKRIEKR  392 (513)
T ss_pred             EEEECCCCCCCCCCCCCCCCCC-----CCCCC--CEEEEEECC-HHHHHHHHHHHHH
T ss_conf             7997879998041317345343-----48998--727998556-2349999999998


No 47 
>KOG0331 consensus
Probab=99.89  E-value=2.9e-20  Score=141.03  Aligned_cols=322  Identities=18%  Similarity=0.259  Sum_probs=190.1

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHH------CC-CCCEEEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             74789999999996798099958899868999-999999997------59-99499991604656999999998558888
Q gi|255764515|r    3 LAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHL------WG-EKSVLVIAPLRVAQSVWTSEVQRWSNFSH   74 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~------~~-~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~   74 (458)
                      .-|-|..+.-.+++.+.++..+.+|+|||+.= |-++.++..      .+ ...+||++|+.-+.+|-++++.+|.....
T Consensus       114 PtpIQaq~wp~~l~GrD~v~iA~TGSGKTLay~lP~i~~l~~~~~~~~~~~~P~vLVL~PTRELA~QV~~~~~~~~~~~~  193 (519)
T KOG0331         114 PTPIQAQGWPIALSGRDLVGIARTGSGKTLAYLLPAIVHLNNEQGKLSRGDGPIVLVLAPTRELAVQVQAEAREFGKSLR  193 (519)
T ss_pred             CCHHHHCCCCEECCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCC
T ss_conf             85344144651126886577823578620555557999987004443479998699976859999999999999707777


Q ss_pred             CEEEEEEC-CHHH-HHHHHCCCCCEEEECCCCHHHHHHHCC-CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             15999858-9789-888730779869980642023344200-01132204404531002465431156777766543059
Q gi|255764515|r   75 MNISVITG-TVKQ-RTKVLKTPAVLYVINFENLGWLVQELK-GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWES  151 (458)
Q Consensus        75 ~~~~~~~g-~~~~-r~~~~~~~~~i~i~s~e~~~~~~~~~~-~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~  151 (458)
                      ++..+++| .++. -...+....+|+|.|...+..+.+.-. .......+|+|||-++-..+-  ..+.-+.+..+....
T Consensus       194 ~~~~cvyGG~~~~~Q~~~l~~gvdiviaTPGRl~d~le~g~~~l~~v~ylVLDEADrMldmGF--e~qI~~Il~~i~~~~  271 (519)
T KOG0331         194 LRSTCVYGGAPKGPQLRDLERGVDVVIATPGRLIDLLEEGSLNLSRVTYLVLDEADRMLDMGF--EPQIRKILSQIPRPD  271 (519)
T ss_pred             CCEEEEECCCCCCHHHHHHHCCCCEEEECCHHHHHHHHCCCCCCCCEEEEEECCHHHHHCCCC--HHHHHHHHHHCCCCC
T ss_conf             407998689886378898755981898077178999974885645303999634776631353--799999987558975


Q ss_pred             CEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             80799658402310010134677517888775327788777369564033000024555545589999974245433200
Q gi|255764515|r  152 ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI  231 (458)
Q Consensus       152 ~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~  231 (458)
                      ...++-|||=    |.+.                 ..+...|..                                    
T Consensus       272 rQtlm~saTw----p~~v-----------------~~lA~~fl~------------------------------------  294 (519)
T KOG0331         272 RQTLMFSATW----PKEV-----------------RQLAEDFLN------------------------------------  294 (519)
T ss_pred             CCEEEEEEEC----CHHH-----------------HHHHHHHHC------------------------------------
T ss_conf             2278886546----4889-----------------999999845------------------------------------


Q ss_pred             CCCCCCCCCCEEEEEEECC-HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCC
Q ss_conf             0010010011000345245-368998889999998510334520223478888754203541000223430001343333
Q gi|255764515|r  232 ADYQNIDKPILITKKVPLP-QPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIK  310 (458)
Q Consensus       232 ~~~~~l~~~~~~~~~v~l~-~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~  310 (458)
                           -|.      .+... ....++-...     .++    ......                           .+|..
T Consensus       295 -----~~~------~i~ig~~~~~~a~~~i-----~qi----ve~~~~---------------------------~~K~~  327 (519)
T KOG0331         295 -----NPI------QINVGNKKELKANHNI-----RQI----VEVCDE---------------------------TAKLR  327 (519)
T ss_pred             -----CCE------EEEECCHHHHHHHCCH-----HHH----HHHCCH---------------------------HHHHH
T ss_conf             -----964------8996121455443331-----465----112687---------------------------88988


Q ss_pred             CHHHHHH---CCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCC
Q ss_conf             2566541---2488403422236788866410----------00265334458998764245885589984422111622
Q gi|255764515|r  311 ALEVIIE---KANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN  377 (458)
Q Consensus       311 ~l~~il~---~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~Gln  377 (458)
                      .+..++.   ...+.|+||||+.+...+.+..          .++++.+..+|...++.|.+|+.+||+++ +.++-||+
T Consensus       328 ~l~~lL~~~~~~~~~KvIIFc~tkr~~~~l~~~l~~~~~~a~~iHGd~sQ~eR~~~L~~FreG~~~vLVAT-dVAaRGLD  406 (519)
T KOG0331         328 KLGKLLEDISSDSEGKVIIFCETKRTCDELARNLRRKGWPAVAIHGDKSQSERDWVLKGFREGKSPVLVAT-DVAARGLD  406 (519)
T ss_pred             HHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHCCCCCCCEEEEC-CCCCCCCC
T ss_conf             79999999735689868999643364999998877517661550066648899999975026885469881-53125688


Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECC--CHHHHHHHHHHH
Q ss_conf             00178599990899898686445666620220203787752899998589--968999999999
Q gi|255764515|r  378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN--TIDELVLQRLRT  439 (458)
Q Consensus       378 L~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~--tide~i~~~~~~  439 (458)
                      +.. -++||+||+|-|...+..++||=-     |.|++  -..|-|++..  .+...+++.+.+
T Consensus       407 i~d-V~lVInydfP~~vEdYVHRiGRTG-----Ra~~~--G~A~tfft~~~~~~a~~l~~~l~e  462 (519)
T KOG0331         407 VPD-VDLVINYDFPNNVEDYVHRIGRTG-----RAGKK--GTAITFFTSDNAKLARELIKVLRE  462 (519)
T ss_pred             CCC-CCEEEECCCCCCHHHHHHHCCCCC-----CCCCC--CEEEEEEEHHHHHHHHHHHHHHHH
T ss_conf             766-647996789999899886537654-----57888--248999727887778999999997


No 48 
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]
Probab=99.88  E-value=1.1e-19  Score=137.39  Aligned_cols=327  Identities=16%  Similarity=0.182  Sum_probs=187.7

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCC--CCEEE
Q ss_conf             874789999999996798099958899868999-999999997599949999160465699999999855888--81599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFS--HMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~--~~~~~   78 (458)
                      +||+||.+|.+.+.+.++.++.-+||+|||..- +.++..+......+.|+|-|.+.+.+--.+.+.+|....  .+++.
T Consensus        70 ~lY~HQ~~A~~~~~~G~~vvVtTgTgSGKTe~FllPIld~~l~~~~a~AL~lYPtnALa~DQ~~rl~~~~~~~~~~v~~~  149 (851)
T COG1205          70 RLYSHQVDALRLIREGRNVVVTTGTGSGKTESFLLPILDHLLRDPSARALLLYPTNALANDQAERLRELISDLPGKVTFG  149 (851)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             20077999999997799889978998854589899999998308665089980437767669999999998478751354


Q ss_pred             EEECCH--HHHHHHHCCCCCEEEECCCCHHHHH-H----HCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH--
Q ss_conf             985897--8988873077986998064202334-4----200011322044045310024654311567777665430--
Q gi|255764515|r   79 VITGTV--KQRTKVLKTPAVLYVINFENLGWLV-Q----ELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW--  149 (458)
Q Consensus        79 ~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~-~----~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~--  149 (458)
                      .++|+.  .++..+.....+|++|||+++.... .    .......+.+||+||+|..+...++..+-..|.+.....  
T Consensus       150 ~y~Gdt~~~~r~~~~~~pp~IllTNpdMLh~~llr~~~~~~~~~~~Lk~lVvDElHtYrGv~GS~vA~llRRL~~~~~~~  229 (851)
T COG1205         150 RYTGDTPPEERRAIIRNPPDILLTNPDMLHYLLLRNHDAWLWLLRNLKYLVVDELHTYRGVQGSEVALLLRRLLRRLRRY  229 (851)
T ss_pred             EECCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCCCHHHHHHCCCEEEEECCEECCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             43488967888998738997898388999898636882278887327589984441215603788999999999997245


Q ss_pred             -CCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -5980799658402310010134677517888775327788777369564033000024555545589999974245433
Q gi|255764515|r  150 -ESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLS  228 (458)
Q Consensus       150 -~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~  228 (458)
                       ..+..++.|||- . +|.|                    |...+........       ......              
T Consensus       230 ~~~~q~i~~SAT~-~-np~e--------------------~~~~l~~~~f~~~-------v~~~g~--------------  266 (851)
T COG1205         230 GSPLQIICTSATL-A-NPGE--------------------FAEELFGRDFEVP-------VDEDGS--------------  266 (851)
T ss_pred             CCCCEEEEEECCC-C-CHHH--------------------HHHHHCCCCCEEE-------CCCCCC--------------
T ss_conf             8996289983124-6-8288--------------------9998628721463-------147888--------------


Q ss_pred             HHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCC
Q ss_conf             20000100100110003452453689988899999985103345202234788887542035410002234300013433
Q gi|255764515|r  229 LDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEK  308 (458)
Q Consensus       229 ~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k  308 (458)
                               |.. .....+..++....... ..+..                                            
T Consensus       267 ---------~~~-~~~~~~~~p~~~~~~~~-~r~s~--------------------------------------------  291 (851)
T COG1205         267 ---------PRG-LRYFVRREPPIRELAES-IRRSA--------------------------------------------  291 (851)
T ss_pred             ---------CCC-CEEEEEECCCCHHHHHH-CCCCH--------------------------------------------
T ss_conf             ---------878-74899856851133221-12345--------------------------------------------


Q ss_pred             CCCHHHHHH--CCCCCEEEEHHHHHHHHHHHH------------------HCCCCCCCHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             332566541--248840342223678886641------------------000265334458998764245885589984
Q gi|255764515|r  309 IKALEVIIE--KANAAPIIVAYHFNSDLARLQ------------------KAFPQGRTLDKDPCTIQEWNEGKIPLLFAH  368 (458)
Q Consensus       309 ~~~l~~il~--~~~~~kviif~~~~~~~~~i~------------------~~~~~g~~~~~r~~~i~~f~~~~~~vli~s  368 (458)
                      ...+..++.  -.++-+.++|+.....+..+.                  ..+.+|....+|.++...|++|+..+++. 
T Consensus       292 ~~~~~~~~~~~~~~~~~tL~F~~sr~~~e~~~~~~~~~~~~~~~~l~~~v~~~~~~~~~~er~~ie~~~~~g~~~~~~s-  370 (851)
T COG1205         292 LAELATLAALLVRNGIQTLVFFRSRKQVELLYLSPRRRLVREGGKLLDAVSTYRAGLHREERRRIEAEFKEGELLGVIA-  370 (851)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEEEHHHHHHHHHHHHHHHHHHCCCCHHHHEEECCCCCCHHHHHHHHHHHHCCCCCEEEE-
T ss_conf             7799999999987696599998357567887541578875406010331342336699999999999974688417861-


Q ss_pred             HHHCCCCCCCCCCCCEEEEECCCC-CHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHH
Q ss_conf             422111622001785999908998-9868644566662022020378775289999858996899999
Q gi|255764515|r  369 PASCGHGLNLQYGGNILVFFSLWW-DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQ  435 (458)
Q Consensus       369 ~~~~~~GlnL~~a~~~iI~~~~~w-n~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~  435 (458)
                      +.|.-.|+++.. -..+|.+..|- +...++|+.||.     .|.||.-.+.+  ..-.+.+|...+.
T Consensus       371 t~AlelgidiG~-ldavi~~g~P~~s~~~~~Q~~GRa-----GR~~~~~l~~~--v~~~~~~d~yy~~  430 (851)
T COG1205         371 TNALELGIDIGS-LDAVIAYGYPGVSVLSFRQRAGRA-----GRRGQESLVLV--VLRSDPLDSYYLR  430 (851)
T ss_pred             CHHHCCCEEECC-EEEEEECCCCCCHHHHHHHHHCCC-----CCCCCCCEEEE--EECCCCCCHHHHH
T ss_conf             210122656702-114530488970288898861103-----58878753799--8378840044550


No 49 
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=99.88  E-value=2.6e-21  Score=147.37  Aligned_cols=349  Identities=15%  Similarity=0.163  Sum_probs=182.3

Q ss_pred             CCCCHHHHHHHHHHHH-----CCCEEEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             9874789999999996-----79809995889986899999999999759-99499991604656999999998558888
Q gi|255764515|r    1 MNLAPHQTKIVDWILD-----HKRCAIWASMGSGKTVSVLTALSYIHLWG-EKSVLVIAPLRVAQSVWTSEVQRWSNFSH   74 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~-----~~~~ll~~~~G~GKT~~al~~~~~l~~~~-~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~   74 (458)
                      +-+|+||..|+..+.+     +++.||++.+|+|||.+|++++..|...+ .+++|-++-...+.+|=..++++|.+...
T Consensus       164 i~~RyyQ~~AI~rv~Eaf~~g~~raLlvMATGTGKTrTAiaii~rL~r~~~~KRVLFLaDR~~Lv~QA~~af~~~~P~~~  243 (875)
T COG4096         164 IGPRYYQIIAIRRVIEAFSKGQNRALLVMATGTGKTRTAIAIIDRLIKSGWVKRVLFLADRNALVDQAYGAFEDFLPFGT  243 (875)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCEEHHHHHHHHHHCCHHHEEEEEECHHHHHHHHHHHHHHHCCCCC
T ss_conf             36227889999999999866874489997058885231999999999614143056761267899999999996398864


Q ss_pred             CEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHC-C-----CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             15999858978988873077986998064202334420-0-----01132204404531002465431156777766543
Q gi|255764515|r   75 MNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQEL-K-----GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA  148 (458)
Q Consensus        75 ~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~-~-----~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~  148 (458)
                      . +..+.+.      .....+.+++.+|+++....... .     ..-.||+||+||||+=       ..+..+.+.-. 
T Consensus       244 ~-~n~i~~~------~~~~s~~i~lsTyqt~~~~~~~~~~~~~~f~~g~FDlIvIDEaHRg-------i~~~~~~I~dY-  308 (875)
T COG4096         244 K-MNKIEDK------KGDTSSEIYLSTYQTMTGRIEQKEDEYRRFGPGFFDLIVIDEAHRG-------IYSEWSSILDY-  308 (875)
T ss_pred             C-EEEECCC------CCCCCEEEEEEEHHHHHHHHHCCCCCCCCCCCCCEEEEEECHHHHH-------HHHHHHHHHHH-
T ss_conf             0-1232014------6786305887603778756406545655678883128996066666-------78766789889-


Q ss_pred             HCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             05980799658402310010134677517888775327788777369564033000024555545589999974245433
Q gi|255764515|r  149 WESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLS  228 (458)
Q Consensus       149 ~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~  228 (458)
                       -+...++|||||-..--.+-|.+++    |.+                       ...|.-......-+.  .++..+.
T Consensus       309 -FdA~~~gLTATP~~~~d~~T~~~F~----g~P-----------------------t~~YsleeAV~DG~L--vpy~vi~  358 (875)
T COG4096         309 -FDAATQGLTATPKETIDRSTYGFFN----GEP-----------------------TYAYSLEEAVEDGFL--VPYKVIR  358 (875)
T ss_pred             -HHHHHHHHCCCCCCCCCCCCCCCCC----CCC-----------------------CEEECHHHHHHCCCC--CCCCCEE
T ss_conf             -9998876125762111323101337----970-----------------------224128888521545--7886337


Q ss_pred             HHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCC
Q ss_conf             20000100100110003452453689988899999985103345202234788887542035410002234300013433
Q gi|255764515|r  229 LDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEK  308 (458)
Q Consensus       229 ~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k  308 (458)
                      +..    ..+..-.  ..-.++ +..+...    +.+.+ .+......                 .++............
T Consensus       359 i~~----~~~~~G~--~~~~~s-erek~~g----~~i~~-dd~~~~~~-----------------d~dr~~v~~~~~~~V  409 (875)
T COG4096         359 IDT----DFDLDGW--KPDAGS-EREKLQG----EAIDE-DDQNFEAR-----------------DFDRTLVIPFRTETV  409 (875)
T ss_pred             EEE----ECCCCCC--CCCCCC-HHHHHHC----CCCCC-CCCCCCCC-----------------CCCHHEECCCHHHHH
T ss_conf             664----3156674--767552-3233313----43686-54463335-----------------532000031247899


Q ss_pred             CCCHHHHHHC--CC--CCEEEEHHHHHHHHHHHHH----CCCCCC---------CHHHHHHHHHHH-CCCCCCEEEEEHH
Q ss_conf             3325665412--48--8403422236788866410----002653---------344589987642-4588558998442
Q gi|255764515|r  309 IKALEVIIEK--AN--AAPIIVAYHFNSDLARLQK----AFPQGR---------TLDKDPCTIQEW-NEGKIPLLFAHPA  370 (458)
Q Consensus       309 ~~~l~~il~~--~~--~~kviif~~~~~~~~~i~~----~~~~g~---------~~~~r~~~i~~f-~~~~~~vli~s~~  370 (458)
                      ...+.+.+++  ..  -.|-||||......+.+..    .+.+..         ..++-+..|+.| .+.+.+.+.+|.+
T Consensus       410 ~r~~~e~l~~~~~g~~~~KTIvFa~n~dHAe~i~~~~~~~ype~~~~~a~~IT~d~~~~q~~Id~f~~ke~~P~Iaitvd  489 (875)
T COG4096         410 ARELTEYLKRGATGDEIGKTIVFAKNHDHAERIREALVNEYPEYNGRYAMKITGDAEQAQALIDNFIDKEKYPRIAITVD  489 (875)
T ss_pred             HHHHHHHHCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCCEEEEHH
T ss_conf             99999984256688866845899627078999999998748010674599984440656899998874378983587612


Q ss_pred             HCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHH--CCCCCC-EEEEEEE
Q ss_conf             21116220017859999089989868644566662022020--378775-2899998
Q gi|255764515|r  371 SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ--AGFKRA-VFVYYLI  424 (458)
Q Consensus       371 ~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR--~Gq~~~-v~v~~li  424 (458)
                      -..+|+|....|| ++|+-.--|-..++|.+||..|.+-.-  .||.|. ..|+.++
T Consensus       490 lL~TGiDvpev~n-lVF~r~V~SktkF~QMvGRGTRl~~~~~~~~~dK~~F~ifDf~  545 (875)
T COG4096         490 LLTTGVDVPEVVN-LVFDRKVRSKTKFKQMVGRGTRLCPDLGGPEQDKEFFTIFDFV  545 (875)
T ss_pred             HHHCCCCCHHEEE-EEEHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEHH
T ss_conf             4542787622045-6431444668999998667654370116865663069998721


No 50 
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]
Probab=99.88  E-value=5.2e-20  Score=139.44  Aligned_cols=309  Identities=17%  Similarity=0.258  Sum_probs=175.6

Q ss_pred             CCCHHHHHHHHHHHHC---C---CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             8747899999999967---9---809995889986899999999999759994999916046569999999985588881
Q gi|255764515|r    2 NLAPHQTKIVDWILDH---K---RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~---~---~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      +|--.|..+++-+...   +   +-||-.|+|+|||+.|+.++......| ..+..++|+.++..|-...+.+|++.-++
T Consensus       262 ~LT~aQ~~vi~EI~~Dl~~~~~M~RLlQGDVGSGKTvVA~laml~ai~~G-~Q~ALMAPTEILA~QH~~~~~~~l~~~~i  340 (677)
T COG1200         262 KLTNAQKRVIKEILADLASPVPMNRLLQGDVGSGKTVVALLAMLAAIEAG-YQAALMAPTEILAEQHYESLRKWLEPLGI  340 (677)
T ss_pred             CCCHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             76789999999998664486666787526767778999999999998728-81688663799999999999987665197


Q ss_pred             EEEEEECCH--HHHHH----HHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             599985897--89888----730779869980642023344200011322044045310024654311567777665430
Q gi|255764515|r   76 NISVITGTV--KQRTK----VLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        76 ~~~~~~g~~--~~r~~----~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                      .+.+++|+-  +.|..    +.++..+++|-|+-.+.    +.-...+..+||+||-|++      ...+|.+...+...
T Consensus       341 ~V~lLtG~~kgk~r~~~l~~l~~G~~~ivVGTHALiQ----d~V~F~~LgLVIiDEQHRF------GV~QR~~L~~KG~~  410 (677)
T COG1200         341 RVALLTGSLKGKARKEILEQLASGEIDIVVGTHALIQ----DKVEFHNLGLVIIDEQHRF------GVHQRLALREKGEQ  410 (677)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCCCEEEECCHHHH----CCEEECCEEEEEEECCCCC------CHHHHHHHHHHCCC
T ss_conf             4898644665067999999874799897997221220----4504420238997252102------29999999973789


Q ss_pred             CCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             59807996584023100101346775178887753277887773695640330000245555455899999742454332
Q gi|255764515|r  150 ESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL  229 (458)
Q Consensus       150 ~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~  229 (458)
                       .++.+.||||||+-.+.    +--|=|.                                                   
T Consensus       411 -~Ph~LvMTATPIPRTLA----lt~fgDl---------------------------------------------------  434 (677)
T COG1200         411 -NPHVLVMTATPIPRTLA----LTAFGDL---------------------------------------------------  434 (677)
T ss_pred             -CCCEEEEECCCCHHHHH----HHHHCCC---------------------------------------------------
T ss_conf             -99679995798507889----8886146---------------------------------------------------


Q ss_pred             HCCCCCCCCC--CCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCC
Q ss_conf             0000100100--11000345245368998889999998510334520223478888754203541000223430001343
Q gi|255764515|r  230 DIADYQNIDK--PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDE  307 (458)
Q Consensus       230 ~~~~~~~l~~--~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~  307 (458)
                      ..+-.-++|+  .++.+..++. ..-.+.|+.+..+..   .+....              .-+|.. +        .|+
T Consensus       435 dvS~IdElP~GRkpI~T~~i~~-~~~~~v~e~i~~ei~---~GrQaY--------------~VcPLI-e--------eSE  487 (677)
T COG1200         435 DVSIIDELPPGRKPITTVVIPH-ERRPEVYERIREEIA---KGRQAY--------------VVCPLI-E--------ESE  487 (677)
T ss_pred             CCHHHCCCCCCCCCEEEEEECC-CCHHHHHHHHHHHHH---CCCEEE--------------EEECCC-C--------CCC
T ss_conf             3011125798997408999644-447999999999997---499799--------------995253-5--------433


Q ss_pred             CCC--CHHHHHH----CCCCCEEEEHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCC
Q ss_conf             333--2566541----2488403422236788866410002653344589987642458855899844221116220017
Q gi|255764515|r  308 KIK--ALEVIIE----KANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYG  381 (458)
Q Consensus       308 k~~--~l~~il~----~~~~~kviif~~~~~~~~~i~~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a  381 (458)
                      +++  ...++-+    ...+.++              .-+++-++.++.++++++|++|+.+||+++ .+..+|+|...|
T Consensus       488 ~l~l~~a~~~~~~L~~~~~~~~v--------------gL~HGrm~~~eKd~vM~~Fk~~e~~ILVaT-TVIEVGVdVPnA  552 (677)
T COG1200         488 KLELQAAEELYEELKSFLPELKV--------------GLVHGRMKPAEKDAVMEAFKEGEIDILVAT-TVIEVGVDVPNA  552 (677)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCEE--------------EEEECCCCHHHHHHHHHHHHCCCCCEEEEE-EEEEECCCCCCC
T ss_conf             11365499999999987054636--------------777568986779999999980887689981-389952357887


Q ss_pred             CCEEEEECC-CCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCC
Q ss_conf             859999089-98986864456666202202037877528999985899
Q gi|255764515|r  382 GNILVFFSL-WWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNT  428 (458)
Q Consensus       382 ~~~iI~~~~-~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~t  428 (458)
                       +++|..+. =+-.+.+.|-.||+     .|-+.+..|  + |++...
T Consensus       553 -TvMVIe~AERFGLaQLHQLRGRV-----GRG~~qSyC--~-Ll~~~~  591 (677)
T COG1200         553 -TVMVIENAERFGLAQLHQLRGRV-----GRGDLQSYC--V-LLYKPP  591 (677)
T ss_pred             -EEEEEECHHHHHHHHHHHHCCCC-----CCCCCCEEE--E-EEECCC
T ss_conf             -07999654330378888752655-----788754489--9-996798


No 51 
>PRK10689 transcription-repair coupling factor; Provisional
Probab=99.85  E-value=3.6e-18  Score=128.33  Aligned_cols=148  Identities=19%  Similarity=0.293  Sum_probs=99.1

Q ss_pred             CHHHHHHHHHHHH---CC---CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHH-HHCCCCCCE
Q ss_conf             4789999999996---79---8099958899868999999999997599949999160465699999999-855888815
Q gi|255764515|r    4 APHQTKIVDWILD---HK---RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQ-RWSNFSHMN   76 (458)
Q Consensus         4 ~p~Q~~~v~~~~~---~~---~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~-kf~~~~~~~   76 (458)
                      -|=|..|++-+++   .+   --|+|.|||-|||=.|+-++..-- ...+.+.|+||+.++..|..+.|. +|.++ +++
T Consensus       602 T~DQl~AI~eV~~DMes~~PMDRLiCGDVGfGKTEVA~RAAFkav-~~gkQVavlvPTTiLA~QH~~tF~~Rf~~~-pv~  679 (1148)
T PRK10689        602 TPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGKTEVAMRAAFLAV-ENHKQVAVLVPTTLLAQQHYDNFRDRFANW-PVR  679 (1148)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHH-HCCCEEEEEECCCCCHHHHHHHHHHHHHCC-CCE
T ss_conf             768999999998776388677415676888877999999999999-639808998366223799999999876415-733


Q ss_pred             EEEEEC--CHHHHHHH----HCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             999858--97898887----307798699806420233442000113220440453100246543115677776654305
Q gi|255764515|r   77 ISVITG--TVKQRTKV----LKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE  150 (458)
Q Consensus        77 ~~~~~g--~~~~r~~~----~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~  150 (458)
                      +..++.  +.++...+    -.+.-+|+|-|+-.+....    ...+-.+|||||=|++       +-+-...+.++. .
T Consensus       680 i~~LsRf~s~ke~~~i~~~l~~G~idIvIGTH~ll~~dv----~f~~LGLlIiDEEqrF-------GV~~KE~lk~l~-~  747 (1148)
T PRK10689        680 IEMLSRFRSAKEQTQILAEAAEGKIDILIGTHKLLQSDV----KWKDLGLLIVDEEHRF-------GVRHKERIKAMR-A  747 (1148)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCCCEEEHHHHHHCCCC----CCCCCCEEEECCCHHC-------CHHHHHHHHHCC-C
T ss_conf             775038888999999999986699877620488866986----5466643786010213-------799999997228-9


Q ss_pred             CCEEEEECCCCHHHH
Q ss_conf             980799658402310
Q gi|255764515|r  151 SERFIELTGTPSPNG  165 (458)
Q Consensus       151 ~~~~l~LTgTPi~n~  165 (458)
                      .-.++-||||||+-.
T Consensus       748 ~vdvLtltATPIPRT  762 (1148)
T PRK10689        748 DVDILTLTATPIPRT  762 (1148)
T ss_pred             CCCEEEEECCCCHHH
T ss_conf             987897625564469


No 52 
>pfam04851 ResIII Type III restriction enzyme, res subunit.
Probab=99.85  E-value=7.3e-21  Score=144.62  Aligned_cols=101  Identities=25%  Similarity=0.363  Sum_probs=80.3

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             98747899999999967980999588998689999999999975999499991604656999999998558888159998
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      |+|||||.++++.+.+++++++..++|+|||++++.++..+... ..++|||||...+.+||.++|              
T Consensus         2 ~~LR~yQ~~a~~~~~~~~~~~i~~pTGsGKT~~~~~~i~~~~~~-~~~~lvlvp~~~L~~Q~~~~~--------------   66 (103)
T pfam04851         2 LELRPYQIEAIRNLLEKKRGLIVMATGSGKTLTAAKLIARLLKG-KKKVLFLVPRKDLLEQALEEF--------------   66 (103)
T ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHC-CCCEEEEECCHHHHHHHHHHH--------------
T ss_conf             98729999999999963986999589998799999999999846-992999908299999999965--------------


Q ss_pred             ECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             58978988873077986998064202334420001132204404531002465431156777766543059807996584
Q gi|255764515|r   81 TGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        81 ~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                                                             +||+||||+...      ....+.+.. ..+..++++||||
T Consensus        67 ---------------------------------------lii~DE~H~~~a------~~~~~~l~~-~~~~~~~lGlTAT  100 (103)
T pfam04851        67 ---------------------------------------VIIIDEAHHSSA------KTKYRKILE-YFKPAFLLGLTAT  100 (103)
T ss_pred             ---------------------------------------HHHHHHHHHCCC------HHHHHHHHH-HCCCCEEEEEEEC
T ss_conf             ---------------------------------------646016352353------789999999-5772608998008


Q ss_pred             CH
Q ss_conf             02
Q gi|255764515|r  161 PS  162 (458)
Q Consensus       161 Pi  162 (458)
                      |.
T Consensus       101 P~  102 (103)
T pfam04851       101 PE  102 (103)
T ss_pred             CC
T ss_conf             88


No 53 
>KOG0330 consensus
Probab=99.85  E-value=9.3e-19  Score=131.88  Aligned_cols=316  Identities=16%  Similarity=0.196  Sum_probs=197.2

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCHHHH-HHHHHHHHHHCCC-CCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             7478999999999679809995889986899-9999999997599-9499991604656999999998558888159998
Q gi|255764515|r    3 LAPHQTKIVDWILDHKRCAIWASMGSGKTVS-VLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~-al~~~~~l~~~~~-~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      .-+-|.+|+-..++++-++.+.++|+|||.. +|-++..|...+. ..+||++|+.-+..|-...|+.+...-++++.++
T Consensus        84 PT~IQ~~aiP~~L~g~dvIglAeTGSGKT~afaLPIl~~LL~~p~~~~~lVLtPtRELA~QI~e~fe~Lg~~iglr~~~l  163 (476)
T KOG0330          84 PTKIQSEAIPVALGGRDVIGLAETGSGKTGAFALPILQRLLQEPKLFFALVLTPTRELAQQIAEQFEALGSGIGLRVAVL  163 (476)
T ss_pred             CCHHHHHHCCHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             74444520655437985799943588840231799999997198774489964828999999999987535667279998


Q ss_pred             ECCHH-HH-HHHHCCCCCEEEECCCCHHHHHHHC--CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             58978-98-8873077986998064202334420--00113220440453100246543115677776654305980799
Q gi|255764515|r   81 TGTVK-QR-TKVLKTPAVLYVINFENLGWLVQEL--KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIE  156 (458)
Q Consensus        81 ~g~~~-~r-~~~~~~~~~i~i~s~e~~~~~~~~~--~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~  156 (458)
                      .|... .. ...+...-+++|.|...+....+..  .....-..+|+|||-++-|..-   ......+.+..+.-...++
T Consensus       164 vGG~~m~~q~~~L~kkPhilVaTPGrL~dhl~~Tkgf~le~lk~LVlDEADrlLd~dF---~~~ld~ILk~ip~erqt~L  240 (476)
T KOG0330         164 VGGMDMMLQANQLSKKPHILVATPGRLWDHLENTKGFSLEQLKFLVLDEADRLLDMDF---EEELDYILKVIPRERQTFL  240 (476)
T ss_pred             ECCCHHHHHHHHHHCCCCEEEECCHHHHHHHHHCCCCCHHHHHHHHHCHHHHHHHHHH---HHHHHHHHHHCCCCCEEEE
T ss_conf             6583299998876248987983707899998743684088757876331776621156---8999999874674414899


Q ss_pred             ECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             65840231001013467751788877532778877736956403300002455554558999997424543320000100
Q gi|255764515|r  157 LTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN  236 (458)
Q Consensus       157 LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~  236 (458)
                      .|||...+ ...                                                 +.+        .      .
T Consensus       241 fsATMt~k-v~k-------------------------------------------------L~r--------a------s  256 (476)
T KOG0330         241 FSATMTKK-VRK-------------------------------------------------LQR--------A------S  256 (476)
T ss_pred             EEEECCHH-HHH-------------------------------------------------HHH--------H------C
T ss_conf             98644413-677-------------------------------------------------876--------4------1


Q ss_pred             CCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHH
Q ss_conf             10011000345245368998889999998510334520223478888754203541000223430001343333256654
Q gi|255764515|r  237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVII  316 (458)
Q Consensus       237 l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il  316 (458)
                      +..|.    .+.-+. -....+.+. ..+..+..                                   .-|-..|..++
T Consensus       257 l~~p~----~v~~s~-ky~tv~~lk-Q~ylfv~~-----------------------------------k~K~~yLV~ll  295 (476)
T KOG0330         257 LDNPV----KVAVSS-KYQTVDHLK-QTYLFVPG-----------------------------------KDKDTYLVYLL  295 (476)
T ss_pred             CCCCE----EEECCC-HHCCHHHHH-HHEEECCC-----------------------------------CCCCHHHHHHH
T ss_conf             58971----786043-011167766-45576326-----------------------------------66652389988


Q ss_pred             HCCCCCEEEEHHHHHHHHHHHH----------HCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEE
Q ss_conf             1248840342223678886641----------000265334458998764245885589984422111622001785999
Q gi|255764515|r  317 EKANAAPIIVAYHFNSDLARLQ----------KAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILV  386 (458)
Q Consensus       317 ~~~~~~kviif~~~~~~~~~i~----------~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI  386 (458)
                      .+..|..+||||+.-.....+.          -.+++.++..+|-...+.|+++...||+|+ +.|+-|||.++. ++||
T Consensus       296 ~e~~g~s~iVF~~t~~tt~~la~~L~~lg~~a~~LhGqmsq~~Rlg~l~~Fk~~~r~iLv~T-DVaSRGLDip~V-d~VV  373 (476)
T KOG0330         296 NELAGNSVIVFCNTCNTTRFLALLLRNLGFQAIPLHGQMSQSKRLGALNKFKAGARSILVCT-DVASRGLDIPHV-DVVV  373 (476)
T ss_pred             HHHCCCCEEEEEECCCHHHHHHHHHHHCCCCEECCCCHHHHHHHHHHHHHHHCCCCCEEEEC-CHHCCCCCCCCC-EEEE
T ss_conf             76359847999834640899999998627643205660357788778998751477679861-301046898771-0799


Q ss_pred             EECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHH
Q ss_conf             908998986864456666202202037877528999985899689999999
Q gi|255764515|r  387 FFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRL  437 (458)
Q Consensus       387 ~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~  437 (458)
                      +||.|-+..++.-+.||..     |-|  +.-.++-||+.  .|-..++++
T Consensus       374 NyDiP~~skDYIHRvGRta-----RaG--rsG~~ItlVtq--yDve~~qrI  415 (476)
T KOG0330         374 NYDIPTHSKDYIHRVGRTA-----RAG--RSGKAITLVTQ--YDVELVQRI  415 (476)
T ss_pred             ECCCCCCHHHHHHHCCCCC-----CCC--CCCCEEEEEEH--HHHHHHHHH
T ss_conf             5378983788888704300-----167--77514898744--556999999


No 54 
>TIGR00580 mfd transcription-repair coupling factor; InterPro: IPR004576 All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transcribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene. A lesion in the template strand blocks the RNA polymerase complex (RNAP). The RNAP-DNA-RNA complex is specifically recognised by TcrF, which releases RNAP and the truncated transcript. The TcrF may replace RNAP at the lesion site and then recruit the UvrA/B/C repair system.; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0006281 DNA repair.
Probab=99.84  E-value=9.1e-19  Score=131.94  Aligned_cols=299  Identities=19%  Similarity=0.282  Sum_probs=172.7

Q ss_pred             HHHHHHHHHHHH-C--CC---EEEEECCCCCHHHHHHHHHHHHHHCCC---CCEEEEECCHHHHHHHHHHH-HHHCCCCC
Q ss_conf             789999999996-7--98---099958899868999999999997599---94999916046569999999-98558888
Q gi|255764515|r    5 PHQTKIVDWILD-H--KR---CAIWASMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEV-QRWSNFSH   74 (458)
Q Consensus         5 p~Q~~~v~~~~~-~--~~---~ll~~~~G~GKT~~al~~~~~l~~~~~---~~~LIv~P~~l~~~~W~~Ei-~kf~~~~~   74 (458)
                      |=|..|++-+.. .  .+   -|||.|||-|||=+|+-|+-..-..|+   +.|.|+||+.++.+|-.+.| +||.++ +
T Consensus       511 ~DQ~~AI~eik~Dm~~~~~MDRL~CGDVGfGKTEVAmRAaFkAv~~gneylKQVavLVPTT~LA~QHf~tf~~RF~~f-P  589 (997)
T TIGR00580       511 PDQLKAIEEIKADMESPRPMDRLVCGDVGFGKTEVAMRAAFKAVLDGNEYLKQVAVLVPTTILAQQHFETFKERFANF-P  589 (997)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCEECEEEEECCHHHHHHHHHHHHHHHHCCC-C
T ss_conf             789999999999740689873465245488536888878887633878220116896270442777889999973789-8


Q ss_pred             CEEEEEECCH--HHHHHH----HCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             1599985897--898887----3077986998064202334420001132204404531002465431156777766543
Q gi|255764515|r   75 MNISVITGTV--KQRTKV----LKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA  148 (458)
Q Consensus        75 ~~~~~~~g~~--~~r~~~----~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~  148 (458)
                      +++..++.-.  ++..++    -.+.-+|+|=|+-.+....    ...+-+||||||=|++       +-+-...|..+.
T Consensus       590 v~I~~LSRF~~~~E~~~iL~~la~G~iDI~IGTH~lL~k~v----~FKdLGLlIiDEEQRF-------GV~~KE~lK~~~  658 (997)
T TIGR00580       590 VTIELLSRFRSAKEKKEILKELASGKIDILIGTHKLLQKDV----KFKDLGLLIIDEEQRF-------GVKQKEKLKELK  658 (997)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCHHHHCCCE----EEECCCCEEEECCCCC-------CCCHHHHHCCCC
T ss_conf             16875277567378999999975594226630104127854----6863864698314348-------831155530015


Q ss_pred             HCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             05980799658402310010134677517888775327788777369564033000024555545589999974245433
Q gi|255764515|r  149 WESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLS  228 (458)
Q Consensus       149 ~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~  228 (458)
                       ..-.+|-||||||+-.+     .|++.                                        -++    + +.-
T Consensus       659 -~~VDvLtlsATPIPRTL-----~MSl~----------------------------------------g~R----d-lS~  687 (997)
T TIGR00580       659 -TSVDVLTLSATPIPRTL-----HMSLS----------------------------------------GIR----D-LSI  687 (997)
T ss_pred             -CCCCEEEEECCCCHHHH-----HHHHH----------------------------------------HHH----H-HHH
T ss_conf             -67656763378960558-----99987----------------------------------------553----3-221


Q ss_pred             HHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCC
Q ss_conf             20000100100110003452453689988899999985103345202234788887542035410002234300013433
Q gi|255764515|r  229 LDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEK  308 (458)
Q Consensus       229 ~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k  308 (458)
                      +..++...+|   +.+...+.++...+.  .+++++..  .|+-.-.                              .++
T Consensus       688 I~TPP~~R~p---v~T~v~~~~~~~~~~--AI~rEL~R--gGQvFyv------------------------------~Nr  730 (997)
T TIGR00580       688 IATPPEDRLP---VRTFVMEYDDELVRE--AIRRELLR--GGQVFYV------------------------------HNR  730 (997)
T ss_pred             CCCCCCCCCC---EEEEEECCCHHHHHH--HHHHHHCC--CCEEEEE------------------------------ECC
T ss_conf             0578887742---488774278689999--99975313--9818998------------------------------088


Q ss_pred             CCCH---HHHHHCC-CCCEEEEHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCE
Q ss_conf             3325---6654124-88403422236788866410002653344589987642458855899844221116220017859
Q gi|255764515|r  309 IKAL---EVIIEKA-NAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNI  384 (458)
Q Consensus       309 ~~~l---~~il~~~-~~~kviif~~~~~~~~~i~~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~  384 (458)
                      ++-+   ..-+++. +..+|-|              .++-++.++-..++.+|.+++.+||||| .-.-.|||+..| |+
T Consensus       731 ie~i~~~~~~l~~LVP~arIai--------------aHGqM~e~eLE~~m~~F~~~~~~vLvcT-TIIE~GIDIPnA-NT  794 (997)
T TIGR00580       731 IESIEKLKTQLRELVPEARIAI--------------AHGQMTENELEEVMLEFYKGEFDVLVCT-TIIESGIDIPNA-NT  794 (997)
T ss_pred             CCCHHHHHHHHHHCCCCEEEEE--------------EECCCCHHHHHHHHHHHHCCCCCEEEEH-HHHHCCCCHHHH-HH
T ss_conf             1357899999985084326788--------------8335684568999998626843301322-146505641001-26


Q ss_pred             EE-EECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEEC
Q ss_conf             99-9089989868644566662022020378775289999858
Q gi|255764515|r  385 LV-FFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQ  426 (458)
Q Consensus       385 iI-~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~  426 (458)
                      +| +-=-.+=.+.+.|-.||+=  |++     +.-|+|.|+..
T Consensus       795 iIi~~AD~FGLaQLYQLRGRVG--Rs~-----~~AYAYlL~~~  830 (997)
T TIGR00580       795 IIIDRADKFGLAQLYQLRGRVG--RSK-----KKAYAYLLYPH  830 (997)
T ss_pred             HHHHHHCCCCHHHHHHCCCEEC--CCC-----CEEEEEECCCC
T ss_conf             8687521147034745363120--587-----12689833477


No 55 
>COG4889 Predicted helicase [General function prediction only]
Probab=99.84  E-value=1.7e-19  Score=136.37  Aligned_cols=154  Identities=16%  Similarity=0.252  Sum_probs=93.1

Q ss_pred             CCCHHHHHHHHHHHH----CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCE
Q ss_conf             874789999999996----798099958899868999999999997599949999160-465699999999855888815
Q gi|255764515|r    2 NLAPHQTKIVDWILD----HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMN   76 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~----~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~   76 (458)
                      ++||||.+|++..++    |.||-|-+.+|+|||+++|-+++.+-.   .++|.++|. +++. |=   +..|+....+.
T Consensus       161 k~R~hQq~Aid~a~~~F~~n~RGkLIMAcGTGKTfTsLkisEala~---~~iL~LvPSIsLLs-QT---lrew~~~~~l~  233 (1518)
T COG4889         161 KPRPHQQTAIDAAKEGFSDNDRGKLIMACGTGKTFTSLKISEALAA---ARILFLVPSISLLS-QT---LREWTAQKELD  233 (1518)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHHHH---HHEEEECCHHHHHH-HH---HHHHHHCCCCC
T ss_conf             9983678999999862551667758983378862137889999864---02365435189999-99---99885346655


Q ss_pred             EE---EEECCHHH------------------HHH--------HHCCCCCEEEECCCCHHHHHHHCC-CCCCCCEEECCCC
Q ss_conf             99---98589789------------------888--------730779869980642023344200-0113220440453
Q gi|255764515|r   77 IS---VITGTVKQ------------------RTK--------VLKTPAVLYVINFENLGWLVQELK-GTWPFATIVVDES  126 (458)
Q Consensus        77 ~~---~~~g~~~~------------------r~~--------~~~~~~~i~i~s~e~~~~~~~~~~-~~~~~~~iIiDEa  126 (458)
                      +.   +-+.+.-.                  ...        .......|+.++|+++-...+.-. ...+||+||||||
T Consensus       234 ~~a~aVcSD~kvsrs~eDik~sdl~~p~sT~~~~il~~~~~~~k~~~~~vvFsTYQSl~~i~eAQe~G~~~fDliicDEA  313 (1518)
T COG4889         234 FRASAVCSDDKVSRSAEDIKASDLPIPVSTDLEDILSEMEHRQKANGLTVVFSTYQSLPRIKEAQEAGLDEFDLIICDEA  313 (1518)
T ss_pred             CEEEEEECCCCCCCCCCCCCHHCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCCCCEEEECCH
T ss_conf             12578863652344412321204788875749999999987533378389997021148789999749997537974400


Q ss_pred             CCCCCCC--CCCHHHHHHHHHHHHHCCCEEEEECCCCH
Q ss_conf             1002465--43115677776654305980799658402
Q gi|255764515|r  127 TKLKSFR--LRQGSKTARALAKPAWESERFIELTGTPS  162 (458)
Q Consensus       127 H~lkn~~--~~~~s~~~~~l~~~~~~~~~~l~LTgTPi  162 (458)
                      |+--...  +...|...+.-.....++.+|+-|||||-
T Consensus       314 HRTtGa~~a~dd~saFt~vHs~~niKa~kRlYmTATPk  351 (1518)
T COG4889         314 HRTTGATLAGDDKSAFTRVHSDQNIKAAKRLYMTATPK  351 (1518)
T ss_pred             HCCCCCEECCCCCCCCEEECCCCCHHHHHHHHCCCCCH
T ss_conf             01446232257720104533764158887666006860


No 56 
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]
Probab=99.83  E-value=2.7e-17  Score=122.98  Aligned_cols=148  Identities=20%  Similarity=0.289  Sum_probs=97.2

Q ss_pred             CHHHHHHHHHHHH---CC---CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHH-HHCCCCCCE
Q ss_conf             4789999999996---79---8099958899868999999999997599949999160465699999999-855888815
Q gi|255764515|r    4 APHQTKIVDWILD---HK---RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQ-RWSNFSHMN   76 (458)
Q Consensus         4 ~p~Q~~~v~~~~~---~~---~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~-kf~~~~~~~   76 (458)
                      -|=|..|++-+++   .+   --|++.|+|-|||=.|+-++-..-. +.+.+-|+||+.++.+|..+-|. +|.++ +++
T Consensus       596 T~DQl~AI~eVk~DM~~~kpMDRLiCGDVGFGKTEVAmRAAFkAV~-~GKQVAvLVPTTlLA~QHy~tFkeRF~~f-PV~  673 (1139)
T COG1197         596 TPDQLKAIEEVKRDMESGKPMDRLICGDVGFGKTEVAMRAAFKAVM-DGKQVAVLVPTTLLAQQHYETFKERFAGF-PVR  673 (1139)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCHHEEECCCCCCHHHHHHHHHHHHHC-CCCEEEEECCCHHHHHHHHHHHHHHHCCC-CEE
T ss_conf             8789999999998860698661025657687599999999999863-79749999260786899899999873389-825


Q ss_pred             EEEEEC--CHHHHHH----HHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             999858--9789888----7307798699806420233442000113220440453100246543115677776654305
Q gi|255764515|r   77 ISVITG--TVKQRTK----VLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE  150 (458)
Q Consensus        77 ~~~~~g--~~~~r~~----~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~  150 (458)
                      +.+++-  +.++...    .-.+.-+|+|-|+-.+....+    ..+-.++||||=|++       +-+-...+..+. .
T Consensus       674 I~~LSRF~s~kE~~~il~~la~G~vDIvIGTHrLL~kdv~----FkdLGLlIIDEEqRF-------GVk~KEkLK~Lr-~  741 (1139)
T COG1197         674 IEVLSRFRSAKEQKEILKGLAEGKVDIVIGTHRLLSKDVK----FKDLGLLIIDEEQRF-------GVKHKEKLKELR-A  741 (1139)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCCCEEEECHHHHCCCCE----EECCCEEEEECHHHC-------CCCHHHHHHHHH-C
T ss_conf             8886055788999999999856984589963176478967----704764897443532-------711789998775-0


Q ss_pred             CCEEEEECCCCHHHH
Q ss_conf             980799658402310
Q gi|255764515|r  151 SERFIELTGTPSPNG  165 (458)
Q Consensus       151 ~~~~l~LTgTPi~n~  165 (458)
                      .-.++-||||||+-.
T Consensus       742 ~VDvLTLSATPIPRT  756 (1139)
T COG1197         742 NVDVLTLSATPIPRT  756 (1139)
T ss_pred             CCCEEEEECCCCCCH
T ss_conf             572897417887544


No 57 
>KOG0952 consensus
Probab=99.82  E-value=1.8e-17  Score=124.09  Aligned_cols=341  Identities=16%  Similarity=0.153  Sum_probs=162.7

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHC---------CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHH
Q ss_conf             67980999588998689999999999975---------999499991604656999999998558888159998589789
Q gi|255764515|r   16 DHKRCAIWASMGSGKTVSVLTALSYIHLW---------GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQ   86 (458)
Q Consensus        16 ~~~~~ll~~~~G~GKT~~al~~~~~l~~~---------~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~   86 (458)
                      .+.++++++++|+|||..|+-.+..+..+         +.-+++.|+|...+...-.+-+.+=+..-++.|.-++|+...
T Consensus       125 SneNMLIcAPTGsGKT~la~L~ILr~ik~~~~~~~i~k~~fKiVYIaPmKALa~Em~~~~~kkl~~~gi~v~ELTGD~ql  204 (1230)
T KOG0952         125 SNENMLICAPTGSGKTVLAELCILRTIKEHEEQGDIAKDDFKIVYIAPMKALAAEMVDKFSKKLAPLGISVRELTGDTQL  204 (1230)
T ss_pred             CCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEECCCCHH
T ss_conf             78877997778997167899999999985014554346871399992568899999999866424246258884175456


Q ss_pred             HHHHHCCCCCEEEECCCCHHHHHH------HCCCCCCCCEEECCCCCCCCCCCCCCHHH-HHHHH--HHHHHCCCEEEEE
Q ss_conf             888730779869980642023344------20001132204404531002465431156-77776--6543059807996
Q gi|255764515|r   87 RTKVLKTPAVLYVINFENLGWLVQ------ELKGTWPFATIVVDESTKLKSFRLRQGSK-TARAL--AKPAWESERFIEL  157 (458)
Q Consensus        87 r~~~~~~~~~i~i~s~e~~~~~~~------~~~~~~~~~~iIiDEaH~lkn~~~~~~s~-~~~~l--~~~~~~~~~~l~L  157 (458)
                      .... -.+.+++|+|.|+..-.-+      .+..  ...+||+||.|.+...++..-.. .+|.+  ....++.-|.++|
T Consensus       205 ~~te-i~~tqiiVTTPEKwDvvTRk~~~d~~l~~--~V~LviIDEVHlLhd~RGpvlEtiVaRtlr~vessqs~IRivgL  281 (1230)
T KOG0952         205 TKTE-IADTQIIVTTPEKWDVVTRKSVGDSALFS--LVRLVIIDEVHLLHDDRGPVLETIVARTLRLVESSQSMIRIVGL  281 (1230)
T ss_pred             HHHH-HHHCCEEEECCCCEEEEEEEECCCHHHHH--HEEEEEEEEEHHHCCCCCCHHHHHHHHHHHHHHHHHHHEEEEEE
T ss_conf             6778-77437797063400046654126265555--42048853001215766406999999999998854200578886


Q ss_pred             CCCCHHHHCCCHHHHHHHCC--CCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             58402310010134677517--8887753277887773695640330000245555455899999742454332000010
Q gi|255764515|r  158 TGTPSPNGLIDLWGQIWFLD--KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ  235 (458)
Q Consensus       158 TgTPi~n~~~el~~ll~~l~--~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~  235 (458)
                      ||| ++| ..|+   ..||.  |...++.+-..|+.-.......+....          .........+........+..
T Consensus       282 SAT-lPN-~eDv---A~fL~vn~~~glfsFd~~yRPvpL~~~~iG~k~~----------~~~~~~~~~d~~~~~kv~e~~  346 (1230)
T KOG0952         282 SAT-LPN-YEDV---ARFLRVNPYAGLFSFDQRYRPVPLTQGFIGIKGK----------KNRQQKKNIDEVCYDKVVEFL  346 (1230)
T ss_pred             ECC-CCC-HHHH---HHHHCCCCCCCEEEECCCCCCCCEEEEEEEEECC----------CCHHHHHHHHHHHHHHHHHHH
T ss_conf             245-787-7999---9986678756626520232034311168742124----------420024667778999999999


Q ss_pred             CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHH
Q ss_conf             01001100034524536899888999999851033452022347888875420354100022343000134333325665
Q gi|255764515|r  236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI  315 (458)
Q Consensus       236 ~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~i  315 (458)
                      .--.+.  -+.|....+..+.-..+..                      ..+.+..        .....++++.+.+.++
T Consensus       347 ~~g~qV--lvFvhsR~~Ti~tA~~l~~----------------------~a~~~g~--------~~~f~~~~~~k~l~el  394 (1230)
T KOG0952         347 QEGHQV--LVFVHSRNETIRTAKKLRE----------------------RAETNGE--------KDLFLPSPRNKQLKEL  394 (1230)
T ss_pred             HCCCEE--EEEEECCHHHHHHHHHHHH----------------------HHHHCCC--------CCCCCCCHHHHHHHHH
T ss_conf             749859--9999657489999999999----------------------9886286--------5656788366789999


Q ss_pred             HHCCCCCEEEEHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHH
Q ss_conf             41248840342223678886641000265334458998764245885589984422111622001785999908998986
Q gi|255764515|r  316 IEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLE  395 (458)
Q Consensus       316 l~~~~~~kviif~~~~~~~~~i~~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~  395 (458)
                      ....-+                  .-+.|.....|...-+.|.+|..+||.|+ .+.+.|+||+ |-.++|.-...|++.
T Consensus       395 f~~g~~------------------iHhAGm~r~DR~l~E~~F~~G~i~vL~cT-aTLAwGVNLP-A~aViIKGT~~ydss  454 (1230)
T KOG0952         395 FQQGMG------------------IHHAGMLRSDRQLVEKEFKEGHIKVLCCT-ATLAWGVNLP-AYAVIIKGTQVYDSS  454 (1230)
T ss_pred             HHHHHH------------------HCCCCCCHHHHHHHHHHHHCCCCEEEEEC-CEEEECCCCC-CEEEEECCCCCCCCC
T ss_conf             874010------------------20256431468999999855982289961-2133125776-418986487411356


Q ss_pred             ----------HHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHH
Q ss_conf             ----------864456666202202037877528999985899689
Q gi|255764515|r  396 ----------EHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDE  431 (458)
Q Consensus       396 ----------~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide  431 (458)
                                +..|..||.     .|.+-.+.-..+-+.+.+.+|-
T Consensus       455 kg~f~dlgilDVlQifGRA-----GRPqFd~~G~giIiTt~dkl~~  495 (1230)
T KOG0952         455 KGSFVDLGILDVLQIFGRA-----GRPQFDSSGEGIIITTRDKLDH  495 (1230)
T ss_pred             CCCEEEEHHHHHHHHHHCC-----CCCCCCCCCEEEEEECCCHHHH
T ss_conf             6843540288889987206-----8998777762899966507989


No 58 
>TIGR01389 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR006293   The ATP-dependent DNA helicase RecQ (3.6.1 from EC) is involved in genome maintenance . All homologues tested to date unwind paired DNA, translocating in a 3' to 5' direction and several have a preference for forked or 4-way DNA structures (e.g. Holliday junctions) or for G-quartet DNA. The yeast protein, Sgs1, is present in numerous foci that coincide with sites of de novo synthesis DNA, such as the replication fork, and protein levels peak during S-phase.    A model has been proposed for Sgs1p action in the S-phase checkpoint response, both as a 'sensor' for damage during replication and a 'resolvase' for structures that arise at paused forks, such as the four-way 'chickenfoot' structure. The action of Sgs1p may serve to maintain the proper amount and integrity of ss DNA that is necessary for the binding of RPA (replication protein A, the eukaryotic ss DNA-binding protein)DNA pol complexes. Sgs1p would thus function by detecting (or resolving) aberrant DNA structures, and would thus contribute to the full activation of the DNA-dependent protein kinase, Mec1p and the effector kinase, Rad53p. Its ability to bind both the large subunit of RPA and the RecA-like protein Rad51p, place it in a unique position to resolve inappropriate fork structures that can occur when either the leading or lagging strand synthesis is stalled. Thus, RecQ helicases integrate checkpoint activation and checkpoint response. ; GO: 0004003 ATP-dependent DNA helicase activity, 0006310 DNA recombination, 0009432 SOS response.
Probab=99.82  E-value=4.2e-18  Score=127.89  Aligned_cols=324  Identities=18%  Similarity=0.242  Sum_probs=201.0

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160-4656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      +.||-|.+.|+.++..+.++..+|||=||++.  .=+-.|...|  -++||.|- ||+.+| ++.+..    -++....+
T Consensus        13 ~FR~gQe~II~~vL~g~~~l~vmPTGGGKSlC--YQ~PALll~G--lt~VISPLIsLMkDQ-Vd~L~~----~Gv~Aa~l   83 (607)
T TIGR01389        13 DFRGGQEEIIEHVLDGRDVLVVMPTGGGKSLC--YQVPALLLKG--LTVVISPLISLMKDQ-VDQLRA----AGVAAAYL   83 (607)
T ss_pred             CCCCHHHHHHHHHHCCCCEEEECCCCCCHHHH--HHHHHHHHCC--CEEEECCHHHHHHHH-HHHHHH----CCCEEEEE
T ss_conf             67731589999984779858973899851277--7217887289--879984236314779-999986----07014520


Q ss_pred             EC--CHHHHHHHHC----CCCCEEEECCCCHHH-HHHHCCCCCCCCEEECCCCCCCCCCC--CCCHHHHHHHHHHHHHCC
Q ss_conf             58--9789888730----779869980642023-34420001132204404531002465--431156777766543059
Q gi|255764515|r   81 TG--TVKQRTKVLK----TPAVLYVINFENLGW-LVQELKGTWPFATIVVDESTKLKSFR--LRQGSKTARALAKPAWES  151 (458)
Q Consensus        81 ~g--~~~~r~~~~~----~~~~i~i~s~e~~~~-~~~~~~~~~~~~~iIiDEaH~lkn~~--~~~~s~~~~~l~~~~~~~  151 (458)
                      ..  +.++...++.    +.-+++=+.+|-+.. .....+...+.+||-|||||-+.=|+  =....+..-.+....++.
T Consensus        84 NSt~s~~E~~~i~~~~~~G~~~LLYvAPERL~~~~Fl~~L~~~~i~L~AvDEAHCvSQWGHDFRPeY~~L~~l~~~fp~~  163 (607)
T TIGR01389        84 NSTLSAKEQQEIEKALVNGELKLLYVAPERLEQDYFLNMLKRLTIALLAVDEAHCVSQWGHDFRPEYRRLGELAERFPQV  163 (607)
T ss_pred             CCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             37788889999999984198157751671321189998873199308998325021668888756589999999867898


Q ss_pred             CEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             80799658402310010134677517888775327788777369564033000024555545589999974245433200
Q gi|255764515|r  152 ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI  231 (458)
Q Consensus       152 ~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~  231 (458)
                      +-+++||||--..--.|+-..|++-++..        |.+-+                                      
T Consensus       164 P~~iALTATAd~~t~~DI~~~L~L~~~~~--------f~~SF--------------------------------------  197 (607)
T TIGR01389       164 PTRIALTATADAETRQDIVELLRLKDANE--------FISSF--------------------------------------  197 (607)
T ss_pred             CEEEEEECCCCHHHHHHHHHHCCCCCCCC--------CCCCC--------------------------------------
T ss_conf             66998724899878999999708898654--------12567--------------------------------------


Q ss_pred             CCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCC
Q ss_conf             00100100110003452453689988899999985103345202234788887542035410002234300013433332
Q gi|255764515|r  232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKA  311 (458)
Q Consensus       232 ~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~  311 (458)
                            .+|.+             .|.                                           .....++.+-
T Consensus       198 ------dRpNl-------------~~~-------------------------------------------v~~k~n~~~~  215 (607)
T TIGR01389       198 ------DRPNL-------------RFS-------------------------------------------VVKKNNKKKF  215 (607)
T ss_pred             ------CCHHH-------------HHH-------------------------------------------HHHHCCCCHH
T ss_conf             ------75114-------------334-------------------------------------------3120378136


Q ss_pred             HHHHHHCC-CCCEEEEHHHHHHHHHHHHHC----------CCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCC
Q ss_conf             56654124-884034222367888664100----------0265334458998764245885589984422111622001
Q gi|255764515|r  312 LEVIIEKA-NAAPIIVAYHFNSDLARLQKA----------FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQY  380 (458)
Q Consensus       312 l~~il~~~-~~~kviif~~~~~~~~~i~~~----------~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~  380 (458)
                      +.+.+... +|..=||||.-...++.+.+.          |+.|.+.+.|.+..+.|...+..|+++| -|-|.|||= .
T Consensus       216 l~~yl~~~~~G~SGIIYa~sR~~VE~~~~~L~s~G~~A~~YHAGL~~~~R~e~Q~~Fl~d~~~vmVAT-~AFGMGIdK-p  293 (607)
T TIGR01389       216 LLEYLKKHREGQSGIIYASSRKKVEELAERLESQGISALAYHAGLSNKVRAENQEDFLYDDVKVMVAT-NAFGMGIDK-P  293 (607)
T ss_pred             HHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHHHCCEEEEEE-ECCCCCCCC-C
T ss_conf             89997507999534787677045899999997479620403679877689999754446255488887-123587478-7


Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEE-E---------EECCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             785999908998986864456666202202037877528999-9---------85899689999999999999999985
Q gi|255764515|r  381 GGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY-L---------IAQNTIDELVLQRLRTKSTIQDLLLN  449 (458)
Q Consensus       381 a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~-l---------i~~~tide~i~~~~~~K~~~~~~~~~  449 (458)
                      -.+.|||+|+|-|-..+.|=-||.     -|.|++..+-..| .         |.....++..=++-.+|.+-+-+..+
T Consensus       294 nVRFViH~d~P~~~EsYYQE~GRA-----GRDGlpae~~lly~~~D~~l~~~~I~~s~~~~~~K~~e~~KL~~m~~y~~  367 (607)
T TIGR01389       294 NVRFVIHADMPKNIESYYQEAGRA-----GRDGLPAEAILLYSLADIALLKRFIEQSEADEDRKQIEREKLDAMLAYCE  367 (607)
T ss_pred             CCCEEEEECCCCCHHHHHCCCCCC-----CCCCCHHHHHHHCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             654888636874211131035546-----88752677867247778999999974158848899999999999999887


No 59 
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]
Probab=99.81  E-value=5.3e-17  Score=121.26  Aligned_cols=300  Identities=19%  Similarity=0.235  Sum_probs=171.7

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160-4656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      .++|=|.++++.+++.++++..+++|.||++.--  +-.+..  .+.+|||.|- ||+.+| .+....    .++.+..+
T Consensus        17 ~FR~gQ~evI~~~l~g~d~lvvmPTGgGKSlCyQ--iPAll~--~G~TLVVSPLiSLM~DQ-V~~l~~----~Gi~A~~l   87 (590)
T COG0514          17 SFRPGQQEIIDALLSGKDTLVVMPTGGGKSLCYQ--IPALLL--EGLTLVVSPLISLMKDQ-VDQLEA----AGIRAAYL   87 (590)
T ss_pred             CCCCCHHHHHHHHHCCCCEEEECCCCCCCCHHHH--HHHHHC--CCCEEEECCHHHHHHHH-HHHHHH----CCCEEEHH
T ss_conf             0388889999999658867998538987106743--678865--99789978568889999-999997----59652044


Q ss_pred             EC--CHHHHHHHH----CCCCCEEEECCCCHHH-HHHHCCCCCCCCEEECCCCCCCCCCC---CCCHHHHHHHHHHHHHC
Q ss_conf             58--978988873----0779869980642023-34420001132204404531002465---43115677776654305
Q gi|255764515|r   81 TG--TVKQRTKVL----KTPAVLYVINFENLGW-LVQELKGTWPFATIVVDESTKLKSFR---LRQGSKTARALAKPAWE  150 (458)
Q Consensus        81 ~g--~~~~r~~~~----~~~~~i~i~s~e~~~~-~~~~~~~~~~~~~iIiDEaH~lkn~~---~~~~s~~~~~l~~~~~~  150 (458)
                      .+  +..++...+    .+..+++-++.|.+.. ...+.+...+..+++|||||-+..++   ...+.+. ..+.....+
T Consensus        88 nS~l~~~e~~~v~~~l~~g~~klLyisPErl~~~~f~~~L~~~~i~l~vIDEAHCiSqWGhdFRP~Y~~l-g~l~~~~~~  166 (590)
T COG0514          88 NSTLSREERQQVLNQLKSGQLKLLYISPERLMSPRFLELLKRLPISLVAIDEAHCISQWGHDFRPDYRRL-GRLRAGLPN  166 (590)
T ss_pred             HCCCCHHHHHHHHHHHHCCCEEEEEECCHHHCCHHHHHHHHHCCCCEEEECHHHHHHHCCCCCCHHHHHH-HHHHHHCCC
T ss_conf             2436787799999998649645999881363176899999708875699621777764177437768999-999851799


Q ss_pred             CCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98079965840231001013467751788877532778877736956403300002455554558999997424543320
Q gi|255764515|r  151 SERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLD  230 (458)
Q Consensus       151 ~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~  230 (458)
                       .-+++||||--+---.|+-.+|..-++...        .                                        
T Consensus       167 -~p~~AlTATA~~~v~~DI~~~L~l~~~~~~--------~----------------------------------------  197 (590)
T COG0514         167 -PPVLALTATATPRVRDDIREQLGLQDANIF--------R----------------------------------------  197 (590)
T ss_pred             -CCEEEEECCCCHHHHHHHHHHHCCCCCCEE--------E----------------------------------------
T ss_conf             -977997378986789999998467886648--------7----------------------------------------


Q ss_pred             CCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCC
Q ss_conf             00010010011000345245368998889999998510334520223478888754203541000223430001343333
Q gi|255764515|r  231 IADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIK  310 (458)
Q Consensus       231 ~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~  310 (458)
                          ....+|.+....++.. .....+.                                                    
T Consensus       198 ----~sfdRpNi~~~v~~~~-~~~~q~~----------------------------------------------------  220 (590)
T COG0514         198 ----GSFDRPNLALKVVEKG-EPSDQLA----------------------------------------------------  220 (590)
T ss_pred             ----ECCCCCHHHHHHHHCC-CHHHHHH----------------------------------------------------
T ss_conf             ----1589852345564256-4788899----------------------------------------------------


Q ss_pred             CHHHHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCC
Q ss_conf             25665412488403422236788866410----------00265334458998764245885589984422111622001
Q gi|255764515|r  311 ALEVIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQY  380 (458)
Q Consensus       311 ~l~~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~  380 (458)
                      .+.+ .....+..-||||.-....+.+.+          .|++|.+.++|...-+.|.+++.+|++++ .|-|.|||=..
T Consensus       221 fi~~-~~~~~~~~GIIYc~sRk~~E~ia~~L~~~g~~a~~YHaGl~~~eR~~~q~~f~~~~~~iiVAT-~AFGMGIdKpd  298 (590)
T COG0514         221 FLAT-VLPQLSKSGIIYCLTRKKVEELAEWLRKNGISAGAYHAGLSNEERERVQQAFLNDEIKVMVAT-NAFGMGIDKPD  298 (590)
T ss_pred             HHHH-HCCCCCCCEEEEEEEHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCCCEEEEE-CCCCCCCCCCC
T ss_conf             9874-132468972899933775999999999779725775189889999999999716998689996-46247767888


Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECC
Q ss_conf             78599990899898686445666620220203787752899998589
Q gi|255764515|r  381 GGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN  427 (458)
Q Consensus       381 a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~  427 (458)
                       ...||||++|-|...+.|=+||.     -|.|....  .+.|..++
T Consensus       299 -VRfViH~~lP~s~EsYyQE~GRA-----GRDG~~a~--aill~~~~  337 (590)
T COG0514         299 -VRFVIHYDLPGSIESYYQETGRA-----GRDGLPAE--AILLYSPE  337 (590)
T ss_pred             -CEEEEEECCCCCHHHHHHHHHHC-----CCCCCCCE--EEEEECCC
T ss_conf             -40799806998989999997135-----67877021--78860630


No 60 
>PRK09751 putative ATP-dependent helicase Lhr; Provisional
Probab=99.80  E-value=3.8e-17  Score=122.08  Aligned_cols=338  Identities=17%  Similarity=0.216  Sum_probs=160.8

Q ss_pred             EEECCCCCHHHHH-HHHHHHHHHCC-----------CCCEEEEECCH-HHHHHH------HHHH----HHH-CCCCCCEE
Q ss_conf             9958899868999-99999999759-----------99499991604-656999------9999----985-58888159
Q gi|255764515|r   22 IWASMGSGKTVSV-LTALSYIHLWG-----------EKSVLVIAPLR-VAQSVW------TSEV----QRW-SNFSHMNI   77 (458)
Q Consensus        22 l~~~~G~GKT~~a-l~~~~~l~~~~-----------~~~~LIv~P~~-l~~~~W------~~Ei----~kf-~~~~~~~~   77 (458)
                      +..++|+|||+.| +.++..|...+           .-++|+|.|-. +..++.      -.+|    .+. ...+.+.+
T Consensus         1 VvAPTGSGKTLAAFL~aLd~L~~~~~~~~~~~~~~~~~~VLYISPLKALa~Dv~rNL~~PL~gI~~~~~~~g~~~~~i~V   80 (1490)
T PRK09751          1 VIAPTGSGKTLAAFLYALDRLFREGGEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKGIADERRRRGETEVNLRV   80 (1490)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEE
T ss_conf             95988743989999999999996145555556788973899959278889999999987998889999862567899758


Q ss_pred             EEEECCH--HHHHHHHCCCCCEEEECCCCHHHHHH----HCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHH---H
Q ss_conf             9985897--89888730779869980642023344----2000113220440453100246543115677776654---3
Q gi|255764515|r   78 SVITGTV--KQRTKVLKTPAVLYVINFENLGWLVQ----ELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKP---A  148 (458)
Q Consensus        78 ~~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~~----~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~---~  148 (458)
                      .+-+|+.  .+|.......-+|+|||.|++.-+..    +.+.  .-..|||||.|.+-+  ++.++...-.+.++   .
T Consensus        81 ~vRtGDT~~~eR~r~~r~PPdILITTPESL~LlLtsk~r~~L~--~v~~VIVDEiHalag--sKRGahLaLsLeRL~~l~  156 (1490)
T PRK09751         81 GIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLR--GVETVIIDEVHAVAG--SKRGAHLALSLERLDALL  156 (1490)
T ss_pred             EEECCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHHHHC--CCCEEEECCCHHHHC--CCCHHHHHHHHHHHHHHC
T ss_conf             6379999999999985089983984889999987356999977--998999628644205--883999999999999865


Q ss_pred             HCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             05980799658402310010134677517888775327788777369564033000024555545589999974245433
Q gi|255764515|r  149 WESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLS  228 (458)
Q Consensus       149 ~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~  228 (458)
                      .....+|+||||=  +.+.+   ...||.+....            .......           .  +.+     +..+.
T Consensus       157 ~~~~qRIGLSATv--~p~e~---vA~fLgg~rpv------------~IV~~~~-----------~--k~~-----~l~v~  201 (1490)
T PRK09751        157 HTSAQRIGLSATV--RSASD---VAAFLGGDRPV------------TVVNPPA-----------M--RHP-----QIRIV  201 (1490)
T ss_pred             CCCCCEEEEECCC--CCHHH---HHHHHCCCCCE------------EEECCCC-----------C--CCC-----EEEEE
T ss_conf             8999689997766--89999---99873799983------------7868888-----------8--875-----27997


Q ss_pred             HHCCCCCCCCCCCEEEE---EEECCHHHH-HHHHHHHHHHHHHCCCCCCHHHHHHHHHHH----HHHCCCCCCCCCCCCC
Q ss_conf             20000100100110003---452453689-988899999985103345202234788887----5420354100022343
Q gi|255764515|r  229 LDIADYQNIDKPILITK---KVPLPQPVM-KQYHKFQRELYCDLQGENIEAFNSASKTVK----CLQLANGAVYYDEEKH  300 (458)
Q Consensus       229 ~~~~~~~~l~~~~~~~~---~v~l~~~~~-~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~----l~q~~~~~~~~~~~~~  300 (458)
                      ....+..+++......-   ......... ..+..+.... ... ...+...|.-....+    +.++...-.  .....
T Consensus       202 vPv~d~~~~~~~~~~~g~~~~~~~~~siw~~v~~~i~~~i-~~h-rsTLVF~NTR~~AErl~~~L~el~~erl--~~~~~  277 (1490)
T PRK09751        202 VPVANMDDVSSVASGTGEDSHAGREGSIWPYIETGILDEV-LRH-RSTIVFTNSRGLAEKLTARLNELYAARL--QRSPS  277 (1490)
T ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-HHC-CCEEEEECCHHHHHHHHHHHHHHHHHHH--CCCCC
T ss_conf             0466533333235677632235554531678899999999-726-8769997887999999999999999873--24643


Q ss_pred             CHHCCCCCCCCHHHHH-HCCCCC-EEEEHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCC
Q ss_conf             0001343333256654-124884-03422236788866410002653344589987642458855899844221116220
Q gi|255764515|r  301 WKEVHDEKIKALEVII-EKANAA-PIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNL  378 (458)
Q Consensus       301 ~~~~~~~k~~~l~~il-~~~~~~-kviif~~~~~~~~~i~~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL  378 (458)
                      .... ........... ....+. .+|+            ...+++.++++|..+-+.+++|+.+.+++| .+...|||+
T Consensus       278 ~~~~-~~~~~~~~~~~~~~~~g~~~~ia------------~aHHGSlSke~R~~vE~~LK~G~LraVVaT-SSLELGIDi  343 (1490)
T PRK09751        278 IAVD-AAHFESTSGATSNRVQSSDVFIA------------RSHHGSVSKEQRAITEQALKSGELRCVVAT-SSLELGIDM  343 (1490)
T ss_pred             CCCC-CCCCCCCCCCCCCCCCCCCCCCC------------CCCCCCCCHHHHHHHHHHHHCCCCCEEEEC-CCHHHCCCC
T ss_conf             2211-00001112222112356654334------------455576899999999999867997789977-805407764


Q ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEE
Q ss_conf             0178599990899898686445666620220203787752899
Q gi|255764515|r  379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY  421 (458)
Q Consensus       379 ~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~  421 (458)
                      - .-+.||.+..|-+.+...|++||--    |+.|......++
T Consensus       344 G-~VDlVVQvgsP~sVAs~lQRvGRAG----H~vg~~S~g~~~  381 (1490)
T PRK09751        344 G-AVDLVIQVATPLSVASGLQRIGRAG----HQVGGVSKGLFF  381 (1490)
T ss_pred             C-CCCEEEEECCCHHHHHHHHHHCCCC----CCCCCCCCEEEE
T ss_conf             4-6557998069667889999710125----788984407996


No 61 
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family; InterPro: IPR004589   The ATP-dependent DNA helicase RecQ (3.6.1 from EC) is involved in genome maintenance . All homologues tested to date unwind paired DNA, translocating in a 3' to 5' direction and several have a preference for forked or 4-way DNA structures (e.g. Holliday junctions) or for G-quartet DNA. The yeast protein, Sgs1, is present in numerous foci that coincide with sites of de novo synthesis DNA, such as the replication fork, and protein levels peak during S-phase.    A model has been proposed for Sgs1p action in the S-phase checkpoint response, both as a 'sensor' for damage during replication and a 'resolvase' for structures that arise at paused forks, such as the four-way 'chickenfoot' structure. The action of Sgs1p may serve to maintain the proper amount and integrity of ss DNA that is necessary for the binding of RPA (replication protein A, the eukaryotic ss DNA-binding protein)DNA pol complexes. Sgs1p would thus function by detecting (or resolving) aberrant DNA structures, and would thus contribute to the full activation of the DNA-dependent protein kinase, Mec1p and the effector kinase, Rad53p. Its ability to bind both the large subunit of RPA and the RecA-like protein Rad51p, place it in a unique position to resolve inappropriate fork structures that can occur when either the leading or lagging strand synthesis is stalled. Thus, RecQ helicases integrate checkpoint activation and checkpoint response. ; GO: 0008026 ATP-dependent helicase activity, 0006310 DNA recombination.
Probab=99.80  E-value=6.1e-17  Score=120.87  Aligned_cols=308  Identities=18%  Similarity=0.235  Sum_probs=186.1

Q ss_pred             CCCHHHHHHHHHHHHCC-CEEEEECCCCCHHHHH-HHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             87478999999999679-8099958899868999-999999997599949999160-46569999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHK-RCAIWASMGSGKTVSV-LTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~-~~ll~~~~G~GKT~~a-l~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~~~   78 (458)
                      +.+|-|.++|+-.+..+ -+++.++||-||+|.= +.++   ..  .+-+|||+|- ||+++| ...++.    .++...
T Consensus        11 ~Frp~Q~e~I~~~L~g~RD~~vvMpTG~GKSLCYQ~Pa~---~~--~G~t~VIsPLiSLm~DQ-V~~L~~----~~i~A~   80 (497)
T TIGR00614        11 SFRPVQLEVINAVLEGRRDCLVVMPTGGGKSLCYQLPAL---YS--DGLTLVISPLISLMEDQ-VLQLKA----SGIPAT   80 (497)
T ss_pred             CCCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHH---HC--CCCEEEECCHHHHHHHH-HHHHHH----CCCCEE
T ss_conf             455148999998754897569981589860367640567---50--89649973636568999-999874----486301


Q ss_pred             EEECCHHHH--HH----H--HCCCCCEEEECCCCHHH---HHHHC---CCCCCCCEEECCCCCCCCCCCC--CCHHHHHH
Q ss_conf             985897898--88----7--30779869980642023---34420---0011322044045310024654--31156777
Q gi|255764515|r   79 VITGTVKQR--TK----V--LKTPAVLYVINFENLGW---LVQEL---KGTWPFATIVVDESTKLKSFRL--RQGSKTAR  142 (458)
Q Consensus        79 ~~~g~~~~r--~~----~--~~~~~~i~i~s~e~~~~---~~~~~---~~~~~~~~iIiDEaH~lkn~~~--~~~s~~~~  142 (458)
                      .+.++....  ..    .  ..+...++=+|+|.+..   +...+   -....+.++.|||||-+.-|+=  ....+...
T Consensus        81 ~L~s~~s~~~~~~v~~~~~~k~g~~kllYvtPE~~~~~~~ll~~Le~~Y~~~~~~~iAvDEAHCiSqWGHDFR~~Y~~LG  160 (497)
T TIGR00614        81 FLNSSQSKEQQKEVLTDLSKKDGKLKLLYVTPEKISKSKSLLQTLEKLYERKGITLIAVDEAHCISQWGHDFRPDYKALG  160 (497)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCEEEEEECHHHHHCCHHHHHHHHHHHHHCCCEEEEEECEEEECCCCCCCCHHHHHHH
T ss_conf             04432577899999999873079758997163465346478999999886449669998321543588887407999965


Q ss_pred             HHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             76654305980799658402310010134677517888775327788777369564033000024555545589999974
Q gi|255764515|r  143 ALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQL  222 (458)
Q Consensus       143 ~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l  222 (458)
                      .|....+..+ +++||||--..=-.|+..+|++.+|.....                                       
T Consensus       161 ~Lk~~fP~vP-~~ALTATA~~~~~~Di~~~L~l~~p~~~~~---------------------------------------  200 (497)
T TIGR00614       161 SLKQKFPNVP-IMALTATASPSVREDILRILNLKNPQVFIT---------------------------------------  200 (497)
T ss_pred             HHHHHCCCCC-EEEEECCCCHHHHHHHHHHHCCCCCCEEEE---------------------------------------
T ss_conf             7888548874-364340578678999998722136624640---------------------------------------


Q ss_pred             HHHHHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCH
Q ss_conf             24543320000100100110003452453689988899999985103345202234788887542035410002234300
Q gi|255764515|r  223 SDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWK  302 (458)
Q Consensus       223 ~~~~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~  302 (458)
                                   ...+|.+.....+-.....+....+.+-. ..                   +..             
T Consensus       201 -------------SFdRPNl~y~v~~K~~n~~~~~~dl~~f~-~~-------------------~~~-------------  234 (497)
T TIGR00614       201 -------------SFDRPNLYYEVRRKTSNTKKILEDLLRFI-VK-------------------KAS-------------  234 (497)
T ss_pred             -------------CCCCCCCEEEEECCCCCHHHHHHHHHHHH-HH-------------------HCC-------------
T ss_conf             -------------46687630340057897025899999998-75-------------------203-------------


Q ss_pred             HCCCCCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHH----------HCCCCCCCHHHHHHHHHHHC-CCCCCEEEEEHHH
Q ss_conf             013433332566541248840342223678886641----------00026533445899876424-5885589984422
Q gi|255764515|r  303 EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQ----------KAFPQGRTLDKDPCTIQEWN-EGKIPLLFAHPAS  371 (458)
Q Consensus       303 ~~~~~k~~~l~~il~~~~~~kviif~~~~~~~~~i~----------~~~~~g~~~~~r~~~i~~f~-~~~~~vli~s~~~  371 (458)
                                  -..+.+|..-||||.-....+.+.          .+|+-|...+.|..+-.+|. ..+++|+++|+ |
T Consensus       235 ------------s~~~~~G~sGIIYC~SR~~~e~~a~~L~~~G~~a~aYHAGl~~~~R~~V~~~f~nrD~~QvVvATv-A  301 (497)
T TIGR00614       235 ------------SAWEFKGKSGIIYCPSRKKSEQVAAELQKLGIAAGAYHAGLEISARKEVQHKFQNRDEIQVVVATV-A  301 (497)
T ss_pred             ------------CCCCCCCCCEEEECCCCHHHHHHHHHHHHCCCEEEHHHCCCCHHHHHHHHHHHHCCCCCEEEEEEE-E
T ss_conf             ------------565245883027528723489999999755861002402688647789999875038857999872-1


Q ss_pred             CCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEE
Q ss_conf             11162200178599990899898686445666620220203787752899998
Q gi|255764515|r  372 CGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLI  424 (458)
Q Consensus       372 ~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li  424 (458)
                      -|.|||=.. -+.||||++|-+-..+-|=.||.     -|.|-...|..||=-
T Consensus       302 FGMGInKpd-vRfViH~~~Pk~~EsYYQE~GRA-----GRDgl~s~c~lfy~~  348 (497)
T TIGR00614       302 FGMGINKPD-VRFVIHYSLPKSMESYYQESGRA-----GRDGLPSECVLFYAP  348 (497)
T ss_pred             CCCCCCCCC-CCEEEEECCCCCCCCCCCCCCCC-----CCCCCCCCEEEEECH
T ss_conf             268887635-36788507885621101355556-----789732010233043


No 62 
>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=99.79  E-value=2.8e-18  Score=129.02  Aligned_cols=140  Identities=19%  Similarity=0.190  Sum_probs=95.1

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHH-HHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECC--HHHHHHHHCCC
Q ss_conf             98099958899868999999999-9975999499991604656999999998558888159998589--78988873077
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSY-IHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT--VKQRTKVLKTP   94 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~-l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~--~~~r~~~~~~~   94 (458)
                      ++.++.++||+|||++++..+.. +.....+++||+||...+.+||.+++.++... ...+....+.  ...+.......
T Consensus         1 ~~~lv~~ptGsGKT~~~~~~~~~~~~~~~~~~~lil~Pt~~L~~q~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~   79 (144)
T cd00046           1 RDVLLAAPTGSGKTLAALLPILELLDSLKGGQVLVLAPTRELANQVAERLKELFGE-GIKVGYLIGGTSIKQQEKLLSGK   79 (144)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCHHHHHHHHCCC
T ss_conf             99999889971799999999999997568976999746799999999999997488-71799996136367789874589


Q ss_pred             CCEEEECCCCHHHHHHH-CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             98699806420233442-00011322044045310024654311567777665430598079965840
Q gi|255764515|r   95 AVLYVINFENLGWLVQE-LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTP  161 (458)
Q Consensus        95 ~~i~i~s~e~~~~~~~~-~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTP  161 (458)
                      .+++++|++.+.+.... ......|++||+||||++.+....  ... ..+..........++|||||
T Consensus        80 ~~ilv~T~~~l~~~~~~~~~~~~~~~~vViDEaH~~~~~~~~--~~~-~~~~~~~~~~~~~l~lSATp  144 (144)
T cd00046          80 TDIVVGTPGRLLDELERLKLSLKKLDLLILDEAHRLLNQGFG--LLG-LKILLKLPKDRQVLLLSATP  144 (144)
T ss_pred             CCEEECCHHHHHHHHHCCCCCCCCCCEEEEECHHHHHCCCCH--HHH-HHHHHHCCCCCCEEEECCCC
T ss_conf             849982889999999738765551009999888876437969--999-99999679999489982899


No 63 
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]
Probab=99.79  E-value=4e-17  Score=121.95  Aligned_cols=312  Identities=17%  Similarity=0.216  Sum_probs=177.3

Q ss_pred             CCCHHHHHHHHH-HHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             874789999999-996798099958899868999-999999997599949999160465699999999855888815999
Q gi|255764515|r    2 NLAPHQTKIVDW-ILDHKRCAIWASMGSGKTVSV-LTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         2 ~L~p~Q~~~v~~-~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      +|.|-|..+|+. +++..+.++...+++|||+++ +|-+..+. .+.++.|.++|--.+.||=.++|..--..-++++.+
T Consensus       216 eLlPVQ~laVe~GLLeG~nllVVSaTasGKTLIgElAGi~~~l-~~g~KmlfLvPLVALANQKy~dF~~rYs~Lglkvai  294 (830)
T COG1202         216 ELLPVQVLAVEAGLLEGENLLVVSATASGKTLIGELAGIPRLL-SGGKKMLFLVPLVALANQKYEDFKERYSKLGLKVAI  294 (830)
T ss_pred             EECCHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHCCHHHH-HCCCEEEEEEHHHHHHCCHHHHHHHHHHCCCCEEEE
T ss_conf             4302346556614405773499940577751477763738788-378728997316876311189999986501662788


Q ss_pred             EECCHHHHHH------HHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCC-CCCCHHHHHHHHHHHHHCCC
Q ss_conf             8589789888------7307798699806420233442000113220440453100246-54311567777665430598
Q gi|255764515|r   80 ITGTVKQRTK------VLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSF-RLRQGSKTARALAKPAWESE  152 (458)
Q Consensus        80 ~~g~~~~r~~------~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~-~~~~~s~~~~~l~~~~~~~~  152 (458)
                      -.|...-+..      ....+.+|+|-|||.+..+.+.-....+...|||||.|.+... ++.+-......+..+...+ 
T Consensus       295 rVG~srIk~~~~pv~~~t~~dADIIVGTYEGiD~lLRtg~~lgdiGtVVIDEiHtL~deERG~RLdGLI~RLr~l~~~A-  373 (830)
T COG1202         295 RVGMSRIKTREEPVVVDTSPDADIIVGTYEGIDYLLRTGKDLGDIGTVVIDEIHTLEDEERGPRLDGLIGRLRYLFPGA-  373 (830)
T ss_pred             EECHHHHCCCCCCCCCCCCCCCCEEEEECHHHHHHHHCCCCCCCCCEEEEEEEEECCCHHCCCCHHHHHHHHHHHCCCC-
T ss_conf             8423452246775356899877679861110789987078555443599650120440101632352899999867777-


Q ss_pred             EEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             07996584023100101346775178887753277887773695640330000245555455899999742454332000
Q gi|255764515|r  153 RFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIA  232 (458)
Q Consensus       153 ~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~  232 (458)
                      ..+.||||-  .+|.|+...+..                                                      ...
T Consensus       374 Q~i~LSATV--gNp~elA~~l~a------------------------------------------------------~lV  397 (830)
T COG1202         374 QFIYLSATV--GNPEELAKKLGA------------------------------------------------------KLV  397 (830)
T ss_pred             EEEEEEEEC--CCHHHHHHHHCC------------------------------------------------------EEE
T ss_conf             499987433--886999988387------------------------------------------------------258


Q ss_pred             CCCCCCCCCEEEEEEECCHHH-HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCC
Q ss_conf             010010011000345245368-9988899999985103345202234788887542035410002234300013433332
Q gi|255764515|r  233 DYQNIDKPILITKKVPLPQPV-MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKA  311 (458)
Q Consensus       233 ~~~~l~~~~~~~~~v~l~~~~-~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~  311 (458)
                      .+..-|.|........-...+ .+...++.+.-+.                                             
T Consensus       398 ~y~~RPVplErHlvf~~~e~eK~~ii~~L~k~E~~---------------------------------------------  432 (830)
T COG1202         398 LYDERPVPLERHLVFARNESEKWDIIARLVKREFS---------------------------------------------  432 (830)
T ss_pred             EECCCCCCHHHEEEEECCCHHHHHHHHHHHHHHHH---------------------------------------------
T ss_conf             65588787367066404816777899999999975---------------------------------------------


Q ss_pred             HHHHHHCCCCCEEEEHHHHHHHHHHHH----------HCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCC
Q ss_conf             566541248840342223678886641----------0002653344589987642458855899844221116220017
Q gi|255764515|r  312 LEVIIEKANAAPIIVAYHFNSDLARLQ----------KAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYG  381 (458)
Q Consensus       312 l~~il~~~~~~kviif~~~~~~~~~i~----------~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a  381 (458)
                       .+ -...-....|||++...--..+.          .-++.|.+-.+|+.+-..|.+++..+++ ++.|.|.|+++. |
T Consensus       433 -~~-sskg~rGQtIVFT~SRrr~h~lA~~L~~kG~~a~pYHaGL~y~eRk~vE~~F~~q~l~~VV-TTAAL~AGVDFP-A  508 (830)
T COG1202         433 -TE-SSKGYRGQTIVFTYSRRRCHELADALTGKGLKAAPYHAGLPYKERKSVERAFAAQELAAVV-TTAALAAGVDFP-A  508 (830)
T ss_pred             -HH-HCCCCCCCEEEEECCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEE-EHHHHHCCCCCC-H
T ss_conf             -44-1137677369994216669999988610786665443798678888899997608755576-424564478875-1


Q ss_pred             CCEEEEE----CC-CCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEEC
Q ss_conf             8599990----89-989868644566662022020378775289999858
Q gi|255764515|r  382 GNILVFF----SL-WWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQ  426 (458)
Q Consensus       382 ~~~iI~~----~~-~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~  426 (458)
                       +-|||-    .. |-||..++|.-||.-|..-|-     .-.||.|+-+
T Consensus       509 -SQVIFEsLaMG~~WLs~~EF~QM~GRAGRp~yHd-----rGkVyllvep  552 (830)
T COG1202         509 -SQVIFESLAMGIEWLSVREFQQMLGRAGRPDYHD-----RGKVYLLVEP  552 (830)
T ss_pred             -HHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCC-----CCEEEEEECC
T ss_conf             -8999999871043278999999850469987233-----7339999557


No 64 
>pfam00270 DEAD DEAD/DEAH box helicase. Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression.
Probab=99.79  E-value=6.5e-18  Score=126.75  Aligned_cols=160  Identities=22%  Similarity=0.232  Sum_probs=109.3

Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHH-HHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEE
Q ss_conf             478999999999679809995889986899999-99999975-9994999916046569999999985588881599985
Q gi|255764515|r    4 APHQTKIVDWILDHKRCAIWASMGSGKTVSVLT-ALSYIHLW-GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT   81 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~-~~~~l~~~-~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~   81 (458)
                      +|+|.+++..+.++++.++.+++|+|||+.++. ++..+... ...++++++|...+.+||.+++.++......++...+
T Consensus         1 ~~~Q~~~i~~~~~g~~~iv~~pTGsGKT~~~~~~~l~~~~~~~~~~~~v~l~Pt~aL~~q~~~~~~~~~~~~~~~~~~~~   80 (167)
T pfam00270         1 TPIQAEAIPAILEGKDVLVQAPTGSGKTLAFLLPALQALLKNPDGPQALVLAPTRELAEQIYEELKKLGKYLGLKVALLY   80 (167)
T ss_pred             CHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             94599999999769978998899975899999999999874778987999906088888999886432102676404641


Q ss_pred             CCH--HHHHHHHCCCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             897--8988873077986998064202334420-0011322044045310024654311567777665430598079965
Q gi|255764515|r   82 GTV--KQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELT  158 (458)
Q Consensus        82 g~~--~~r~~~~~~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LT  158 (458)
                      |..  ..+...+....+++++|++.+....... ......+++|+||+|.+....  ........+..+ ......++||
T Consensus        81 g~~~~~~~~~~~~~~~~Ilv~Tp~~l~~~l~~~~~~~~~~~~lIvDE~H~~~~~~--~g~~~~~il~~l-~~~~q~v~~S  157 (167)
T pfam00270        81 GGDSPKEQLRKLKKGPDILVGTPGRLLDLLERGGLLLKNLKLLVLDEAHRLLDQG--FGDDLEEILRRL-PPKRQILLLS  157 (167)
T ss_pred             CCCCHHHHHHHHCCCCCEEEECHHHHHHHHHHCCCCCCCEEEEEEECHHHHHCCC--HHHHHHHHHHHC-CCCCCEEEEE
T ss_conf             7861788987640577079947899999998033121100389988088673358--299999999857-9999789997


Q ss_pred             CCCHHHHCC
Q ss_conf             840231001
Q gi|255764515|r  159 GTPSPNGLI  167 (458)
Q Consensus       159 gTPi~n~~~  167 (458)
                      ||+- +++.
T Consensus       158 AT~~-~~~~  165 (167)
T pfam00270       158 ATLP-RNVE  165 (167)
T ss_pred             CCCC-HHHH
T ss_conf             2699-7785


No 65 
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process
Probab=99.78  E-value=2.4e-19  Score=135.43  Aligned_cols=112  Identities=21%  Similarity=0.353  Sum_probs=94.0

Q ss_pred             HCCCCCCCCHHHHHHCC--CCCEEEEHHHHHHHHHHHHHCC----------CCCCCHHHHHHHHHHHCCCCCCEEEEEHH
Q ss_conf             01343333256654124--8840342223678886641000----------26533445899876424588558998442
Q gi|255764515|r  303 EVHDEKIKALEVIIEKA--NAAPIIVAYHFNSDLARLQKAF----------PQGRTLDKDPCTIQEWNEGKIPLLFAHPA  370 (458)
Q Consensus       303 ~~~~~k~~~l~~il~~~--~~~kviif~~~~~~~~~i~~~~----------~~g~~~~~r~~~i~~f~~~~~~vli~s~~  370 (458)
                      ...++|++.+.+++++.  +++++||||++...++.+...+          .++.+.++|..++++|++++..+++++ +
T Consensus         8 ~~~~~K~~~l~~~i~~~~~~~~kviIF~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~R~~~~~~F~~~~~~ilv~t-~   86 (131)
T cd00079           8 PVEDEKLEALLELLKEHLKKGGKVLIFCPSKKMLDELAELLRKPGIKVAALHGDGSQEEREEVLKDFREGEIVVLVAT-D   86 (131)
T ss_pred             ECCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCEEEEEEE-E
T ss_conf             386699999999999999789909999788999999999995589989999899999999999999775401048875-1


Q ss_pred             HCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEE
Q ss_conf             211162200178599990899898686445666620220203787752899
Q gi|255764515|r  371 SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY  421 (458)
Q Consensus       371 ~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~  421 (458)
                      ++++||||+. ++++|++|+|||+..+.|++||+     ||.||+..|.++
T Consensus        87 ~~~~Gldl~~-~~~vI~~~~~~s~~~~~Q~~GR~-----~R~gq~~~~~~~  131 (131)
T cd00079          87 VIARGIDLPN-VSVVINYDLPWSPSSYLQRIGRA-----GRAGQKGTAILL  131 (131)
T ss_pred             CCEECCCCCC-CCEEEEECCCCCHHHHHHHHHCC-----CCCCCCEEEEEC
T ss_conf             1200366102-87999978996989999897216-----708996379979


No 66 
>KOG0350 consensus
Probab=99.78  E-value=1.2e-16  Score=119.15  Aligned_cols=352  Identities=17%  Similarity=0.203  Sum_probs=187.0

Q ss_pred             CCCHHHHHHHHHHHHC---------CCEEEEECCCCCHHHH-HHHHHHHHHHCCC--CCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             8747899999999967---------9809995889986899-9999999997599--94999916046569999999985
Q gi|255764515|r    2 NLAPHQTKIVDWILDH---------KRCAIWASMGSGKTVS-VLTALSYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRW   69 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~---------~~~ll~~~~G~GKT~~-al~~~~~l~~~~~--~~~LIv~P~~l~~~~W~~Ei~kf   69 (458)
                      .++|-|...+.|++.-         +-.++..++|+|||+. +|-+...|.....  -+.+||+|...+..|-+++|.+|
T Consensus       159 ~~FPVQ~aVlp~ll~~~~~p~~~r~rDIcV~ApTGSGKTLaY~iPIVQ~L~~R~v~~LRavVivPtr~L~~QV~~~f~~~  238 (620)
T KOG0350         159 RLFPVQYAVLPSLLEEIRSPPPSRPRDICVNAPTGSGKTLAYVIPIVQLLSSRPVKRLRAVVIVPTRELALQVYDTFKRL  238 (620)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCEEEEHHHHHHHHCCCCCCCEEEEEEEEHHHHHHHHHHHHHHH
T ss_conf             54505888888999861479998877547755789884566513789997038734057999954799999999999985


Q ss_pred             CCCCCCEEEEEECCHHHHHHH--HC-CCC----CEEEECCCCHHHHHHHCCCCCCC-----CEEECCCCCCCCCCCCCCH
Q ss_conf             588881599985897898887--30-779----86998064202334420001132-----2044045310024654311
Q gi|255764515|r   70 SNFSHMNISVITGTVKQRTKV--LK-TPA----VLYVINFENLGWLVQELKGTWPF-----ATIVVDESTKLKSFRLRQG  137 (458)
Q Consensus        70 ~~~~~~~~~~~~g~~~~r~~~--~~-~~~----~i~i~s~e~~~~~~~~~~~~~~~-----~~iIiDEaH~lkn~~~~~~  137 (458)
                      +...++.|....|..+...+.  +. ...    +|+|+|...+   .+++.....|     ..+|||||-++-+      
T Consensus       239 ~~~tgL~V~~~sgq~sl~~E~~qL~~~~~~~~~DIlVaTPGRL---VDHl~~~k~f~Lk~LrfLVIDEADRll~------  309 (620)
T KOG0350         239 NSGTGLAVCSLSGQNSLEDEARQLASDPPECRIDILVATPGRL---VDHLNNTKSFDLKHLRFLVIDEADRLLD------  309 (620)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEECCCHHH---HHHCCCCCCCCHHHCEEEEECHHHHHHH------
T ss_conf             6688659886014540578999972599765436697372688---8860489875644535777525778999------


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCHH-HHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             56777766543059807996584023-10010134677517888775327788777369564033000024555545589
Q gi|255764515|r  138 SKTARALAKPAWESERFIELTGTPSP-NGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQK  216 (458)
Q Consensus       138 s~~~~~l~~~~~~~~~~l~LTgTPi~-n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~  216 (458)
                       +.++.=      .+.++.+.+||-. -.+.+++.+..   +.  -+..+.+.....      +................
T Consensus       310 -qsfQ~W------l~~v~~~~~~~k~~~~~~nii~~~~---~~--~pt~~~e~~t~~------~~~~~~l~kL~~satLs  371 (620)
T KOG0350         310 -QSFQEW------LDTVMSLCKTMKRVACLDNIIRQRQ---AP--QPTVLSELLTKL------GKLYPPLWKLVFSATLS  371 (620)
T ss_pred             -HHHHHH------HHHHHHHHCCCHHHCCHHHHHHHCC---CC--CCHHHHHHHHHC------CCCCCHHHHHHCCHHHH
T ss_conf             -999988------9999998377401047154441014---67--740058777412------77675267653013330


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             99997424543320000100100110003452453689988899999985103345202234788887542035410002
Q gi|255764515|r  217 EIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD  296 (458)
Q Consensus       217 ~l~~~l~~~~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~  296 (458)
                      .....+.+..+.          -|..  ..+..+  .                ........   .+      .       
T Consensus       372 qdP~Kl~~l~l~----------~Prl--~~v~~~--~----------------~~ryslp~---~l------~-------  405 (620)
T KOG0350         372 QDPSKLKDLTLH----------IPRL--FHVSKP--L----------------IGRYSLPS---SL------S-------  405 (620)
T ss_pred             CCHHHHHHHHCC----------CCCE--EEEECC--C----------------CEEEECCH---HH------H-------
T ss_conf             496887653327----------9835--886225--4----------------32661575---54------2-------


Q ss_pred             CCCCCHHCCC--CCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHHC--------------CCCCCCHHHHHHHHHHHCCC
Q ss_conf             2343000134--3333256654124884034222367888664100--------------02653344589987642458
Q gi|255764515|r  297 EEKHWKEVHD--EKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA--------------FPQGRTLDKDPCTIQEWNEG  360 (458)
Q Consensus       297 ~~~~~~~~~~--~k~~~l~~il~~~~~~kviif~~~~~~~~~i~~~--------------~~~g~~~~~r~~~i~~f~~~  360 (458)
                         ......+  -|.-.+..+++..+..++|+|++-.+...++...              |.++...+.|...+..|+.|
T Consensus       406 ---~~~vv~~~~~kpl~~~~lI~~~k~~r~lcf~~S~~sa~Rl~~~L~v~~~~~~~~~s~~t~~l~~k~r~k~l~~f~~g  482 (620)
T KOG0350         406 ---HRLVVTEPKFKPLAVYALITSNKLNRTLCFVNSVSSANRLAHVLKVEFCSDNFKVSEFTGQLNGKRRYKMLEKFAKG  482 (620)
T ss_pred             ---HCEEECCCCCCHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             ---13342023554376999997740104899952468899999999998626440255652344388999999987538


Q ss_pred             CCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             85589984422111622001785999908998986864456666202202037877528999985899689999999999
Q gi|255764515|r  361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       361 ~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
                      ++++|||| ++.+-|+++-. .+.||.||+|-+...+.-|.||-.     |.||.-  ++|-++..  .|++.+..+.+|
T Consensus       483 ~i~vLIcS-D~laRGiDv~~-v~~VINYd~P~~~ktyVHR~GRTA-----RAgq~G--~a~tll~~--~~~r~F~klL~~  551 (620)
T KOG0350         483 DINVLICS-DALARGIDVND-VDNVINYDPPASDKTYVHRAGRTA-----RAGQDG--YAITLLDK--HEKRLFSKLLKK  551 (620)
T ss_pred             CCEEEEEH-HHHHCCCCCCC-CCEEEECCCCCHHHHHHHHHCCCC-----CCCCCC--EEEEEECC--CCCHHHHHHHHH
T ss_conf             95299852-36554776024-604763589812657877602210-----056774--47896315--540379999987


No 67 
>KOG0333 consensus
Probab=99.75  E-value=3.5e-16  Score=116.26  Aligned_cols=332  Identities=17%  Similarity=0.200  Sum_probs=190.1

Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCHHHH----HHHHHHHH-------HHCCCCCEEEEECCHHHHHHHHHHHHHHCCC
Q ss_conf             478999999999679809995889986899----99999999-------9759994999916046569999999985588
Q gi|255764515|r    4 APHQTKIVDWILDHKRCAIWASMGSGKTVS----VLTALSYI-------HLWGEKSVLVIAPLRVAQSVWTSEVQRWSNF   72 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~----al~~~~~l-------~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~   72 (458)
                      -|-|..++--+++++..+...++|+|||.-    .+.++..+       +.-.....+|++|+..+.+|-++|-.||+..
T Consensus       269 tpIqR~aipl~lQ~rD~igvaETgsGktaaf~ipLl~~IsslP~~~~~en~~~gpyaiilaptReLaqqIeeEt~kf~~~  348 (673)
T KOG0333         269 TPIQRQAIPLGLQNRDPIGVAETGSGKTAAFLIPLLIWISSLPPMARLENNIEGPYAIILAPTRELAQQIEEETNKFGKP  348 (673)
T ss_pred             CHHHHHHCCCHHCCCCEEEEEECCCCCCCCCHHHHHHHHHCCCCCCHHHHCCCCCEEEEECHHHHHHHHHHHHHHHHCCC
T ss_conf             46788631101014772368731677532000158899870898414442346860012033799999999999875030


Q ss_pred             CCCEEEEEEC-CHHH-HHHHHCCCCCEEEECCCCHH-HHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             8815999858-9789-88873077986998064202-3344200011322044045310024654311567777665430
Q gi|255764515|r   73 SHMNISVITG-TVKQ-RTKVLKTPAVLYVINFENLG-WLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        73 ~~~~~~~~~g-~~~~-r~~~~~~~~~i~i~s~e~~~-~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                      .+.++..+.| -+.+ ....+.....++|.+.-.+- .+-+.++-.-.-..||+|||.++-..+-..  ...+.      
T Consensus       349 lg~r~vsvigg~s~EEq~fqls~gceiviatPgrLid~Lenr~lvl~qctyvvldeadrmiDmgfE~--dv~~i------  420 (673)
T KOG0333         349 LGIRTVSVIGGLSFEEQGFQLSMGCEIVIATPGRLIDSLENRYLVLNQCTYVVLDEADRMIDMGFEP--DVQKI------  420 (673)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHHCCCCEEECCCHHHHHCCCCCH--HHHHH------
T ss_conf             1432899854633665302464154144247407888777788875058467624066654246667--78889------


Q ss_pred             CCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             59807996584023100101346775178887753277887773695640330000245555455899999742454332
Q gi|255764515|r  150 ESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL  229 (458)
Q Consensus       150 ~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~  229 (458)
                             |+.-|..|-           .|+-.-..                             ....+..   .+..  
T Consensus       421 -------L~~mPssn~-----------k~~tde~~-----------------------------~~~~~~~---~~~~--  448 (673)
T KOG0333         421 -------LEQMPSSNA-----------KPDTDEKE-----------------------------GEERVRK---NFSS--  448 (673)
T ss_pred             -------HHHCCCCCC-----------CCCCCCHH-----------------------------HHHHHHH---HCCC--
T ss_conf             -------983876345-----------88863102-----------------------------1888875---1031--


Q ss_pred             HCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCC
Q ss_conf             00001001001100034524536899888999999851033452022347888875420354100022343000134333
Q gi|255764515|r  230 DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKI  309 (458)
Q Consensus       230 ~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~  309 (458)
                      . + ..   . ........|++...+....+.+....-. .+...     .-..++-|           .-.....+.|.
T Consensus       449 ~-k-~y---r-qT~mftatm~p~verlar~ylr~pv~vt-ig~~g-----k~~~rveQ-----------~v~m~~ed~k~  505 (673)
T KOG0333         449 S-K-KY---R-QTVMFTATMPPAVERLARSYLRRPVVVT-IGSAG-----KPTPRVEQ-----------KVEMVSEDEKR  505 (673)
T ss_pred             C-C-CE---E-EEEEEECCCCHHHHHHHHHHHHCCEEEE-ECCCC-----CCCCCHHE-----------EEEEECCHHHH
T ss_conf             2-1-02---5-7899844787679999999852776999-54678-----98602111-----------78881556889


Q ss_pred             CCHHHHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCC
Q ss_conf             325665412488403422236788866410----------0026533445899876424588558998442211162200
Q gi|255764515|r  310 KALEVIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQ  379 (458)
Q Consensus       310 ~~l~~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~  379 (458)
                      +.|.++++.....++|||.|.+...+.+.+          .+++|.+.++|..+++.|.++...||+++ +++|-||+.+
T Consensus       506 kkL~eil~~~~~ppiIIFvN~kk~~d~lAk~LeK~g~~~~tlHg~k~qeQRe~aL~~fr~~t~dIlVaT-DvAgRGIDIp  584 (673)
T KOG0333         506 KKLIEILESNFDPPIIIFVNTKKGADALAKILEKAGYKVTTLHGGKSQEQRENALADFREGTGDILVAT-DVAGRGIDIP  584 (673)
T ss_pred             HHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEE-CCCCCCCCCC
T ss_conf             999999984799987999831324899999986443247996178527789999999871578779983-2212577777


Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECC
Q ss_conf             178599990899898686445666620220203787752899998589
Q gi|255764515|r  380 YGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN  427 (458)
Q Consensus       380 ~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~  427 (458)
                      .- ++||+||+.=+..++.-+|||-     .|-|+.-. - .-|+++.
T Consensus       585 nV-SlVinydmaksieDYtHRIGRT-----gRAGk~Gt-a-iSflt~~  624 (673)
T KOG0333         585 NV-SLVINYDMAKSIEDYTHRIGRT-----GRAGKSGT-A-ISFLTPA  624 (673)
T ss_pred             CC-CEEEECCHHHHHHHHHHHHCCC-----CCCCCCCE-E-EEEECCC
T ss_conf             61-2146220556589998874234-----44666753-6-8986401


No 68 
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type. subtype of CRISPR/Cas locus, found in several species of Cyanobacteria and several archaeal species. It contains helicase motifs and appears to represent the Cas3 protein of the Cyano subtype of CRISPR/Cas system.
Probab=99.73  E-value=1.3e-15  Score=112.89  Aligned_cols=153  Identities=18%  Similarity=0.229  Sum_probs=85.7

Q ss_pred             HHHHHHHHHHHCCC--EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCC----CCCCEEE
Q ss_conf             89999999996798--099958899868999999999997599949999160-4656999999998558----8881599
Q gi|255764515|r    6 HQTKIVDWILDHKR--CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSN----FSHMNIS   78 (458)
Q Consensus         6 ~Q~~~v~~~~~~~~--~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~----~~~~~~~   78 (458)
                      ||.++.+.+.+..+  .++..++|+|||+.++.-+  +  .+..++|+|.|. ++..+| .+.++.|..    .....+.
T Consensus         1 hq~~~~~~~~~~~~~~ivitAPTgsGKT~Aa~lp~--l--~~~~~~lyi~P~kAL~~Dq-~~~l~~~~~~~~~~~~~~~~   75 (357)
T TIGR03158         1 HQVATFEALQSKDADIIFNTAPTGAGKTLAWLTPL--L--HGENDTIALYPTNALIEDQ-TEAIKEFVDVFKPERDVNLL   75 (357)
T ss_pred             CHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHH--H--HCCCCEEEECCHHHHHHHH-HHHHHHHHHHHCCCCCCCEE
T ss_conf             96899999976899869998999856999999999--7--3898799977789999999-99999999874423464402


Q ss_pred             EEECCH----------------------HHHHHHHCCCCCEEEECCCCHHHHHHHCC---------CCCCCCEEECCCCC
Q ss_conf             985897----------------------89888730779869980642023344200---------01132204404531
Q gi|255764515|r   79 VITGTV----------------------KQRTKVLKTPAVLYVINFENLGWLVQELK---------GTWPFATIVVDEST  127 (458)
Q Consensus        79 ~~~g~~----------------------~~r~~~~~~~~~i~i~s~e~~~~~~~~~~---------~~~~~~~iIiDEaH  127 (458)
                      .+.|..                      ..|.........|+++|.|++........         .....+.|||||.|
T Consensus        76 ~~~~~~~~~~~~~~~d~~~~~~g~~~~~~~r~~~~~~~p~ILlTtPd~l~~~l~~~~~~~~~~~~~~~~~l~~VViDEiH  155 (357)
T TIGR03158        76 HVSKATLKDIKEYANDKVGSSKGEKLYNLLRNPIGTSTPIILLTNPDIFVYLTRFAYIDRGDIAAGFYTKFSTVIFDEFH  155 (357)
T ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCEEEEECHHHHHHHHHHHCCCCCHHHHHHHHCCCEEEEEEEH
T ss_conf             11464323344465555343445410256654302589909992889999997620136510399998516747756200


Q ss_pred             CCCCCCCCCHHHHHHHHH--HHHHCCCEEEEECCCCHH
Q ss_conf             002465431156777766--543059807996584023
Q gi|255764515|r  128 KLKSFRLRQGSKTARALA--KPAWESERFIELTGTPSP  163 (458)
Q Consensus       128 ~lkn~~~~~~s~~~~~l~--~~~~~~~~~l~LTgTPi~  163 (458)
                      .+..............+.  ......++.++|||||-+
T Consensus       156 ~y~~~~~~~~~~~l~~~~~~~~~~~~~~~i~lSAT~~~  193 (357)
T TIGR03158       156 LYDAKQLVGMLFLLAYMQLIRFFECRRKFVFLSATPDP  193 (357)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCH
T ss_conf             00676208999999999998633689808998279980


No 69 
>KOG0338 consensus
Probab=99.72  E-value=1.9e-15  Score=111.82  Aligned_cols=279  Identities=18%  Similarity=0.246  Sum_probs=161.9

Q ss_pred             EEECCCCCHHHH-HHHHHHHHHHCCC----CCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEEC--CHHHHHHHHCCC
Q ss_conf             995889986899-9999999997599----949999160465699999999855888815999858--978988873077
Q gi|255764515|r   22 IWASMGSGKTVS-VLTALSYIHLWGE----KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG--TVKQRTKVLKTP   94 (458)
Q Consensus        22 l~~~~G~GKT~~-al~~~~~l~~~~~----~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g--~~~~r~~~~~~~   94 (458)
                      -+..+|+|||.- ++-.++.|.+.+.    -++||+||+.-+.-|-.+-+.+.+.+-.+.+....|  +-+.-...+.+.
T Consensus       223 a~A~TGsGKTAAF~lPiLERLlYrPk~~~~TRVLVL~PTRELaiQv~sV~~qlaqFt~I~~~L~vGGL~lk~QE~~LRs~  302 (691)
T KOG0338         223 ACAATGSGKTAAFALPILERLLYRPKKVAATRVLVLVPTRELAIQVHSVTKQLAQFTDITVGLAVGGLDLKAQEAVLRSR  302 (691)
T ss_pred             HEECCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHC
T ss_conf             40114687114567889999852735676126999835089999999999998766040244452474578899998308


Q ss_pred             CCEEEECCCCHHHHHHHCCCCCCC-----CEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCH
Q ss_conf             986998064202334420001132-----204404531002465431156777766543059807996584023100101
Q gi|255764515|r   95 AVLYVINFENLGWLVQELKGTWPF-----ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDL  169 (458)
Q Consensus        95 ~~i~i~s~e~~~~~~~~~~~~~~~-----~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el  169 (458)
                      -+|+|.|...+   .+++.+...|     ..+|+|||.++-..   .-.--.+-+..+..+.+.-++.|||. ...+.||
T Consensus       303 PDIVIATPGRl---IDHlrNs~sf~ldsiEVLvlDEADRMLee---gFademnEii~lcpk~RQTmLFSATM-teeVkdL  375 (691)
T KOG0338         303 PDIVIATPGRL---IDHLRNSPSFNLDSIEVLVLDEADRMLEE---GFADEMNEIIRLCPKNRQTMLFSATM-TEEVKDL  375 (691)
T ss_pred             CCEEEECCHHH---HHHHCCCCCCCCCCEEEEEECHHHHHHHH---HHHHHHHHHHHHCCCCCCCEEEHHHH-HHHHHHH
T ss_conf             98799465058---88751588765343257773338889999---99999999998551023001211225-7889999


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEEC
Q ss_conf             34677517888775327788777369564033000024555545589999974245433200001001001100034524
Q gi|255764515|r  170 WGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPL  249 (458)
Q Consensus       170 ~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~l~~~~~~~~~v~l  249 (458)
                      .++ ++=.|                                                              ..  +.+..
T Consensus       376 ~sl-SL~kP--------------------------------------------------------------vr--ifvd~  390 (691)
T KOG0338         376 ASL-SLNKP--------------------------------------------------------------VR--IFVDP  390 (691)
T ss_pred             HHH-HCCCC--------------------------------------------------------------EE--EEECC
T ss_conf             975-51798--------------------------------------------------------------58--98578


Q ss_pred             CHHH-HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHHHCCCCCEEEEHH
Q ss_conf             5368-998889999998510334520223478888754203541000223430001343333256654124884034222
Q gi|255764515|r  250 PQPV-MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAY  328 (458)
Q Consensus       250 ~~~~-~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il~~~~~~kviif~  328 (458)
                      +... .+.-.++.+    -..+....                                 +--.+..++.+.-...++||.
T Consensus       391 ~~~~a~~LtQEFiR----IR~~re~d---------------------------------Rea~l~~l~~rtf~~~~ivFv  433 (691)
T KOG0338         391 NKDTAPKLTQEFIR----IRPKREGD---------------------------------REAMLASLITRTFQDRTIVFV  433 (691)
T ss_pred             CCCCCHHHHHHHHE----ECCCCCCC---------------------------------CHHHHHHHHHHHCCCCEEEEE
T ss_conf             65444044477810----05564444---------------------------------178999999876043369997


Q ss_pred             HHHHHHHHHH----------HCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHH
Q ss_conf             3678886641----------000265334458998764245885589984422111622001785999908998986864
Q gi|255764515|r  329 HFNSDLARLQ----------KAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQ  398 (458)
Q Consensus       329 ~~~~~~~~i~----------~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~  398 (458)
                      ..+....++.          ..+++.-+..+|-+.++.|.+.+++|||++ +.++-||++. +.-+||+|++|-+...+.
T Consensus       434 ~tKk~AHRl~IllGLlgl~agElHGsLtQ~QRlesL~kFk~~eidvLiaT-DvAsRGLDI~-gV~tVINy~mP~t~e~Y~  511 (691)
T KOG0338         434 RTKKQAHRLRILLGLLGLKAGELHGSLTQEQRLESLEKFKKEEIDVLIAT-DVASRGLDIE-GVQTVINYAMPKTIEHYL  511 (691)
T ss_pred             EHHHHHHHHHHHHHHHHCHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEEE-CHHHCCCCCC-CEEEEEECCCCHHHHHHH
T ss_conf             20877889999998730106655054108889999998774568779872-0444467765-516888426752689999


Q ss_pred             HHHHHHHCCCCHHCC
Q ss_conf             456666202202037
Q gi|255764515|r  399 QMIERIGVTRQRQAG  413 (458)
Q Consensus       399 Q~~gRi~~~r~hR~G  413 (458)
                      -++||-.  ||.|-|
T Consensus       512 HRVGRTA--RAGRaG  524 (691)
T KOG0338         512 HRVGRTA--RAGRAG  524 (691)
T ss_pred             HHHHHHH--HCCCCC
T ss_conf             8740033--245676


No 70 
>KOG0328 consensus
Probab=99.70  E-value=1.9e-15  Score=111.81  Aligned_cols=314  Identities=13%  Similarity=0.182  Sum_probs=184.2

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCHHHH-HHHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECC
Q ss_conf             8999999999679809995889986899-99999999975-999499991604656999999998558888159998589
Q gi|255764515|r    6 HQTKIVDWILDHKRCAIWASMGSGKTVS-VLTALSYIHLW-GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT   83 (458)
Q Consensus         6 ~Q~~~v~~~~~~~~~ll~~~~G~GKT~~-al~~~~~l~~~-~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~   83 (458)
                      -|..|+-.++..+..+.-..-|+|||.+ ++..+..+... .+-.+||+.|+.-+..|-++-+.-....-..+++...|.
T Consensus        53 IQqrAi~~IlkGrdViaQaqSGTGKTa~~si~vlq~~d~~~r~tQ~lilsPTRELa~Qi~~vi~alg~~mnvq~hacigg  132 (400)
T KOG0328          53 IQQRAIPQILKGRDVIAQAQSGTGKTATFSISVLQSLDISVRETQALILSPTRELAVQIQKVILALGDYMNVQCHACIGG  132 (400)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCEEEEEEEEEEECCCCCCEEEEEEECCHHHHHHHHHHHHHHHCCCCCCEEEEEECC
T ss_conf             77610245633661478704788844789866314034342003578954708999999999998324236448987357


Q ss_pred             H--HHHHHHHCCCCCEEEECCCCHHHHH-HHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             7--8988873077986998064202334-420001132204404531002465431156777766543059807996584
Q gi|255764515|r   84 V--KQRTKVLKTPAVLYVINFENLGWLV-QELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        84 ~--~~r~~~~~~~~~i~i~s~e~~~~~~-~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      .  .+..+.+...-+++.-+...+-... ...+......++|+|||..+-|..  -..+.+...+.+ +....+++.|||
T Consensus       133 ~n~gedikkld~G~hvVsGtPGrv~dmikr~~L~tr~vkmlVLDEaDemL~kg--fk~Qiydiyr~l-p~~~Qvv~~SAT  209 (400)
T KOG0328         133 KNLGEDIKKLDYGQHVVSGTPGRVLDMIKRRSLRTRAVKMLVLDEADEMLNKG--FKEQIYDIYRYL-PPGAQVVLVSAT  209 (400)
T ss_pred             CCCCHHHHHHCCCCEEEECCCCHHHHHHHHCCCCCCCEEEEEECCHHHHHHHH--HHHHHHHHHHHC-CCCCEEEEEECC
T ss_conf             75103456532561475079815999998623101142689854589998756--778899999847-998669999645


Q ss_pred             CHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             02310010134677517888775327788777369564033000024555545589999974245433200001001001
Q gi|255764515|r  161 PSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP  240 (458)
Q Consensus       161 Pi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~l~~~  240 (458)
                      -    |.|+.   .+              .+.|                                +           +.|
T Consensus       210 l----p~eil---em--------------t~kf--------------------------------m-----------tdp  225 (400)
T KOG0328         210 L----PHEIL---EM--------------TEKF--------------------------------M-----------TDP  225 (400)
T ss_pred             C----CHHHH---HH--------------HHHH--------------------------------C-----------CCC
T ss_conf             8----69999---99--------------9874--------------------------------4-----------885


Q ss_pred             C-EEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHHHCC
Q ss_conf             1-000345245368998889999998510334520223478888754203541000223430001343333256654124
Q gi|255764515|r  241 I-LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKA  319 (458)
Q Consensus       241 ~-~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il~~~  319 (458)
                      . .....-+++.+-.+.|       +....+                            +      .=|++.|.++.+..
T Consensus       226 vrilvkrdeltlEgIKqf-------~v~ve~----------------------------E------ewKfdtLcdLYd~L  264 (400)
T KOG0328         226 VRILVKRDELTLEGIKQF-------FVAVEK----------------------------E------EWKFDTLCDLYDTL  264 (400)
T ss_pred             EEEEEECCCCCHHHHHHH-------EEEECH----------------------------H------HHHHHHHHHHHHHH
T ss_conf             268870577766665554-------244132----------------------------2------55376898886430


Q ss_pred             CCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEEC
Q ss_conf             88403422236788866410----------00265334458998764245885589984422111622001785999908
Q gi|255764515|r  320 NAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFS  389 (458)
Q Consensus       320 ~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~  389 (458)
                      .=...+|||+.+..++-+.+          ..+++...++|.+++++|+.|+.+||+.+ ++-+-|++.|+- +.+|+||
T Consensus       265 tItQavIFcnTk~kVdwLtekm~~~nftVssmHGDm~qkERd~im~dFRsg~SrvLitT-DVwaRGiDv~qV-slviNYD  342 (400)
T KOG0328         265 TITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMEQKERDKIMNDFRSGKSRVLITT-DVWARGIDVQQV-SLVINYD  342 (400)
T ss_pred             EHHEEEEEECCCCHHHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEE-CHHHCCCCCCEE-EEEEECC
T ss_conf             61147999626404368899988617336630577645679999987654783499971-044425875005-7899437


Q ss_pred             CCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHH
Q ss_conf             9989868644566662022020378775289999858996899999999
Q gi|255764515|r  390 LWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR  438 (458)
Q Consensus       390 ~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~  438 (458)
                      +|-|...+.-++||-     .|.|.+  -.++.|+..+  |-+++.-++
T Consensus       343 LP~nre~YIHRIGRS-----GRFGRk--GvainFVk~~--d~~~lrdie  382 (400)
T KOG0328         343 LPNNRELYIHRIGRS-----GRFGRK--GVAINFVKSD--DLRILRDIE  382 (400)
T ss_pred             CCCCHHHHHHHHCCC-----CCCCCC--CEEEEEECHH--HHHHHHHHH
T ss_conf             885487876650135-----656776--0699875178--899999999


No 71 
>KOG0343 consensus
Probab=99.70  E-value=1e-14  Score=107.36  Aligned_cols=320  Identities=16%  Similarity=0.132  Sum_probs=184.1

Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCC-----CCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             789999999996798099958899868999-99999999759-----994999916046569999999985588881599
Q gi|255764515|r    5 PHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLWG-----EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         5 p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~-----~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~   78 (458)
                      .-|...+-..+...-.+-|.-+|+|||+.- +-.++.|...+     .-.+|||.|+.-+.-|-.+.+.+-.........
T Consensus        94 eiQ~~~Ip~aL~G~DvlGAAkTGSGKTLAFlvPvlE~L~r~kWs~~DGlGalIISPTRELA~QtFevL~kvgk~h~fSaG  173 (758)
T KOG0343          94 EIQRDTIPMALQGHDVLGAAKTGSGKTLAFLVPVLEALYRLKWSPTDGLGALIISPTRELALQTFEVLNKVGKHHDFSAG  173 (758)
T ss_pred             HHHHHHCCHHCCCCCCCCCCCCCCCCEEEEHHHHHHHHHHCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99876414220575000102358884465439999999971778878832699565299999999999987520564311


Q ss_pred             EEEC-CHHHHHHHHCCCCCEEEECCCCHHHHHHH--CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             9858-97898887307798699806420233442--00011322044045310024654311567777665430598079
Q gi|255764515|r   79 VITG-TVKQRTKVLKTPAVLYVINFENLGWLVQE--LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFI  155 (458)
Q Consensus        79 ~~~g-~~~~r~~~~~~~~~i~i~s~e~~~~~~~~--~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l  155 (458)
                      .+-| ..-..+..--..-.|+||+...+-...++  .+..-.-.++|+|||.++-..   .-.+...++....+..+..+
T Consensus       174 LiiGG~~~k~E~eRi~~mNILVCTPGRLLQHmde~~~f~t~~lQmLvLDEADR~LDM---GFk~tL~~Ii~~lP~~RQTL  250 (758)
T KOG0343         174 LIIGGKDVKFELERISQMNILVCTPGRLLQHMDENPNFSTSNLQMLVLDEADRMLDM---GFKKTLNAIIENLPKKRQTL  250 (758)
T ss_pred             EEECCCHHHHHHHHHHCCCEEEECHHHHHHHHHHCCCCCCCCCEEEEECCHHHHHHH---HHHHHHHHHHHHCCHHHEEE
T ss_conf             366571268899766257769966178998754167878776047873208889877---67888999987377233046


Q ss_pred             EECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             96584023100101346775178887753277887773695640330000245555455899999742454332000010
Q gi|255764515|r  156 ELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ  235 (458)
Q Consensus       156 ~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~  235 (458)
                      +.||||. ++..||. -+++-||..         +                                     .+..    
T Consensus       251 LFSATqt-~svkdLa-RLsL~dP~~---------v-------------------------------------svhe----  278 (758)
T KOG0343         251 LFSATQT-KSVKDLA-RLSLKDPVY---------V-------------------------------------SVHE----  278 (758)
T ss_pred             EEECCCC-HHHHHHH-HHHCCCCCE---------E-------------------------------------EEEC----
T ss_conf             6632551-1399999-753479857---------9-------------------------------------9723----


Q ss_pred             CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHH
Q ss_conf             01001100034524536899888999999851033452022347888875420354100022343000134333325665
Q gi|255764515|r  236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI  315 (458)
Q Consensus       236 ~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~i  315 (458)
                               ..+.-+|+....+                                          -.......|+++|-..
T Consensus       279 ---------~a~~atP~~L~Q~------------------------------------------y~~v~l~~Ki~~L~sF  307 (758)
T KOG0343         279 ---------NAVAATPSNLQQS------------------------------------------YVIVPLEDKIDMLWSF  307 (758)
T ss_pred             ---------CCCCCCHHHHHHE------------------------------------------EEEEEHHHHHHHHHHH
T ss_conf             ---------5333683645332------------------------------------------7997601478999999


Q ss_pred             HHCCCCCEEEEHHHHHHHHHHHHH------------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCC
Q ss_conf             412488403422236788866410------------00265334458998764245885589984422111622001785
Q gi|255764515|r  316 IEKANAAPIIVAYHFNSDLARLQK------------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN  383 (458)
Q Consensus       316 l~~~~~~kviif~~~~~~~~~i~~------------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~  383 (458)
                      +..+...+.|||...-..+.-+++            .++++++..+|.++.++|.....-||+|+ +.++-||++. |.+
T Consensus       308 I~shlk~K~iVF~SscKqvkf~~e~F~rlrpg~~l~~L~G~~~Q~~R~ev~~~F~~~~~~vLF~T-Dv~aRGLDFp-aVd  385 (758)
T KOG0343         308 IKSHLKKKSIVFLSSCKQVKFLYEAFCRLRPGIPLLALHGTMSQKKRIEVYKKFVRKRAVVLFCT-DVAARGLDFP-AVD  385 (758)
T ss_pred             HHHCCCCCEEEEEEHHHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHCCEEEEEE-HHHHCCCCCC-CCC
T ss_conf             98452543699986006899999999850899832542163137788999999987555589860-2554368986-433


Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             999908998986864456666202202037877528999985899689999999999
Q gi|255764515|r  384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       384 ~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
                      +||-+|+|-+..++.-+.||..     |++..-..  +.++++ +=+|.+.+.+.+|
T Consensus       386 wViQ~DCPedv~tYIHRvGRtA-----R~~~~G~s--ll~L~p-sEeE~~l~~Lq~k  434 (758)
T KOG0343         386 WVIQVDCPEDVDTYIHRVGRTA-----RYKERGES--LLMLTP-SEEEAMLKKLQKK  434 (758)
T ss_pred             EEEEECCCHHHHHHHHHHHHHH-----CCCCCCCE--EEEECC-HHHHHHHHHHHHC
T ss_conf             6998068205889998721221-----13677856--899763-1699999999875


No 72 
>KOG0340 consensus
Probab=99.67  E-value=8.1e-14  Score=101.94  Aligned_cols=304  Identities=15%  Similarity=0.191  Sum_probs=172.6

Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCHHHH-HHHHHHHHHHCCC-CCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEE
Q ss_conf             478999999999679809995889986899-9999999997599-94999916046569999999985588881599985
Q gi|255764515|r    4 APHQTKIVDWILDHKRCAIWASMGSGKTVS-VLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT   81 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~-al~~~~~l~~~~~-~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~   81 (458)
                      -|-|...+-++++.+.|+=+.-+|+|||.. |+-.+..+...+. --.||++|+.-+.-|-.+.|.--...-.+++.++.
T Consensus        31 TpiQ~~cIpkILeGrdcig~AkTGsGKT~AFaLPil~rLsedP~giFalvlTPTrELA~QiaEQF~alGk~l~lK~~viv  110 (442)
T KOG0340          31 TPIQQACIPKILEGRDCIGCAKTGSGKTAAFALPILNRLSEDPYGIFALVLTPTRELALQIAEQFIALGKLLNLKVSVIV  110 (442)
T ss_pred             CCHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             82676524878546631031346887411222787776133887606999545288888888999984564563279997


Q ss_pred             CCHH-HHHH-HHCCCCCEEEECCCCHHHHHHHCCCCCC-----CCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEE
Q ss_conf             8978-9888-7307798699806420233442000113-----2204404531002465431156777766543059807
Q gi|255764515|r   82 GTVK-QRTK-VLKTPAVLYVINFENLGWLVQELKGTWP-----FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERF  154 (458)
Q Consensus        82 g~~~-~r~~-~~~~~~~i~i~s~e~~~~~~~~~~~~~~-----~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~  154 (458)
                      |... -... .+...-+++++|.+.+......-.....     -..+++|||.++-+..   ...-...+....+..+-.
T Consensus       111 GG~d~i~qa~~L~~rPHvVvatPGRlad~l~sn~~~~~~~~~rlkflVlDEADrvL~~~---f~d~L~~i~e~lP~~RQt  187 (442)
T KOG0340         111 GGTDMIMQAAILSDRPHVVVATPGRLADHLSSNLGVCSWIFQRLKFLVLDEADRVLAGC---FPDILEGIEECLPKPRQT  187 (442)
T ss_pred             CCHHHHHHHHHCCCCCCEEECCCCCCCCCCCCCCCCCHHHHHCEEEEEECCHHHHHCCC---HHHHHHHHHCCCCCCCCE
T ss_conf             56887645444266987575176333541126876552555300467741302654156---056776665048876433


Q ss_pred             EEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99658402310010134677517888775327788777369564033000024555545589999974245433200001
Q gi|255764515|r  155 IELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY  234 (458)
Q Consensus       155 l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~  234 (458)
                      +++||| +.+...+++..     |   ...+ ..|+            +                            +-.
T Consensus       188 LlfSAT-itd~i~ql~~~-----~---i~k~-~a~~------------~----------------------------e~~  217 (442)
T KOG0340         188 LLFSAT-ITDTIKQLFGC-----P---ITKS-IAFE------------L----------------------------EVI  217 (442)
T ss_pred             EEEEEE-HHHHHHHHHCC-----C---CCCC-CCEE------------E----------------------------ECC
T ss_conf             799866-36579986368-----7---4555-0268------------8----------------------------526


Q ss_pred             CCCCCCCE-EEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHH
Q ss_conf             00100110-00345245368998889999998510334520223478888754203541000223430001343333256
Q gi|255764515|r  235 QNIDKPIL-ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE  313 (458)
Q Consensus       235 ~~l~~~~~-~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~  313 (458)
                      .+.+.+.. .....-.+.....+|-                                                  +..|.
T Consensus       218 ~~vstvetL~q~yI~~~~~vkdaYL--------------------------------------------------v~~Lr  247 (442)
T KOG0340         218 DGVSTVETLYQGYILVSIDVKDAYL--------------------------------------------------VHLLR  247 (442)
T ss_pred             CCCCCHHHHHHHEEECCHHHHHHHH--------------------------------------------------HHHHH
T ss_conf             9987254552022205444567889--------------------------------------------------98775


Q ss_pred             HHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCC
Q ss_conf             65412488403422236788866410----------00265334458998764245885589984422111622001785
Q gi|255764515|r  314 VIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN  383 (458)
Q Consensus       314 ~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~  383 (458)
                      +.-++ +...++||.+-..+-..+..          .++.-++..+|-.++.+|+++..++||++ ++++-||+... ..
T Consensus       248 ~~~~~-~~~simIFvnttr~cQ~l~~~l~~le~r~~~lHs~m~Q~eR~~aLsrFrs~~~~iliaT-DVAsRGLDIP~-V~  324 (442)
T KOG0340         248 DFENK-ENGSIMIFVNTTRECQLLSMTLKNLEVRVVSLHSQMPQKERLAALSRFRSNAARILIAT-DVASRGLDIPT-VE  324 (442)
T ss_pred             HHHHC-CCCEEEEEEEHHHHHHHHHHHHHHHCEEEEEHHHCCHHHHHHHHHHHHHHCCCCEEEEE-CHHHCCCCCCC-EE
T ss_conf             22213-57608999604689999999996303445431100508889989987762674089973-13432789884-46


Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCHHCCCC
Q ss_conf             99990899898686445666620220203787
Q gi|255764515|r  384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK  415 (458)
Q Consensus       384 ~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~  415 (458)
                      .||++|+|-.|..+.-+.||-.  ||.|.|..
T Consensus       325 LVvN~diPr~P~~yiHRvGRtA--RAGR~G~a  354 (442)
T KOG0340         325 LVVNHDIPRDPKDYIHRVGRTA--RAGRKGMA  354 (442)
T ss_pred             EEEECCCCCCHHHHHHHHCCHH--CCCCCCCE
T ss_conf             7870688998788887603012--05677642


No 73 
>KOG0347 consensus
Probab=99.65  E-value=9.8e-14  Score=101.46  Aligned_cols=337  Identities=15%  Similarity=0.160  Sum_probs=187.6

Q ss_pred             CEEEEECCCCCHHHHH-HHHHHHHHH-------------CCCC-CEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECC
Q ss_conf             8099958899868999-999999997-------------5999-499991604656999999998558888159998589
Q gi|255764515|r   19 RCAIWASMGSGKTVSV-LTALSYIHL-------------WGEK-SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT   83 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~a-l~~~~~l~~-------------~~~~-~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~   83 (458)
                      -.+=++++|+|||+.- |-+++.+..             .+.+ -.|||+|+.-+..|-...|..-...+.+.+..++|.
T Consensus       221 DIlGaAeTGSGKTLAFGIPiv~~l~~~s~~s~e~~~~~~k~~k~~~LV~tPTRELa~QV~~Hl~ai~~~t~i~v~si~GG  300 (731)
T KOG0347         221 DILGAAETGSGKTLAFGIPIVERLLESSDDSQELSNTSAKYVKPIALVVTPTRELAHQVKQHLKAIAEKTQIRVASITGG  300 (731)
T ss_pred             HCCCCCCCCCCCEEEECCHHHHHHHHCCCHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCEEEEEEECH
T ss_conf             00033346887424412325454330365376544677605764038963709999999999998613467278875230


Q ss_pred             --HHHHHHHHCCCCCEEEECCCCHHHHHHH----CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCC----E
Q ss_conf             --7898887307798699806420233442----00011322044045310024654311567777665430598----0
Q gi|255764515|r   84 --VKQRTKVLKTPAVLYVINFENLGWLVQE----LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESE----R  153 (458)
Q Consensus        84 --~~~r~~~~~~~~~i~i~s~e~~~~~~~~----~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~----~  153 (458)
                        ...-..+++...+|+|.|...+=-+.++    +....+..++|+||+-++--  ...-.-..+.+..+....+    .
T Consensus       301 LavqKQqRlL~~~p~IVVATPGRlweli~e~n~~l~~~k~vkcLVlDEaDRmve--kghF~Els~lL~~L~e~~~~~qrQ  378 (731)
T KOG0347         301 LAVQKQQRLLNQRPDIVVATPGRLWELIEEDNTHLGNFKKVKCLVLDEADRMVE--KGHFEELSKLLKHLNEEQKNRQRQ  378 (731)
T ss_pred             HHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHHHHHHCEEEEECCHHHHHH--HCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             579999999852998799366289999975106664233240788734777755--110999999999860311051012


Q ss_pred             EEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             79965840231001013467751788877532778877736956403300002455554558999997424543320000
Q gi|255764515|r  154 FIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD  233 (458)
Q Consensus       154 ~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~  233 (458)
                      -+..|||-.         +.... |   +..      .+    ......         ......+...+....++-. +.
T Consensus       379 TlVFSATlt---------~~~~~-~---~~~------~~----k~~~k~---------~~~~~kiq~Lmk~ig~~~k-pk  425 (731)
T KOG0347         379 TLVFSATLT---------LVLQQ-P---LSS------SR----KKKDKE---------DELNAKIQHLMKKIGFRGK-PK  425 (731)
T ss_pred             EEEEEEEEE---------HHHCC-H---HHH------HH----HCCCHH---------HHHHHHHHHHHHHHCCCCC-CE
T ss_conf             589987763---------33217-0---577------65----422114---------5566799999998475689-82


Q ss_pred             CCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHH
Q ss_conf             10010011000345245368998889999998510334520223478888754203541000223430001343333256
Q gi|255764515|r  234 YQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE  313 (458)
Q Consensus       234 ~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~  313 (458)
                                  .+++++...-+-. + .+.                      .+.|.+.             +|--.+.
T Consensus       426 ------------iiD~t~q~~ta~~-l-~Es----------------------~I~C~~~-------------eKD~yly  456 (731)
T KOG0347         426 ------------IIDLTPQSATAST-L-TES----------------------LIECPPL-------------EKDLYLY  456 (731)
T ss_pred             ------------EEECCCCHHHHHH-H-HHH----------------------HHCCCCC-------------CCCEEEE
T ss_conf             ------------6766820447888-8-877----------------------6358854-------------4540689


Q ss_pred             HHHHCCCCCEEEEHHHHHHHHHHHHHCC----------CCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCC
Q ss_conf             6541248840342223678886641000----------265334458998764245885589984422111622001785
Q gi|255764515|r  314 VIIEKANAAPIIVAYHFNSDLARLQKAF----------PQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN  383 (458)
Q Consensus       314 ~il~~~~~~kviif~~~~~~~~~i~~~~----------~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~  383 (458)
                      -++....|+ -+||||-...+.+|...+          +..+...+|-..+++|.+....|||++ ++++-||+++ +..
T Consensus       457 Yfl~ryPGr-TlVF~NsId~vKRLt~~L~~L~i~p~~LHA~M~QKqRLknLEkF~~~~~~VLiaT-DVAARGLDIp-~V~  533 (731)
T KOG0347         457 YFLTRYPGR-TLVFCNSIDCVKRLTVLLNNLDIPPLPLHASMIQKQRLKNLEKFKQSPSGVLIAT-DVAARGLDIP-GVQ  533 (731)
T ss_pred             EEEEECCCC-EEEEECHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEE-HHHHCCCCCC-CCC
T ss_conf             988636983-5998411889999999974169997102577889999876998744888179962-3444258887-863


Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECC---------------------CHHHHHHHHHHHHHH
Q ss_conf             99990899898686445666620220203787752899998589---------------------968999999999999
Q gi|255764515|r  384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN---------------------TIDELVLQRLRTKST  442 (458)
Q Consensus       384 ~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~---------------------tide~i~~~~~~K~~  442 (458)
                      +||||..|-+...+.-+-||-.|  |.    ...|.+ .|+.++                     .+++.++..+.+...
T Consensus       534 HVIHYqVPrtseiYVHRSGRTAR--A~----~~Gvsv-ml~~P~e~~~~~KL~ktL~k~~dlpifPv~~~~m~~lkeRvr  606 (731)
T KOG0347         534 HVIHYQVPRTSEIYVHRSGRTAR--AN----SEGVSV-MLCGPQEVGPLKKLCKTLKKKEDLPIFPVETDIMDALKERVR  606 (731)
T ss_pred             EEEEEECCCCCCEEEECCCCCCC--CC----CCCEEE-EEECHHHHHHHHHHHHHHHHCCCCCCEECCHHHHHHHHHHHH
T ss_conf             67896068753246762665322--56----788379-986817757899999987323677730021789999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999985
Q gi|255764515|r  443 IQDLLLN  449 (458)
Q Consensus       443 ~~~~~~~  449 (458)
                      ++..+-+
T Consensus       607 LA~ei~~  613 (731)
T KOG0347         607 LAREIDK  613 (731)
T ss_pred             HHHHHHH
T ss_conf             9998887


No 74 
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]
Probab=99.64  E-value=4.6e-14  Score=103.41  Aligned_cols=152  Identities=19%  Similarity=0.219  Sum_probs=103.5

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHH-HHHCCCCCCEEEEE
Q ss_conf             87478999999999679809995889986899999999999759994999916046569999999-98558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEV-QRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei-~kf~~~~~~~~~~~   80 (458)
                      +|.|+|.+|+..+....+.+++..+|+|||+.+-.++......|. ++...+|--.+.||=..|+ .+|... .-.+.++
T Consensus       119 ~LD~fQ~~a~~~Ler~esVlV~ApTssGKTvVaeyAi~~al~~~q-rviYTsPIKALsNQKyrdl~~~fgdv-~~~vGL~  196 (1041)
T COG4581         119 ELDPFQQEAIAILERGESVLVCAPTSSGKTVVAEYAIALALRDGQ-RVIYTSPIKALSNQKYRDLLAKFGDV-ADMVGLM  196 (1041)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHCCC-CEEECCCHHHHHHHHHHHHHHHHHHH-HHHCCCE
T ss_conf             967899999999847995799733789855599999999987189-44861630664206799999986005-6540401


Q ss_pred             ECCHHHHHHHHCCCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             58978988873077986998064202334420-00113220440453100246543115677776654305980799658
Q gi|255764515|r   81 TGTVKQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTG  159 (458)
Q Consensus        81 ~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTg  159 (458)
                      +|+.     ..+.+..+.|++-|-+++....- ....+-..||+||.|.+.....+  . .-..+..+.++.-+.++|||
T Consensus       197 TGDv-----~IN~~A~clvMTTEILRnMlyrg~~~~~~i~~ViFDEvHyi~D~eRG--~-VWEE~Ii~lP~~v~~v~LSA  268 (1041)
T COG4581         197 TGDV-----SINPDAPCLVMTTEILRNMLYRGSESLRDIEWVVFDEVHYIGDRERG--V-VWEEVIILLPDHVRFVFLSA  268 (1041)
T ss_pred             ECCE-----EECCCCCEEEEEHHHHHHHHCCCCCCCCCCCEEEEEEEEECCCCCCC--H-HHHHHHHHCCCCCCEEEEEC
T ss_conf             0543-----42799966886099999986258610135306888766650463221--2-57899986677776899967


Q ss_pred             CCHHH
Q ss_conf             40231
Q gi|255764515|r  160 TPSPN  164 (458)
Q Consensus       160 TPi~n  164 (458)
                      | ++|
T Consensus       269 T-v~N  272 (1041)
T COG4581         269 T-VPN  272 (1041)
T ss_pred             C-CCC
T ss_conf             8-898


No 75 
>KOG0335 consensus
Probab=99.64  E-value=6.5e-14  Score=102.53  Aligned_cols=309  Identities=19%  Similarity=0.205  Sum_probs=171.2

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCC-----------CCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             874789999999996798099958899868999-99999999759-----------994999916046569999999985
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLWG-----------EKSVLVIAPLRVAQSVWTSEVQRW   69 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~-----------~~~~LIv~P~~l~~~~W~~Ei~kf   69 (458)
                      +.-|.|+-++.-+.+.+....++++|+|||.-= +-++.++...+           ....||++|++-+.+|-..|..||
T Consensus        96 ~ptpvQk~sip~i~~GrdlmacAqTGsGKT~aFLiPii~~~~~~~~~~~~~~~~~~~P~~lIlapTReL~~Qi~nea~k~  175 (482)
T KOG0335          96 KPTPVQKYSIPIISGGRDLMACAQTGSGKTAAFLIPIISYLLDEGPEDRGESGGGVYPRALILAPTRELVDQIYNEARKF  175 (482)
T ss_pred             CCCCCEECCCCEEECCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHH
T ss_conf             89861560422442588427882578851378888899999864865666567788972599817378766788888764


Q ss_pred             CCCCCCEEEEEECCHHHHHHH--HCCCCCEEEECCCCHHHHHHHCCCC-CCCCEEECCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             588881599985897898887--3077986998064202334420001-1322044045310024654311567777665
Q gi|255764515|r   70 SNFSHMNISVITGTVKQRTKV--LKTPAVLYVINFENLGWLVQELKGT-WPFATIVVDESTKLKSFRLRQGSKTARALAK  146 (458)
Q Consensus        70 ~~~~~~~~~~~~g~~~~r~~~--~~~~~~i~i~s~e~~~~~~~~~~~~-~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~  146 (458)
                      .....++..+..|..+.+...  .....+++++|...+..+.+.-.-. ..-.++|+|||-++-..-+-           
T Consensus       176 ~~~s~~~~~~~ygg~~~~~q~~~~~~gcdIlvaTpGrL~d~~e~g~i~l~~~k~~vLDEADrMlD~mgF-----------  244 (482)
T KOG0335         176 SYLSGMKSVVVYGGTDLGAQLRFIKRGCDILVATPGRLKDLIERGKISLDNCKFLVLDEADRMLDEMGF-----------  244 (482)
T ss_pred             CCCCCCEEEEEECCCCHHHHHHHHCCCCCEEEECCCHHHHHHHCCEEEHHHCCEEEECCHHHHHHHCCC-----------
T ss_conf             022122033005784454422333257557885575056455415112623858995236776663266-----------


Q ss_pred             HHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             43059807996584023100101346775178887753277887773695640330000245555455899999742454
Q gi|255764515|r  147 PAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCC  226 (458)
Q Consensus       147 ~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~  226 (458)
                       ..+...++.-+++|..|.-.-+           .|..   +|-..    .                 .......+.+..
T Consensus       245 -~p~Ir~Iv~~~~~~~~~~~qt~-----------mFSA---tfp~~----i-----------------q~l~~~fl~~~y  288 (482)
T KOG0335         245 -EPQIRKIVEQLGMPPKNNRQTL-----------LFSA---TFPKE----I-----------------QRLAADFLKDNY  288 (482)
T ss_pred             -CHHHHHHHCCCCCCCCCCEEEE-----------EEEC---CCCHH----H-----------------HHHHHHHHHHCC
T ss_conf             -6207999625588874661378-----------8735---57756----6-----------------644788764151


Q ss_pred             HHHHCCCCCCCCCCCE-EEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCC
Q ss_conf             3320000100100110-003452453689988899999985103345202234788887542035410002234300013
Q gi|255764515|r  227 LSLDIADYQNIDKPIL-ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVH  305 (458)
Q Consensus       227 ~~~~~~~~~~l~~~~~-~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~  305 (458)
                      +.........-..... ...+|.-.                                                       
T Consensus       289 i~laV~rvg~~~~ni~q~i~~V~~~-------------------------------------------------------  313 (482)
T KOG0335         289 IFLAVGRVGSTSENITQKILFVNEM-------------------------------------------------------  313 (482)
T ss_pred             EEEEEEEECCCCCCCEEEEEEECCH-------------------------------------------------------
T ss_conf             3888753046665634676642111-------------------------------------------------------


Q ss_pred             CCCCCCHHHHHH---------CCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEE
Q ss_conf             433332566541---------2488403422236788866410----------002653344589987642458855899
Q gi|255764515|r  306 DEKIKALEVIIE---------KANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLF  366 (458)
Q Consensus       306 ~~k~~~l~~il~---------~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli  366 (458)
                       .|...|.+++.         +...++++||+.-+...+.+..          .+++..+..+|...++.|.+|+.+++|
T Consensus       314 -~kr~~Lldll~~~~~~~~~~~~~~e~tlvFvEt~~~~d~l~~~l~~~~~~~~sIhg~~tq~er~~al~~Fr~g~~pvlV  392 (482)
T KOG0335         314 -EKRSKLLDLLNKDDGPPSDGEPKWEKTLVFVETKRGADELAAFLSSNGYPAKSIHGDRTQIEREQALNDFRNGKAPVLV  392 (482)
T ss_pred             -HHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHCCCCCCEEECCHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             -3578999886134678665776431389996130032699999861798745603325563799998776469866798


Q ss_pred             EEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEE
Q ss_conf             844221116220017859999089989868644566662022020378775289
Q gi|255764515|r  367 AHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV  420 (458)
Q Consensus       367 ~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v  420 (458)
                      ++ ..++-|||... ..+||.||+|-+-.++.-++||-     -|-|+.-..+.
T Consensus       393 aT-~VaaRGlDi~~-V~hVInyDmP~d~d~YvHRIGRT-----GR~Gn~G~ats  439 (482)
T KOG0335         393 AT-NVAARGLDIPN-VKHVINYDMPADIDDYVHRIGRT-----GRVGNGGRATS  439 (482)
T ss_pred             EE-HHHHCCCCCCC-CCEEEEEECCCCHHHHHHHCCCC-----CCCCCCCEEEE
T ss_conf             70-36654788768-74358863675246677741543-----55777732688


No 76 
>KOG0342 consensus
Probab=99.63  E-value=1.7e-13  Score=99.93  Aligned_cols=310  Identities=17%  Similarity=0.204  Sum_probs=173.9

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHH-HHHHHHHHCC-----CCCEEEEECCHHHHHHHHHHHHHHCCC-CCC
Q ss_conf             747899999999967980999588998689999-9999999759-----994999916046569999999985588-881
Q gi|255764515|r    3 LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVL-TALSYIHLWG-----EKSVLVIAPLRVAQSVWTSEVQRWSNF-SHM   75 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al-~~~~~l~~~~-----~~~~LIv~P~~l~~~~W~~Ei~kf~~~-~~~   75 (458)
                      |-|-|...+.-++..+..+.+.-+|+|||+-=+ -+++.+....     .-.++||||+.-+..|-..|.+.-... +..
T Consensus       105 MT~VQ~~ti~pll~gkDvl~~AKTGtGKTlAFLiPaie~l~k~~~~~r~~~~vlIi~PTRELA~Q~~~eak~Ll~~h~~~  184 (543)
T KOG0342         105 MTPVQQKTIPPLLEGKDVLAAAKTGTGKTLAFLLPAIELLRKLKFKPRNGTGVLIICPTRELAMQIFAEAKELLKYHESI  184 (543)
T ss_pred             CHHHHHHHCCCCCCCCCCEEEECCCCCCEEEEHHHHHHHHHHCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             02888742676679843124512688741010468999998536577787148996562899998999999999727677


Q ss_pred             EEEEEECCHHHHH--HHHCCCCCEEEECCCCHHHHHHHCCC--CCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             5999858978988--87307798699806420233442000--1132204404531002465431156777766543059
Q gi|255764515|r   76 NISVITGTVKQRT--KVLKTPAVLYVINFENLGWLVQELKG--TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWES  151 (458)
Q Consensus        76 ~~~~~~g~~~~r~--~~~~~~~~i~i~s~e~~~~~~~~~~~--~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~  151 (458)
                      .+.++-|....+.  +.+.....++|.|...+....+....  ...-+++|+|||-++-..+-.   .-.+.+.++-.+-
T Consensus       185 ~v~~viGG~~~~~e~~kl~k~~niliATPGRLlDHlqNt~~f~~r~~k~lvlDEADrlLd~GF~---~di~~Ii~~lpk~  261 (543)
T KOG0342         185 TVGIVIGGNNFSVEADKLVKGCNILIATPGRLLDHLQNTSGFLFRNLKCLVLDEADRLLDIGFE---EDVEQIIKILPKQ  261 (543)
T ss_pred             CEEEEECCCCCHHHHHHHHCCCCEEEECCCHHHHHHHCCCCCHHHCCCEEEEECCHHHHHCCCH---HHHHHHHHHCCCC
T ss_conf             3478767741058999751555278867841776765578412212203575020356652518---8899998752355


Q ss_pred             CEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             80799658402310010134677517888775327788777369564033000024555545589999974245433200
Q gi|255764515|r  152 ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI  231 (458)
Q Consensus       152 ~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~  231 (458)
                      ...++.|||- +....++.   .                                             -.+..-..   .
T Consensus       262 rqt~LFSAT~-~~kV~~l~---~---------------------------------------------~~L~~d~~---~  289 (543)
T KOG0342         262 RQTLLFSATQ-PSKVKDLA---R---------------------------------------------GALKRDPV---F  289 (543)
T ss_pred             CCEEEEECCC-CHHHHHHH---H---------------------------------------------HHHCCCCE---E
T ss_conf             3046764789-68899999---8---------------------------------------------76337746---8


Q ss_pred             CCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCC
Q ss_conf             00100100110003452453689988899999985103345202234788887542035410002234300013433332
Q gi|255764515|r  232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKA  311 (458)
Q Consensus       232 ~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~  311 (458)
                      .++.+--.           .+..                            .++.|           +......+.++-.
T Consensus       290 v~~~d~~~-----------~~Th----------------------------e~l~Q-----------gyvv~~~~~~f~l  319 (543)
T KOG0342         290 VNVDDGGE-----------RETH----------------------------ERLEQ-----------GYVVAPSDSRFSL  319 (543)
T ss_pred             EECCCCCC-----------CCHH----------------------------HCCCC-----------EEEECCCCCHHHH
T ss_conf             62478997-----------3023----------------------------24664-----------0796265411799


Q ss_pred             HHHHHHCCCC-CEEEEHHHHHHHHH---HH-------HHCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCC
Q ss_conf             5665412488-40342223678886---64-------1000265334458998764245885589984422111622001
Q gi|255764515|r  312 LEVIIEKANA-APIIVAYHFNSDLA---RL-------QKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQY  380 (458)
Q Consensus       312 l~~il~~~~~-~kviif~~~~~~~~---~i-------~~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~  380 (458)
                      +..++.+..+ .|++||+..-....   .+       .-.++++.+..+|.....+|.+.+.-||+|| ++++-|+|+. 
T Consensus       320 l~~~LKk~~~~~KiiVF~sT~~~vk~~~~lL~~~dlpv~eiHgk~~Q~kRT~~~~~F~kaesgIL~cT-DVaARGlD~P-  397 (543)
T KOG0342         320 LYTFLKKNIKRYKIIVFFSTCMSVKFHAELLNYIDLPVLEIHGKQKQNKRTSTFFEFCKAESGILVCT-DVAARGLDIP-  397 (543)
T ss_pred             HHHHHHHHCCCCEEEEEECHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCCHHHHHHHHCCCCEEEEC-CHHHCCCCCC-
T ss_conf             99999973477249999330267999999985068753244257853220238998861066439960-3221368888-


Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEEC
Q ss_conf             7859999089989868644566662022020378775289999858
Q gi|255764515|r  381 GGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQ  426 (458)
Q Consensus       381 a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~  426 (458)
                      ..+.||-|++|-+|..+.-|+||-.     |.|-+  -..+.++++
T Consensus       398 ~V~~VvQ~~~P~d~~~YIHRvGRTa-----R~gk~--G~alL~l~p  436 (543)
T KOG0342         398 DVDWVVQYDPPSDPEQYIHRVGRTA-----REGKE--GKALLLLAP  436 (543)
T ss_pred             CCEEEEEECCCCCHHHHHHHHCCCC-----CCCCC--CEEEEEECH
T ss_conf             8407998589999899898732122-----36898--638999676


No 77 
>KOG0351 consensus
Probab=99.61  E-value=5e-14  Score=103.23  Aligned_cols=298  Identities=17%  Similarity=0.221  Sum_probs=170.3

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160-4656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      .++|-|.++|..++..+.+.+.+++|.||.+.=  -+-.+...  +-+|||.|. ||+.+|    +.+. ....+....+
T Consensus       264 ~FR~~Q~eaI~~~l~Gkd~fvlmpTG~GKSLCY--QlPA~l~~--gitvVISPL~SLm~DQ----v~~L-~~~~I~a~~L  334 (941)
T KOG0351         264 GFRPNQLEAINATLSGKDCFVLMPTGGGKSLCY--QLPALLLG--GVTVVISPLISLMQDQ----VTHL-SKKGIPACFL  334 (941)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEEEECCCCEEEEE--ECCCCCCC--CCEEEECCHHHHHHHH----HHHH-HHCCCCEEEC
T ss_conf             588439999999974884699953488625676--66610138--9369963389999999----9743-2148541323


Q ss_pred             ECC--HHHHHHHHC----C--CCCEEEECCCCHHHH---H---HHCCCCCCCCEEECCCCCCCCCCCCC-CHHHHHHHHH
Q ss_conf             589--789888730----7--798699806420233---4---42000113220440453100246543-1156777766
Q gi|255764515|r   81 TGT--VKQRTKVLK----T--PAVLYVINFENLGWL---V---QELKGTWPFATIVVDESTKLKSFRLR-QGSKTARALA  145 (458)
Q Consensus        81 ~g~--~~~r~~~~~----~--~~~i~i~s~e~~~~~---~---~~~~~~~~~~~iIiDEaH~lkn~~~~-~~s~~~~~l~  145 (458)
                      .+.  ...+...+.    .  ...++-+|.|++...   .   ..+.....-.++|+||||-+..++-. +.  .++.+.
T Consensus       335 ~s~q~~~~~~~i~q~l~~~~~~ikilYvtPE~v~~~~~l~~~~~~L~~~~~lal~vIDEAHCVSqWgHdFRp--~Yk~l~  412 (941)
T KOG0351         335 SSIQTAAERLAILQKLANGNPIIKILYVTPEKVVASEGLLESLADLYARGLLALFVIDEAHCVSQWGHDFRP--SYKRLG  412 (941)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCEEEEEEECHHHHHCCCCHHHHHHHCCCCCEEEEEEECHHHHHHHHCCCCCH--HHHHHH
T ss_conf             565668889999999857887678999677886333215667875067870488872278876642233347--789999


Q ss_pred             HHHHCCC--EEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5430598--07996584023100101346775178887753277887773695640330000245555455899999742
Q gi|255764515|r  146 KPAWESE--RFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLS  223 (458)
Q Consensus       146 ~~~~~~~--~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~  223 (458)
                      .+..+.+  -.++||||-...=-.|+-..|++-+|. .+..+                                      
T Consensus       413 ~l~~~~~~vP~iALTATAT~~v~~DIi~~L~l~~~~-~~~~s--------------------------------------  453 (941)
T KOG0351         413 LLRIRFPGVPFIALTATATERVREDVIRSLGLRNPE-LFKSS--------------------------------------  453 (941)
T ss_pred             HHHHHCCCCCEEEEEHHCCHHHHHHHHHHHCCCCCC-EECCC--------------------------------------
T ss_conf             998527899768753002088999999982788863-22256--------------------------------------


Q ss_pred             HHHHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHH
Q ss_conf             45433200001001001100034524536899888999999851033452022347888875420354100022343000
Q gi|255764515|r  224 DCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKE  303 (458)
Q Consensus       224 ~~~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~  303 (458)
                                 .+  ++. +...|.....                    .                              
T Consensus       454 -----------fn--R~N-L~yeV~~k~~--------------------~------------------------------  469 (941)
T KOG0351         454 -----------FN--RPN-LKYEVSPKTD--------------------K------------------------------  469 (941)
T ss_pred             -----------CC--CCC-CEEEEEECCC--------------------C------------------------------
T ss_conf             -----------79--988-5599985667--------------------5------------------------------


Q ss_pred             CCCCCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHH----------HCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCC
Q ss_conf             13433332566541248840342223678886641----------00026533445899876424588558998442211
Q gi|255764515|r  304 VHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQ----------KAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG  373 (458)
Q Consensus       304 ~~~~k~~~l~~il~~~~~~kviif~~~~~~~~~i~----------~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~  373 (458)
                        +.-+..+..+-....+...||||....+-+.+.          ..++.|.+..+|..+-..|..++.+|+++++ |-|
T Consensus       470 --~~~~~~~~~~~~~~~~~s~IIYC~sr~~ce~vs~~L~~~~~~a~~YHAGl~~~~R~~Vq~~w~~~~~~VivATV-AFG  546 (941)
T KOG0351         470 --DALLDILEESKLRHPDQSGIIYCLSRKECEQVSAVLRSLGKSAAFYHAGLPPKERETVQKAWMSDKIRVIVATV-AFG  546 (941)
T ss_pred             --CCHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHCHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEEE-ECC
T ss_conf             --31688988765128999837996882319999999987352057552678878889999998568870899985-224


Q ss_pred             CCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             1622001785999908998986864456666202202037877528999
Q gi|255764515|r  374 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       374 ~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                      .|||-.. ...||||.+|-+...+-|-.||.     -|.|+...|..|+
T Consensus       547 MGIdK~D-VR~ViH~~lPks~E~YYQE~GRA-----GRDG~~s~C~l~y  589 (941)
T KOG0351         547 MGIDKPD-VRFVIHYSLPKSFEGYYQEAGRA-----GRDGLPSSCVLLY  589 (941)
T ss_pred             CCCCCCC-EEEEEECCCCHHHHHHHHHCCCC-----CCCCCCCEEEEEC
T ss_conf             7877786-35999777861478888740336-----7678800267742


No 78 
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]
Probab=99.60  E-value=1.2e-12  Score=94.85  Aligned_cols=157  Identities=14%  Similarity=0.034  Sum_probs=87.2

Q ss_pred             CCHHHHHHHHHHHHC---C-CEEEEECCCCCHHHHHHHHHHHHHHC---CCCCEEEEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             747899999999967---9-80999588998689999999999975---9994999916046569999999985588881
Q gi|255764515|r    3 LAPHQTKIVDWILDH---K-RCAIWASMGSGKTVSVLTALSYIHLW---GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHM   75 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~---~-~~ll~~~~G~GKT~~al~~~~~l~~~---~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~   75 (458)
                      .+|+|..+++.....   . ...|-+++|.|||..++..+......   ...+++.|.|-+.+.++-.+.+..+......
T Consensus       196 ~~~~~~~~~~~~~~~~~~~~~~vl~aPTG~GKT~asl~~a~~~~~~~~~~~~r~i~vlP~~t~ie~~~~r~~~~~~~~~~  275 (733)
T COG1203         196 GYELQEKALELILRLEKRSLLVVLEAPTGYGKTEASLILALALLDEKIKLKSRVIYVLPFRTIIEDMYRRAKEIFGLFSV  275 (733)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             13556799999873225575189991688871999999999975311354562899655899999999999875123554


Q ss_pred             EEEEEECCHHHHHHHHCC-CCCEEEECCCCHHHH----------------HHHC----CCCCCCCEEECCCCCCCCCCCC
Q ss_conf             599985897898887307-798699806420233----------------4420----0011322044045310024654
Q gi|255764515|r   76 NISVITGTVKQRTKVLKT-PAVLYVINFENLGWL----------------VQEL----KGTWPFATIVVDESTKLKSFRL  134 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~~~~-~~~i~i~s~e~~~~~----------------~~~~----~~~~~~~~iIiDEaH~lkn~~~  134 (458)
                      .....+|........... .....+++.++..+.                ....    .......++|+||.|.+ +..+
T Consensus       276 ~~~~~h~~~~~~~~~~~~~~~~~~~~~~ds~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~S~vIlDE~h~~-~~~~  354 (733)
T COG1203         276 IGKSLHSSSKEPLLLEPDQDILLTLTTNDSYKKLLLALIVVTPIQILIFSVKGFKFEFLALLLTSLVILDEVHLY-ADET  354 (733)
T ss_pred             CCCCCCCCCHHHHHHCCCCCCCEEEEECCCCCCCCCCCEEECHHHHHHHHHCCCCCHHHHHHHHCCEEEECHHHC-CCCC
T ss_conf             331001310255651701002258881242236204522206999855740466725778876467787427541-6543


Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             311567777665430598079965840
Q gi|255764515|r  135 RQGSKTARALAKPAWESERFIELTGTP  161 (458)
Q Consensus       135 ~~~s~~~~~l~~~~~~~~~~l~LTgTP  161 (458)
                       ...-....+..+......++++|||+
T Consensus       355 -~~~~l~~~i~~l~~~g~~ill~SATl  380 (733)
T COG1203         355 -MLAALLALLEALAEAGVPVLLMSATL  380 (733)
T ss_pred             -HHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             -08999999999996899789992789


No 79 
>KOG0345 consensus
Probab=99.59  E-value=2.3e-12  Score=93.17  Aligned_cols=301  Identities=19%  Similarity=0.222  Sum_probs=171.2

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHH-HHHHHHHH-CCC---C--CEEEEECCHHHHHHHHHHHHHHCC-CC
Q ss_conf             8747899999999967980999588998689999-99999997-599---9--499991604656999999998558-88
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVL-TALSYIHL-WGE---K--SVLVIAPLRVAQSVWTSEVQRWSN-FS   73 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al-~~~~~l~~-~~~---~--~~LIv~P~~l~~~~W~~Ei~kf~~-~~   73 (458)
                      ++-|-|..++-.++.++-..+-..+|+|||+-=+ -+++.+.. .+.   .  ..|||+|+.-+..|-.+-+.-|.. .+
T Consensus        28 ~mTpVQa~tIPlll~~KDVvveavTGSGKTlAFllP~le~i~rr~~~~~~~~vgalIIsPTRELa~QI~~V~~~F~~~l~  107 (567)
T KOG0345          28 KMTPVQAATIPLLLKNKDVVVEAVTGSGKTLAFLLPMLEIIYRREAKTPPGQVGALIISPTRELARQIREVAQPFLEHLP  107 (567)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCC
T ss_conf             36877874667885278568985678871066899999999861157896512479965719999999999999998503


Q ss_pred             CCEEEEEECCH--HHHHHHHC-CCCCEEEECCCCHHHHHHH---CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             81599985897--89888730-7798699806420233442---000113220440453100246543115677776654
Q gi|255764515|r   74 HMNISVITGTV--KQRTKVLK-TPAVLYVINFENLGWLVQE---LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKP  147 (458)
Q Consensus        74 ~~~~~~~~g~~--~~r~~~~~-~~~~i~i~s~e~~~~~~~~---~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~  147 (458)
                      .+++..+.|..  .+..+.+. ....|+|.|...+......   ......-.++|+|||-++-..+   -....+.+...
T Consensus       108 ~l~~~l~vGG~~v~~Di~~fkee~~nIlVgTPGRL~di~~~~~~~l~~rsLe~LVLDEADrLldmg---Fe~~~n~ILs~  184 (567)
T KOG0345         108 NLNCELLVGGRSVEEDIKTFKEEGPNILVGTPGRLLDILQREAEKLSFRSLEILVLDEADRLLDMG---FEASVNTILSF  184 (567)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHCCCEEEECCHHHHHHHHCHHHCCCCCCCCEEEECCHHHHHCCC---HHHHHHHHHHH
T ss_conf             654599976864777999999709958994762499998453000361331157751467674432---79999999986


Q ss_pred             HHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHH-HH
Q ss_conf             30598079965840231001013467751788877532778877736956403300002455554558999997424-54
Q gi|255764515|r  148 AWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSD-CC  226 (458)
Q Consensus       148 ~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~-~~  226 (458)
                      -++.++.=+-|||-.+ ...||.                                                ..-+.+ .-
T Consensus       185 LPKQRRTGLFSATq~~-~v~dL~------------------------------------------------raGLRNpv~  215 (567)
T KOG0345         185 LPKQRRTGLFSATQTQ-EVEDLA------------------------------------------------RAGLRNPVR  215 (567)
T ss_pred             CCCCCCCCCCEEHHHH-HHHHHH------------------------------------------------HHHCCCCEE
T ss_conf             6210002443002146-688999------------------------------------------------853568636


Q ss_pred             HHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCC
Q ss_conf             33200001001001100034524536899888999999851033452022347888875420354100022343000134
Q gi|255764515|r  227 LSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHD  306 (458)
Q Consensus       227 ~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~  306 (458)
                      +.+..+....             +|.....                                          ........
T Consensus       216 V~V~~k~~~~-------------tPS~L~~------------------------------------------~Y~v~~a~  240 (567)
T KOG0345         216 VSVKEKSKSA-------------TPSSLAL------------------------------------------EYLVCEAD  240 (567)
T ss_pred             EEECCCCCCC-------------CCHHHHH------------------------------------------EEEEECHH
T ss_conf             5412344555-------------8423111------------------------------------------25675778


Q ss_pred             CCCCCHHHHHHCCCCCEEEEHHH-------HHHHHHHHHH-----CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCC
Q ss_conf             33332566541248840342223-------6788866410-----00265334458998764245885589984422111
Q gi|255764515|r  307 EKIKALEVIIEKANAAPIIVAYH-------FNSDLARLQK-----AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH  374 (458)
Q Consensus       307 ~k~~~l~~il~~~~~~kviif~~-------~~~~~~~i~~-----~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~  374 (458)
                      .|+..+.+++.....+|+|||..       |...+..+..     .+++-...+.|...++.|.+....+|+|+ ++++-
T Consensus       241 eK~~~lv~~L~~~~~kK~iVFF~TCasVeYf~~~~~~~l~~~~i~~iHGK~~q~~R~k~~~~F~~~~~~vl~~T-DVaAR  319 (567)
T KOG0345         241 EKLSQLVHLLNNNKDKKCIVFFPTCASVEYFGKLFSRLLKKREIFSIHGKMSQKARAKVLEAFRKLSNGVLFCT-DVAAR  319 (567)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCHHCCHHHHHHHHHHHHCCCCEEEEE-HHHHC
T ss_conf             88999999996245462799934754099999888876078747986220123468899999871568618860-45553


Q ss_pred             CCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCC
Q ss_conf             622001785999908998986864456666202202037
Q gi|255764515|r  375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG  413 (458)
Q Consensus       375 GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~G  413 (458)
                      |||+. .-+.||.||||-+|..+.-+.||-.  |+.|.|
T Consensus       320 GlDip-~iD~VvQ~DpP~~~~~FvHR~GRTa--R~gr~G  355 (567)
T KOG0345         320 GLDIP-GIDLVVQFDPPKDPSSFVHRCGRTA--RAGREG  355 (567)
T ss_pred             CCCCC-CCEEEEECCCCCCHHHHHHHCCHHH--HCCCCC
T ss_conf             68988-9707997079998147777412144--356766


No 80 
>KOG0951 consensus
Probab=99.58  E-value=7.1e-13  Score=96.24  Aligned_cols=337  Identities=17%  Similarity=0.196  Sum_probs=158.1

Q ss_pred             CCCEEEEECCCCCHHHHHH-HHHHHHHHC---------CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHH
Q ss_conf             7980999588998689999-999999975---------999499991604656999999998558888159998589789
Q gi|255764515|r   17 HKRCAIWASMGSGKTVSVL-TALSYIHLW---------GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQ   86 (458)
Q Consensus        17 ~~~~ll~~~~G~GKT~~al-~~~~~l~~~---------~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~   86 (458)
                      ..+.+++.++|+|||-.|+ .++..+...         +..++..|+|--.+.+.|...|.++....++.|.-.+|+...
T Consensus       325 ~EnmLlCAPTGaGKTNVAvLtiLqel~~h~r~dgs~nl~~fKIVYIAPmKaLVqE~VgsfSkRla~~GItV~ElTgD~~l  404 (1674)
T KOG0951         325 DENMLLCAPTGAGKTNVAVLTILQELGNHLREDGSVNLAPFKIVYIAPMKALVQEMVGSFSKRLAPLGITVLELTGDSQL  404 (1674)
T ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCEECCCCEEEEEEEHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCC
T ss_conf             67378742678882379999999998535454454102561379984289999999988886423567179873265410


Q ss_pred             HHHHHCCCCCEEEECCCCHHHHHHHCC---CCCCCCEEECCCCCCCCCCCCCCH-HHHHHHHHH--HHHCCCEEEEECCC
Q ss_conf             888730779869980642023344200---011322044045310024654311-567777665--43059807996584
Q gi|255764515|r   87 RTKVLKTPAVLYVINFENLGWLVQELK---GTWPFATIVVDESTKLKSFRLRQG-SKTARALAK--PAWESERFIELTGT  160 (458)
Q Consensus        87 r~~~~~~~~~i~i~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~lkn~~~~~~-s~~~~~l~~--~~~~~~~~l~LTgT  160 (458)
                      -...+. ..++++++.|...-.-+.-.   ..--+.++|+||-|-+-..++..- |-..|....  -.....+.++||||
T Consensus       405 ~~~qie-eTQVIVtTPEKwDiITRk~gdraY~qlvRLlIIDEIHLLhDdRGpVLESIVaRt~r~ses~~e~~RlVGLSAT  483 (1674)
T KOG0951         405 GKEQIE-ETQVIVTTPEKWDIITRKSGDRAYEQLVRLLIIDEIHLLHDDRGPVLESIVARTFRRSESTEEGSRLVGLSAT  483 (1674)
T ss_pred             HHHHHH-CCEEEEECCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             044321-2202870642222111046742388888887654443215566407889999999986512457436410155


Q ss_pred             CHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             02310010134677517888775327788777369564033000024555545589999974245433200001001001
Q gi|255764515|r  161 PSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP  240 (458)
Q Consensus       161 Pi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~l~~~  240 (458)
                       .+| ..|.-+.+..-.++  ++.+-.+|+.-...  +-  ..+.....+..+     .+.+.+.++....+-...  .+
T Consensus       484 -LPN-y~DV~~Fl~v~~~g--lf~fd~syRpvPL~--qq--~Igitek~~~~~-----~qamNe~~yeKVme~agk--~q  548 (1674)
T KOG0951         484 -LPN-YEDVASFLRVDPEG--LFYFDSSYRPVPLK--QQ--YIGITEKKPLKR-----FQAMNEACYEKVLEHAGK--NQ  548 (1674)
T ss_pred             -CCC-HHHHHHHHCCCCCC--CCCCCCCCCCCCCC--CE--EECCCCCCCHHH-----HHHHHHHHHHHHHHHCCC--CC
T ss_conf             -786-16557775558532--41357555767764--14--763303780677-----777789999999973787--85


Q ss_pred             CEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHHHCCC
Q ss_conf             10003452453689988899999985103345202234788887542035410002234300013433332566541248
Q gi|255764515|r  241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKAN  320 (458)
Q Consensus       241 ~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il~~~~  320 (458)
                      ..  +.|.-..+..+.-..++...+ +   +     +.+.+.++--   +...    +.-..+....|-.-|.+++.-  
T Consensus       549 VL--VFVHsRKET~ktA~aIRd~~l-e---~-----dtls~fmre~---s~s~----eilrtea~~~kn~dLkdLLpy--  608 (1674)
T KOG0951         549 VL--VFVHSRKETAKTARAIRDKAL-E---E-----DTLSRFMRED---SASR----EILRTEAGQAKNPDLKDLLPY--  608 (1674)
T ss_pred             EE--EEEEECHHHHHHHHHHHHHHH-H---H-----HHHHHHHHCC---CCHH----HHHHHHHHCCCCHHHHHHHHC--
T ss_conf             89--999833578899999999886-4---5-----3799987634---4114----565544420158307877313--


Q ss_pred             CCEEEEHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEE----EECC---CC-
Q ss_conf             840342223678886641000265334458998764245885589984422111622001785999----9089---98-
Q gi|255764515|r  321 AAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILV----FFSL---WW-  392 (458)
Q Consensus       321 ~~kviif~~~~~~~~~i~~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI----~~~~---~w-  392 (458)
                      |    +..            -+.|.+...|...-+.|.+|+.+|++. +++.+-|+||. |..++|    .||+   -| 
T Consensus       609 g----faI------------HhAGl~R~dR~~~EdLf~~g~iqvlvs-tatlawgvnlp-ahtViikgtqvy~pekg~w~  670 (1674)
T KOG0951         609 G----FAI------------HHAGLNRKDRELVEDLFADGHIQVLVS-TATLAWGVNLP-AHTVIIKGTQVYDPEKGRWT  670 (1674)
T ss_pred             C----CEE------------ECCCCCCCHHHHHHHHHHCCCEEEEEE-EHHHHHHCCCC-CCEEEECCCCCCCCCCCCCC
T ss_conf             5----133------------116778623778999874486268875-02456424777-62689607621583457666


Q ss_pred             --CHHHHHHHHHHHHCC
Q ss_conf             --986864456666202
Q gi|255764515|r  393 --DLEEHQQMIERIGVT  407 (458)
Q Consensus       393 --n~~~~~Q~~gRi~~~  407 (458)
                        +|.+..|..||.-|.
T Consensus       671 elsp~dv~qmlgragrp  687 (1674)
T KOG0951         671 ELSPLDVMQMLGRAGRP  687 (1674)
T ss_pred             CCCHHHHHHHHHHCCCC
T ss_conf             27879999997544897


No 81 
>KOG0348 consensus
Probab=99.58  E-value=2.1e-12  Score=93.45  Aligned_cols=373  Identities=18%  Similarity=0.185  Sum_probs=170.6

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCHHHHHH-HHHHHHHHCC-------CCCEEEEECCHHHHHHHHHHHHHHCCCCCC--
Q ss_conf             899999999967980999588998689999-9999999759-------994999916046569999999985588881--
Q gi|255764515|r    6 HQTKIVDWILDHKRCAIWASMGSGKTVSVL-TALSYIHLWG-------EKSVLVIAPLRVAQSVWTSEVQRWSNFSHM--   75 (458)
Q Consensus         6 ~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al-~~~~~l~~~~-------~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~--   75 (458)
                      -|..++-.+++.+-.++-..+|+|||+.=+ -++..|....       .--.|||||+.-+-.|-++-+.|.....++  
T Consensus       163 VQkq~IP~lL~grD~lV~aQTGSGKTLAYllPiVq~Lq~m~~ki~Rs~G~~ALVivPTREL~~Q~y~~~qKLl~~~hWIV  242 (708)
T KOG0348         163 VQKQAIPVLLEGRDALVRAQTGSGKTLAYLLPIVQSLQAMEPKIQRSDGPYALVIVPTRELALQIYETVQKLLKPFHWIV  242 (708)
T ss_pred             HHHCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             76502035525863478857788621799999999997268655556883489980419999999999998725743773


Q ss_pred             EEEEEECCHHHHHHH-HCCCCCEEEECCCCHHHHHHHCCCCCC-----CCEEECCCCCCCCCCCCC-CHHHHHHHHHHHH
Q ss_conf             599985897898887-307798699806420233442000113-----220440453100246543-1156777766543
Q gi|255764515|r   76 NISVITGTVKQRTKV-LKTPAVLYVINFENLGWLVQELKGTWP-----FATIVVDESTKLKSFRLR-QGSKTARALAKPA  148 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~-~~~~~~i~i~s~e~~~~~~~~~~~~~~-----~~~iIiDEaH~lkn~~~~-~~s~~~~~l~~~~  148 (458)
                      -..++.|..+..++. +...-.|+|-|...+.   ++++....     -.-||+|||-++-..+-. .-++..+++....
T Consensus       243 Pg~lmGGEkkKSEKARLRKGiNILIgTPGRLv---DHLknT~~i~~s~LRwlVlDEaDrlleLGfekdit~Il~~v~~~~  319 (708)
T KOG0348         243 PGVLMGGEKKKSEKARLRKGINILIGTPGRLV---DHLKNTKSIKFSRLRWLVLDEADRLLELGFEKDITQILKAVHSIQ  319 (708)
T ss_pred             ECEEECCCCCCCHHHHHHCCCEEEECCCHHHH---HHHHCCCHHEEEEEEEEEECCHHHHHHCCCHHHHHHHHHHHHHCC
T ss_conf             02122363310178887548548975842788---987430022100356898534367876243003999999875002


Q ss_pred             H-CC--------CEEEEECCCCHH--HHCCCHHHHHHHCCCCC-CCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             0-59--------807996584023--10010134677517888-775327788777369564033000024555545589
Q gi|255764515|r  149 W-ES--------ERFIELTGTPSP--NGLIDLWGQIWFLDKGK-RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQK  216 (458)
Q Consensus       149 ~-~~--------~~~l~LTgTPi~--n~~~el~~ll~~l~~~~-~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~  216 (458)
                      . .+        .-.++||||-..  |++.|+    .+=||-. .+.......                 .  +...+..
T Consensus       320 ~~e~~~~~lp~q~q~mLlSATLtd~V~rLa~~----sLkDpv~I~ld~s~~~~-----------------~--p~~~a~~  376 (708)
T KOG0348         320 NAECKDPKLPHQLQNMLLSATLTDGVNRLADL----SLKDPVYISLDKSHSQL-----------------N--PKDKAVQ  376 (708)
T ss_pred             CHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHC----CCCCCEEEECCCHHHHC-----------------C--CCHHHHH
T ss_conf             00102556637877676665567778887633----15685564043012203-----------------8--6314566


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH-HHHCCCCCCCC
Q ss_conf             99997424543320000100100110003452453689988899999985103345202234788887-54203541000
Q gi|255764515|r  217 EIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVK-CLQLANGAVYY  295 (458)
Q Consensus       217 ~l~~~l~~~~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~-l~q~~~~~~~~  295 (458)
                      ++-.    . ..-..-+...+|........|--+.--.-.+..+....+..........+.+...... .-.+-++....
T Consensus       377 ev~~----~-~~~~~l~~~~iPeqL~qry~vVPpKLRLV~Laa~L~~~~k~~~~qk~iVF~S~~d~VeFHy~lf~~~l~~  451 (708)
T KOG0348         377 EVDD----G-PAGDKLDSFAIPEQLLQRYTVVPPKLRLVALAALLLNKVKFEEKQKMIVFFSCSDSVEFHYSLFSEALLS  451 (708)
T ss_pred             HCCC----C-CCCCCCCCCCCCHHHHHCEEECCCCHHHHHHHHHHHHHHHHHHHCEEEEEEECHHHHHHHHHHHHHHHHC
T ss_conf             3377----5-3456320123868765006852874108999999999865444230699996325789999999865402


Q ss_pred             CCCCCCHHCCCCCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCC
Q ss_conf             22343000134333325665412488403422236788866410002653344589987642458855899844221116
Q gi|255764515|r  296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHG  375 (458)
Q Consensus       296 ~~~~~~~~~~~~k~~~l~~il~~~~~~kviif~~~~~~~~~i~~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~G  375 (458)
                      ..+......             ...|.+       ..-++.-..+++++++..+|....+.|....-.||+|+ ++++-|
T Consensus       452 ~~e~~s~~~-------------~s~g~~-------~l~~~~k~~rLHGsm~QeeRts~f~~Fs~~~~~VLLcT-DVAaRG  510 (708)
T KOG0348         452 HLEGSSGAP-------------DSEGLP-------PLFMDLKFYRLHGSMEQEERTSVFQEFSHSRRAVLLCT-DVAARG  510 (708)
T ss_pred             CCCCCCCCC-------------CCCCCH-------HHHHCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEH-HHHHCC
T ss_conf             323666786-------------667981-------03314637884274348899999875303544278850-345426


Q ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             22001785999908998986864456666202202037877528999985899689999999999
Q gi|255764515|r  376 LNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       376 lnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
                      |||.+- ..||-||+|++++++.-++||-.     |+|.+-.  ...|.++...|  ....+..+
T Consensus       511 LDlP~V-~~vVQYd~P~s~adylHRvGRTA-----RaG~kG~--alLfL~P~Eae--y~~~l~~~  565 (708)
T KOG0348         511 LDLPHV-GLVVQYDPPFSTADYLHRVGRTA-----RAGEKGE--ALLFLLPSEAE--YVNYLKKH  565 (708)
T ss_pred             CCCCCC-CEEEEECCCCCHHHHHHHHHHHH-----HCCCCCC--EEEEECCCHHH--HHHHHHHH
T ss_conf             888776-76998279998899999840454-----3467771--57886651799--99988750


No 82 
>KOG0344 consensus
Probab=99.57  E-value=4.5e-14  Score=103.50  Aligned_cols=300  Identities=17%  Similarity=0.178  Sum_probs=151.2

Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC------CCCCEEEEECCHHHHHHHHHHHHHHC--CCCCC
Q ss_conf             789999999996798099958899868999-9999999975------99949999160465699999999855--88881
Q gi|255764515|r    5 PHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW------GEKSVLVIAPLRVAQSVWTSEVQRWS--NFSHM   75 (458)
Q Consensus         5 p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~------~~~~~LIv~P~~l~~~~W~~Ei~kf~--~~~~~   75 (458)
                      |-|..++-.++..+.++-+.++|+|||+.= +-.+.+|...      ..-..+|+.|...+.+|-..|+.+..  .....
T Consensus       161 ~iq~~aipvfl~~r~~lAcapTGsgKtlaf~~Pil~~L~~~~~~~~~~gl~a~Il~ptreLa~Qi~re~~k~~~~~~t~~  240 (593)
T KOG0344         161 PIQKQAIPVFLEKRDVLACAPTGSGKTLAFNLPILQHLKDLSQEKHKVGLRALILSPTRELAAQIYREMRKYSIDEGTSL  240 (593)
T ss_pred             CCCCHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCH
T ss_conf             31001156664133058863578862056556999999875203576542788844449999999999985577778753


Q ss_pred             EEEEEECC---HHHHHHHHCCCCCEEEECCCCHHHHHHHCC---CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             59998589---789888730779869980642023344200---011322044045310024654311567777665430
Q gi|255764515|r   76 NISVITGT---VKQRTKVLKTPAVLYVINFENLGWLVQELK---GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        76 ~~~~~~g~---~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                      ...-+..+   .++........+++.+.|.-.+..+...-.   .......+|+|||-.+.++ ..-..+....+..+..
T Consensus       241 ~a~~~~~~~~~~qk~a~~~~~k~dili~TP~ri~~~~~~~~~~idl~~V~~lV~dEaD~lfe~-~~f~~Qla~I~sac~s  319 (593)
T KOG0344         241 RAAQFSKPAYPSQKPAFLSDEKYDILISTPMRIVGLLGLGKLNIDLSKVEWLVVDEADLLFEP-EFFVEQLADIYSACQS  319 (593)
T ss_pred             HHHHCCCCCCHHHCCCHHHHHHHHHHHCCHHHHHHHHCCCCCCCHHHEEEEEEECHHHHHHCH-HHHHHHHHHHHHHHCC
T ss_conf             455166665311033246777887886187999998558975320120356766468765081-5699999999998528


Q ss_pred             CCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             59807996584023100101346775178887753277887773695640330000245555455899999742454332
Q gi|255764515|r  150 ESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL  229 (458)
Q Consensus       150 ~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~  229 (458)
                      ..-++=+.|||-                         ..++++|+.......                            
T Consensus       320 ~~i~~a~FSat~-------------------------~~~VEE~~~~i~~~~----------------------------  346 (593)
T KOG0344         320 PDIRVALFSATI-------------------------SVYVEEWAELIKSDL----------------------------  346 (593)
T ss_pred             CCHHHHHHHCCC-------------------------CHHHHHHHHHHHCCC----------------------------
T ss_conf             522256632146-------------------------077999999865053----------------------------


Q ss_pred             HCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCC
Q ss_conf             00001001001100034524536899888999999851033452022347888875420354100022343000134333
Q gi|255764515|r  230 DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKI  309 (458)
Q Consensus       230 ~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~  309 (458)
                                   ..+.+...+.+....+   .++.                                   ...-...|+
T Consensus       347 -------------~~vivg~~~sa~~~V~---Qelv-----------------------------------F~gse~~K~  375 (593)
T KOG0344         347 -------------KRVIVGLRNSANETVD---QELV-----------------------------------FCGSEKGKL  375 (593)
T ss_pred             -------------EEEEEECCHHHHHHHH---HHHE-----------------------------------EEECCHHHH
T ss_conf             -------------3689842525765545---5512-----------------------------------110434577


Q ss_pred             CCHHHHHHCCCCCEEEEHHHHHHHHHHHHH-----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCC
Q ss_conf             325665412488403422236788866410-----------002653344589987642458855899844221116220
Q gi|255764515|r  310 KALEVIIEKANAAPIIVAYHFNSDLARLQK-----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNL  378 (458)
Q Consensus       310 ~~l~~il~~~~~~kviif~~~~~~~~~i~~-----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL  378 (458)
                      -++.+++...-.-+++||-+...-...+..           .+++..+..+|.+.+++|..|++.||+|+ ...+-||+|
T Consensus       376 lA~rq~v~~g~~PP~lIfVQs~eRak~L~~~L~~~~~i~v~vIh~e~~~~qrde~~~~FR~g~IwvLicT-dll~RGiDf  454 (593)
T KOG0344         376 LALRQLVASGFKPPVLIFVQSKERAKQLFEELEIYDNINVDVIHGERSQKQRDETMERFRIGKIWVLICT-DLLARGIDF  454 (593)
T ss_pred             HHHHHHHHCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEH-HHHHCCCCC
T ss_conf             8899998615899748988538889999998642357663467636666677899999850670688850-466545564


Q ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCC
Q ss_conf             01785999908998986864456666202202037877
Q gi|255764515|r  379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR  416 (458)
Q Consensus       379 ~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~  416 (458)
                      + +.|.||+||.|-+-..+.-++||..     |.|+.-
T Consensus       455 ~-gvn~VInyD~p~s~~syihrIGRtg-----Rag~~g  486 (593)
T KOG0344         455 K-GVNLVINYDFPQSDLSYIHRIGRTG-----RAGRSG  486 (593)
T ss_pred             C-CCCEEEECCCCCHHHHHHHHHHCCC-----CCCCCC
T ss_conf             5-7636895378722478888730257-----889886


No 83 
>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif (motif II). This domain contains the ATP- binding region.
Probab=99.56  E-value=5.3e-13  Score=96.99  Aligned_cols=163  Identities=18%  Similarity=0.224  Sum_probs=110.1

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC---CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             874789999999996798099958899868999-9999999975---999499991604656999999998558888159
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW---GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~---~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~   77 (458)
                      ++.|-|..++-.+++.+..++.+++|+|||+.- +-++..+...   +...+||+||+.-+..|-.+++.++.....+++
T Consensus        21 ~pt~IQ~~~ip~il~g~dvi~~a~TGSGKTlay~lpil~~l~~~~~~~~~~alil~PTrELa~Qi~~~~~~l~~~~~i~~  100 (203)
T cd00268          21 KPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEKLDPSPKKDGPQALILAPTRELALQIAEVARKLGKHTNLKV  100 (203)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99999999999997799889975799722288886999998616676896699996879999999999998505798389


Q ss_pred             EEEECCH--HHHHHHHCCCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEE
Q ss_conf             9985897--8988873077986998064202334420-001132204404531002465431156777766543059807
Q gi|255764515|r   78 SVITGTV--KQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERF  154 (458)
Q Consensus        78 ~~~~g~~--~~r~~~~~~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~  154 (458)
                      ....|..  ......+....+++|.|...+....+.. .....-.++|+|||+.+-+.+-   ..-...+.+...+...+
T Consensus       101 ~~~~gg~~~~~~~~~l~~~~~IlI~TPgrl~~~l~~~~~~l~~l~~lVlDEAD~ll~~gf---~~~i~~I~~~l~~~~Q~  177 (203)
T cd00268         101 VVIYGGTSIDKQIRKLKRGPHIVVATPGRLLDLLERGKLDLSKVKYLVLDEADRMLDMGF---EDQIREILKLLPKDRQT  177 (203)
T ss_pred             EEEECCCCHHHHHHHHHCCCEEEEECCHHHHHHHHCCCCCCCCCCEEEEECHHHHHHCCC---HHHHHHHHHHCCCCCEE
T ss_conf             998389887999999853875999681899999984886513224899985888874776---99999999858967779


Q ss_pred             EEECCCCHHHHCCC
Q ss_conf             99658402310010
Q gi|255764515|r  155 IELTGTPSPNGLID  168 (458)
Q Consensus       155 l~LTgTPi~n~~~e  168 (458)
                      ++.|||- +..+.+
T Consensus       178 ~lfSAT~-~~~v~~  190 (203)
T cd00268         178 LLFSATM-PKEVRD  190 (203)
T ss_pred             EEEEECC-CHHHHH
T ss_conf             9998049-988999


No 84 
>KOG0336 consensus
Probab=99.55  E-value=8.7e-12  Score=89.65  Aligned_cols=110  Identities=13%  Similarity=0.260  Sum_probs=80.9

Q ss_pred             CCCHHHHHHC-CCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCC
Q ss_conf             3325665412-488403422236788866410----------00265334458998764245885589984422111622
Q gi|255764515|r  309 IKALEVIIEK-ANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN  377 (458)
Q Consensus       309 ~~~l~~il~~-~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~Gln  377 (458)
                      +..+..+++. +...|+|||+.-+.+.+.+..          .++++.....|+.+++.|+.|+++||+++ +.++-||+
T Consensus       452 ~~~~~~f~~~ms~ndKvIiFv~~K~~AD~LSSd~~l~gi~~q~lHG~r~Q~DrE~al~~~ksG~vrILvaT-DlaSRGlD  530 (629)
T KOG0336         452 LEIVQFFVANMSSNDKVIIFVSRKVMADHLSSDFCLKGISSQSLHGNREQSDREMALEDFKSGEVRILVAT-DLASRGLD  530 (629)
T ss_pred             HHHHHHHHHHCCCCCEEEEEEECHHHHHHCCCHHHHCCCCHHHCCCCHHHHHHHHHHHHHHCCCEEEEEEE-CHHHCCCC
T ss_conf             99999999855888618999831032210231021146101102587224359999976415816999972-23433788


Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECC
Q ss_conf             00178599990899898686445666620220203787752899998589
Q gi|255764515|r  378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN  427 (458)
Q Consensus       378 L~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~  427 (458)
                      +... ++|++||.|-|-..+--++||.  .|+.|.|    +. .-+++.+
T Consensus       531 v~Di-THV~NyDFP~nIeeYVHRvGrt--GRaGr~G----~s-is~lt~~  572 (629)
T KOG0336         531 VPDI-THVYNYDFPRNIEEYVHRVGRT--GRAGRTG----TS-ISFLTRN  572 (629)
T ss_pred             CHHC-CEEECCCCCCCHHHHHHHHCCC--CCCCCCC----CE-EEEEEHH
T ss_conf             2002-0354057875599999871235--6577776----32-7888630


No 85 
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]
Probab=99.54  E-value=5.1e-11  Score=85.00  Aligned_cols=323  Identities=19%  Similarity=0.250  Sum_probs=169.0

Q ss_pred             CCCHHHHHHHHHHH----HCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHH-HH-CCCCCC
Q ss_conf             87478999999999----6798099958899868999999999997599949999160465699999999-85-588881
Q gi|255764515|r    2 NLAPHQTKIVDWIL----DHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQ-RW-SNFSHM   75 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~----~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~-kf-~~~~~~   75 (458)
                      +|-|+|..+.+.++    ++.-.++.+-+|+|||=+.-..++.....| .++.|..|.--   . .-|+. ++ ..++..
T Consensus        97 ~Ls~~Q~~as~~l~q~i~~k~~~lv~AV~GaGKTEMif~~i~~al~~G-~~vciASPRvD---V-clEl~~Rlk~aF~~~  171 (441)
T COG4098          97 TLSPGQKKASNQLVQYIKQKEDTLVWAVTGAGKTEMIFQGIEQALNQG-GRVCIASPRVD---V-CLELYPRLKQAFSNC  171 (441)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCC-CEEEEECCCCC---C-HHHHHHHHHHHHCCC
T ss_conf             327247899999999987157689997427985101699999999659-86998468610---1-177789999762149


Q ss_pred             EEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             59998589789888730779869980642023344200011322044045310024654311567777665430598079
Q gi|255764515|r   76 NISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFI  155 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l  155 (458)
                      ++..++|++.....    .-.++.++++.++       ....||++|+||.-.+  |-. ......-++.+....-...+
T Consensus       172 ~I~~Lyg~S~~~fr----~plvVaTtHQLlr-------Fk~aFD~liIDEVDAF--P~~-~d~~L~~Av~~ark~~g~~I  237 (441)
T COG4098         172 DIDLLYGDSDSYFR----APLVVATTHQLLR-------FKQAFDLLIIDEVDAF--PFS-DDQSLQYAVKKARKKEGATI  237 (441)
T ss_pred             CEEEEECCCCHHCC----CCEEEEEHHHHHH-------HHHHCCEEEEECCCCC--CCC-CCHHHHHHHHHHHCCCCCEE
T ss_conf             86667258713133----4479976688888-------8864338998302456--566-78889999997512367369


Q ss_pred             EECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             96584023100101346775178887753277887773695640330000245555455899999742454332000010
Q gi|255764515|r  156 ELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ  235 (458)
Q Consensus       156 ~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~  235 (458)
                      .|||||-..=-.+       +..+                                     .    +....+   .....
T Consensus       238 ylTATp~k~l~r~-------~~~g-------------------------------------~----~~~~kl---p~RfH  266 (441)
T COG4098         238 YLTATPTKKLERK-------ILKG-------------------------------------N----LRILKL---PARFH  266 (441)
T ss_pred             EEECCCHHHHHHH-------HHHC-------------------------------------C----EEEEEC---CHHHC
T ss_conf             9964880788887-------5407-------------------------------------7----567634---46543


Q ss_pred             CCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCC-CHHH
Q ss_conf             010011000345245368998889999998510334520223478888754203541000223430001343333-2566
Q gi|255764515|r  236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIK-ALEV  314 (458)
Q Consensus       236 ~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~-~l~~  314 (458)
                      .-|.+.....+....   .+..                                               .-+|+. ++..
T Consensus       267 ~~pLpvPkf~w~~~~---~k~l-----------------------------------------------~r~kl~~kl~~  296 (441)
T COG4098         267 GKPLPVPKFVWIGNW---NKKL-----------------------------------------------QRNKLPLKLKR  296 (441)
T ss_pred             CCCCCCCCEEEECCH---HHHH-----------------------------------------------HHCCCCHHHHH
T ss_conf             899898742886447---7776-----------------------------------------------64447789999


Q ss_pred             HHHC--CCCCEEEEHHHHHHHHHHHHHCCCC----------CCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCC
Q ss_conf             5412--4884034222367888664100026----------533445899876424588558998442211162200178
Q gi|255764515|r  315 IIEK--ANAAPIIVAYHFNSDLARLQKAFPQ----------GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGG  382 (458)
Q Consensus       315 il~~--~~~~kviif~~~~~~~~~i~~~~~~----------g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~  382 (458)
                      +++.  .+|.+++||..-...+......+..          .+....|.+.++.|++|+..+|+.+ .-..-|+++.. .
T Consensus       297 ~lekq~~~~~P~liF~p~I~~~eq~a~~lk~~~~~~~i~~Vhs~d~~R~EkV~~fR~G~~~lLiTT-TILERGVTfp~-v  374 (441)
T COG4098         297 WLEKQRKTGRPVLIFFPEIETMEQVAAALKKKLPKETIASVHSEDQHRKEKVEAFRDGKITLLITT-TILERGVTFPN-V  374 (441)
T ss_pred             HHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEEE-EHHHCCCCCCC-C
T ss_conf             999987438828999250588999999998618864215653367017899999875863899984-40332664356-2


Q ss_pred             CEEEEECCC--CCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             599990899--89868644566662022020378775289999858996899999999999999999855413745
Q gi|255764515|r  383 NILVFFSLW--WDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI  456 (458)
Q Consensus       383 ~~iI~~~~~--wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~~~~~~~  456 (458)
                      ++.++-.-+  ++.+.+.|.-||+-  |+++.- +-.|  ++| ..| +-..|.+...+=++++..   +.+++.+
T Consensus       375 dV~Vlgaeh~vfTesaLVQIaGRvG--Rs~~~P-tGdv--~FF-H~G-~skaM~~A~keIk~MN~l---g~k~~~~  440 (441)
T COG4098         375 DVFVLGAEHRVFTESALVQIAGRVG--RSLERP-TGDV--LFF-HYG-KSKAMKQARKEIKEMNKL---GFKRGLI  440 (441)
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHCC--CCCCCC-CCCE--EEE-ECC-CHHHHHHHHHHHHHHHHH---HHHCCCC
T ss_conf             3999547764201889999752316--787689-8758--999-646-338999999999999887---6442046


No 86 
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family; InterPro: IPR004473   There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements , , as summarised below:    Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.    Type I restriction endonucleases are components of prokaryotic DNA restriction-modification mechanisms that protects the organism against invading foreign DNA. Type I enzymes have three different subunits subunits - M (modification), S (specificity) and R (restriction) - that form multifunctional enzymes with restriction (3.1.21.3 from EC), methylase (2.1.1.72 from EC) and ATPase activities , . The S subunit is required for both restriction and modification and is responsible for recognition of the DNA sequence specific for the system. The M subunit is necessary for modification, and the R subunit is required for restriction. These enzymes use S-Adenosyl-L-methionine (AdoMet) as the methyl group donor in the methylation reaction, and have a requirement for ATP. They recognize asymmetric DNA sequences split into two domains of specific sequence, one 3-4 bp long and another 4-5 bp long, separated by a nonspecific spacer 6-8 bp in length. Cleavage occurs a considerable distance from the recognition sites, rarely less than 400 bp away and up to 7000 bp away. Adenosyl residues are methylated, one on each strand of the recognition sequence. These enzymes are widespread in eubacteria and archaea. In enteric bacteria they have been subdivide into four families: types IA, IB, IC and ID.   This entry represents the R subunit (HsdR) of type I restriction endonucleases such as EcoRI (3.1.21.3 from EC), which recognises the DNA sequence 5'-GAATTC; the R protein (HsdR) is required for both nuclease and ATPase activity , , , .; GO: 0003677 DNA binding, 0005524 ATP binding, 0009035 Type I site-specific deoxyribonuclease activity, 0009307 DNA restriction-modification system.
Probab=99.53  E-value=1.5e-13  Score=100.40  Aligned_cols=161  Identities=18%  Similarity=0.252  Sum_probs=97.8

Q ss_pred             HHHHHHHHHHH----------CC-CEEEEECCCCCHHHHHHHHHHHHH--H-CCCCCEEEEECCHHHHHHHHHHHHHHCC
Q ss_conf             89999999996----------79-809995889986899999999999--7-5999499991604656999999998558
Q gi|255764515|r    6 HQTKIVDWILD----------HK-RCAIWASMGSGKTVSVLTALSYIH--L-WGEKSVLVIAPLRVAQSVWTSEVQRWSN   71 (458)
Q Consensus         6 ~Q~~~v~~~~~----------~~-~~ll~~~~G~GKT~~al~~~~~l~--~-~~~~~~LIv~P~~l~~~~W~~Ei~kf~~   71 (458)
                      ||..||+.+.+          .+ +|++.|-.|+|||+|++-++..+.  . .....+++||=..-+..|-..|+..+..
T Consensus       301 ~qy~av~ki~~~~~~~~~~k~~~n~G~iWHtQGSGKtlTm~f~A~k~~~~~~~~~p~v~fvvDR~eLd~Ql~~~~~~~~~  380 (813)
T TIGR00348       301 MQYRAVKKIVESILRKEKGKDKRNKGLIWHTQGSGKTLTMLFLARKLRKQKELKNPKVFFVVDRRELDEQLYKEFSSLKD  380 (813)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHHHHH
T ss_conf             99999999999998531378863674489850763788999999999874652698499997272778899999987642


Q ss_pred             CCCCEEEEEECCHHHHHH-HHCCC----------CCEEEECCCCHHH----HHHHCCCCCCCC--------EEECCCCCC
Q ss_conf             888159998589789888-73077----------9869980642023----344200011322--------044045310
Q gi|255764515|r   72 FSHMNISVITGTVKQRTK-VLKTP----------AVLYVINFENLGW----LVQELKGTWPFA--------TIVVDESTK  128 (458)
Q Consensus        72 ~~~~~~~~~~g~~~~r~~-~~~~~----------~~i~i~s~e~~~~----~~~~~~~~~~~~--------~iIiDEaH~  128 (458)
                       .-....--..+.+.... +-..+          ..+++++.+++..    ...+.....+|.        .||+|||||
T Consensus       381 -~~~~~~~~~eS~~~Lk~~L~~~~~sennPn~~k~g~~~t~IqKF~~~~~~k~~e~~~~~~~~i~~~r~~vv~i~DEaHR  459 (813)
T TIGR00348       381 -LIKDCAERIESIAELKELLEKNDESENNPNISKRGIIITTIQKFDDELLDKLKEEEEKFPESIIIDRKEVVVIIDEAHR  459 (813)
T ss_pred             -HCHHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCEEEEEECCCC
T ss_conf             -0101042067888999987517764567553567679996001040344536888743873689871608999706755


Q ss_pred             CCCCC------CCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCC
Q ss_conf             02465------43115677776654305980799658402310010
Q gi|255764515|r  129 LKSFR------LRQGSKTARALAKPAWESERFIELTGTPSPNGLID  168 (458)
Q Consensus       129 lkn~~------~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~e  168 (458)
                      =.-..      +.-.+..++.+.+...+| ..++=|||||.-.=.+
T Consensus       460 sqyG~tqklhnGkfqtGla~~~~~~lknA-~f~gFTGTPI~~~d~~  504 (813)
T TIGR00348       460 SQYGKTQKLHNGKFQTGLAKALKKALKNA-SFFGFTGTPISKKDRD  504 (813)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCHHH-HHHCCCCCCCCHHCCC
T ss_conf             53534110004413589999998743112-0101224776532477


No 87 
>PRK05580 primosome assembly protein PriA; Validated
Probab=99.52  E-value=8.1e-11  Score=83.79  Aligned_cols=152  Identities=19%  Similarity=0.128  Sum_probs=99.6

Q ss_pred             CCCHHHHHHHHHHHHC---CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             8747899999999967---9809995889986899999999999759994999916046569999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDH---KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~---~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~   78 (458)
                      .|.+.|..+++.+.+.   ..+||...+|+|||-.-+.+++.....| +.+||++|-.-+..|+.+-+...++   .++.
T Consensus       168 ~L~~eQ~~a~~~i~~~~~~~~~LL~GvTGSGKTevYl~li~~~l~~G-kqvLiLvPEI~lt~q~~~rl~~~fg---~~v~  243 (699)
T PRK05580        168 TLNEEQAAALAAIRAAGGFSAFLLDGVTGSGKTEVYLQAIAEALAQG-KQALVLVPEIALTPQLLARFRARFG---ARVA  243 (699)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHHCC-CCEEEEECCHHHHHHHHHHHHHHHC---CCEE
T ss_conf             88999999999998558887178747898607999999999999739-9789991767878999999998709---9579


Q ss_pred             EEEC--CHHHHHHHH----CCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCC--CCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             9858--978988873----0779869980642023344200011322044045310--0246543115677776654305
Q gi|255764515|r   79 VITG--TVKQRTKVL----KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTK--LKSFRLRQGSKTARALAKPAWE  150 (458)
Q Consensus        79 ~~~g--~~~~r~~~~----~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~--lkn~~~~~~s~~~~~l~~~~~~  150 (458)
                      +++.  +..+|.+.|    .+...|+|-+..++-      ....+.++||+||=|.  .|-..+..+..+--++.+....
T Consensus       244 v~HS~ls~~eR~~~w~~i~~G~~~IVIGtRSAvF------aP~~nLgLIIVDEEhd~SYKq~~~Pry~ARdvA~~Ra~~~  317 (699)
T PRK05580        244 VLHSGLSDGERYRAWLAALRGEARVVIGTRSALF------APFKNLGLIIVDEEHDDSYKQQDGPRYHARDVAVLRAKQE  317 (699)
T ss_pred             EECCCCCHHHHHHHHHHHHCCCCEEEEECCCEEE------CCCCCCCEEEEECCCCHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             9648898579999999997699719997360110------6578984899973654544466687611999999999984


Q ss_pred             CCEEEEECCCCHH
Q ss_conf             9807996584023
Q gi|255764515|r  151 SERFIELTGTPSP  163 (458)
Q Consensus       151 ~~~~l~LTgTPi~  163 (458)
                      ...+++.||||.-
T Consensus       318 ~~~liLgSaTPSl  330 (699)
T PRK05580        318 GCPVVLGSATPSL  330 (699)
T ss_pred             CCCEEECCCCCCH
T ss_conf             9988961689999


No 88 
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=99.51  E-value=7.9e-13  Score=95.96  Aligned_cols=139  Identities=19%  Similarity=0.251  Sum_probs=93.2

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHC-CCC
Q ss_conf             980999588998689999999999975-999499991604656999999998558888159998589789888730-779
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLW-GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLK-TPA   95 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~-~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~-~~~   95 (458)
                      ++|++.|-.|+|||+++.-++..+... +...+++||=..-+..|-.++|..|........  -..+.......+. ...
T Consensus       274 ~~G~IWHtqGSGKTltm~~~A~~l~~~~~~~~v~fvvDR~dLd~Q~~~~f~~~~~~~~~~~--~~~s~~~Lk~~l~~~~~  351 (962)
T COG0610         274 KGGYIWHTQGSGKTLTMFKLARLLLELPKNPKVLFVVDRKDLDDQTSDEFQSFGKVAFNDP--KAESTSELKELLEDGKG  351 (962)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHHHHHHHCCC--CCCCHHHHHHHHHCCCC
T ss_conf             7238984069837899999999998365999699996728899999999999887632044--44579999999865898


Q ss_pred             CEEEECCCCHHHHHHHC---CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHH
Q ss_conf             86998064202334420---00113220440453100246543115677776654305980799658402310
Q gi|255764515|r   96 VLYVINFENLGWLVQEL---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNG  165 (458)
Q Consensus        96 ~i~i~s~e~~~~~~~~~---~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~  165 (458)
                      .+++||.+++.......   ....+.-.||+||||+--      +-...+.+.....+ ...++.||||+...
T Consensus       352 ~ii~TTIQKf~~~~~~~~~~~~~~~~ivvI~DEaHRSQ------~G~~~~~~~~~~~~-a~~~gFTGTPi~~~  417 (962)
T COG0610         352 KIIVTTIQKFNKAVKEDELELLKRKNVVVIIDEAHRSQ------YGELAKLLKKALKK-AIFIGFTGTPIFKE  417 (962)
T ss_pred             CEEEEEECCCCHHHHCCCCCCCCCCCEEEEEECCCCCC------CHHHHHHHHHHHCC-CEEEEEECCCCCCC
T ss_conf             48999710264333333200047876799986401035------60789999987036-70897517856402


No 89 
>KOG1513 consensus
Probab=99.50  E-value=7.5e-13  Score=96.09  Aligned_cols=81  Identities=17%  Similarity=0.248  Sum_probs=60.2

Q ss_pred             HHHHCCCCCCEEEEEHHHCCCCCCCCCC-------CCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEEC
Q ss_conf             7642458855899844221116220017-------859999089989868644566662022020378775289999858
Q gi|255764515|r  354 IQEWNEGKIPLLFAHPASCGHGLNLQYG-------GNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQ  426 (458)
Q Consensus       354 i~~f~~~~~~vli~s~~~~~~GlnL~~a-------~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~  426 (458)
                      .++|-+|+-.|.|+| .|++-||.||.-       ..+-|-+++||++.+-.|..||-     ||-.|-+...+.+||+.
T Consensus       850 KqrFM~GeK~vAIIS-EAaSSGISLQsDrRv~NqRRRvHiTLELPWSADrAIQQFGRT-----HRSNQVsaPEYVFlIse  923 (1300)
T KOG1513         850 KQRFMDGEKLVAIIS-EAASSGISLQSDRRVQNQRRRVHITLELPWSADRAIQQFGRT-----HRSNQVSAPEYVFLISE  923 (1300)
T ss_pred             HHHHCCCCCEEEEEE-HHHCCCCEEECCHHHHHHHHEEEEEEECCCCHHHHHHHHCCC-----CCCCCCCCCEEEEEEHH
T ss_conf             765236652245451-233168602021555420124799997773153899985633-----22465678717998544


Q ss_pred             CCHHHHHHHHHHHHH
Q ss_conf             996899999999999
Q gi|255764515|r  427 NTIDELVLQRLRTKS  441 (458)
Q Consensus       427 ~tide~i~~~~~~K~  441 (458)
                      = .-|+-+..+..|+
T Consensus       924 L-AGErRFAS~VAKR  937 (1300)
T KOG1513         924 L-AGERRFASIVAKR  937 (1300)
T ss_pred             H-CCCHHHHHHHHHH
T ss_conf             2-1324789999999


No 90 
>KOG0947 consensus
Probab=99.49  E-value=7e-12  Score=90.21  Aligned_cols=150  Identities=15%  Similarity=0.164  Sum_probs=97.9

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEE
Q ss_conf             87478999999999679809995889986899999999999759994999916046569999999985588881599985
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT   81 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~   81 (458)
                      +|-++|++|+..+.......+|+.+-+|||+.|=++++.-.. +..+++.-.|-..+.||=.++|..-.+    ++..++
T Consensus       297 elD~FQk~Ai~~lerg~SVFVAAHTSAGKTvVAEYAialaq~-h~TR~iYTSPIKALSNQKfRDFk~tF~----DvgLlT  371 (1248)
T KOG0947         297 ELDTFQKEAIYHLERGDSVFVAAHTSAGKTVVAEYAIALAQK-HMTRTIYTSPIKALSNQKFRDFKETFG----DVGLLT  371 (1248)
T ss_pred             CCCHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHH-HCCCEEECCHHHHHCCCHHHHHHHHCC----CCCEEE
T ss_conf             766789999999972781799713778843699999999886-355157526346540015788877426----665451


Q ss_pred             CCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCC-CCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             897898887307798699806420233442000-1132204404531002465431156777766543059807996584
Q gi|255764515|r   82 GTVKQRTKVLKTPAVLYVINFENLGWLVQELKG-TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        82 g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~-~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      |+.+     ++.....+|+|-|-++...-.--. ...-+.||+||.|++.+....  .-.-..+ ...++--..++||||
T Consensus       372 GDvq-----inPeAsCLIMTTEILRsMLYrgadliRDvE~VIFDEVHYiND~eRG--vVWEEVi-IMlP~HV~~IlLSAT  443 (1248)
T KOG0947         372 GDVQ-----INPEASCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYINDVERG--VVWEEVI-IMLPRHVNFILLSAT  443 (1248)
T ss_pred             CCEE-----ECCCCCEEEEHHHHHHHHHHCCCCHHHCCCEEEEEEEEECCCCCCC--CCCEEEE-EECCCCCEEEEEECC
T ss_conf             4433-----2777546765699999987515543211336987403541441356--2210122-532554159998465


Q ss_pred             CHHHH
Q ss_conf             02310
Q gi|255764515|r  161 PSPNG  165 (458)
Q Consensus       161 Pi~n~  165 (458)
                       ++|.
T Consensus       444 -VPN~  447 (1248)
T KOG0947         444 -VPNT  447 (1248)
T ss_pred             -CCCH
T ss_conf             -7981


No 91 
>KOG0341 consensus
Probab=99.47  E-value=7.8e-13  Score=96.00  Aligned_cols=118  Identities=19%  Similarity=0.303  Sum_probs=85.8

Q ss_pred             CCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCC
Q ss_conf             333325665412488403422236788866410----------0026533445899876424588558998442211162
Q gi|255764515|r  307 EKIKALEVIIEKANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGL  376 (458)
Q Consensus       307 ~k~~~l~~il~~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~Gl  376 (458)
                      +|+..+.+.+.+. .-+++|||.-+..++.|.+          ++++|.-.+.|...|+.|+.|+-+||+++ ++++-||
T Consensus       408 aKiVylLeCLQKT-~PpVLIFaEkK~DVD~IhEYLLlKGVEavaIHGGKDQedR~~ai~afr~gkKDVLVAT-DVASKGL  485 (610)
T KOG0341         408 AKIVYLLECLQKT-SPPVLIFAEKKADVDDIHEYLLLKGVEAVAIHGGKDQEDRHYAIEAFRAGKKDVLVAT-DVASKGL  485 (610)
T ss_pred             HHHHHHHHHHCCC-CCCEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCCEEEEE-CCHHCCC
T ss_conf             0120699876127-9966998414567478999998725136874168656678889999865787458873-1000368


Q ss_pred             CCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHH
Q ss_conf             2001785999908998986864456666202202037877528999985899689999
Q gi|255764515|r  377 NLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL  434 (458)
Q Consensus       377 nL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~  434 (458)
                      +++.. .++|+||+|-.-..+--++||-     .|-|.+  -...-|+.+++-+.-++
T Consensus       486 DFp~i-qHVINyDMP~eIENYVHRIGRT-----GRsg~~--GiATTfINK~~~esvLl  535 (610)
T KOG0341         486 DFPDI-QHVINYDMPEEIENYVHRIGRT-----GRSGKT--GIATTFINKNQEESVLL  535 (610)
T ss_pred             CCCCC-HHHCCCCCHHHHHHHHHHHCCC-----CCCCCC--CEEEEEECCCCHHHHHH
T ss_conf             97450-4440478808899999971246-----778886--40222114563188898


No 92 
>KOG0326 consensus
Probab=99.46  E-value=8.3e-13  Score=95.83  Aligned_cols=313  Identities=19%  Similarity=0.227  Sum_probs=168.4

Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC-CCCCEEEEECCH---HHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             789999999996798099958899868999-9999999975-999499991604---65699999999855888815999
Q gi|255764515|r    5 PHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW-GEKSVLVIAPLR---VAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         5 p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~-~~~~~LIv~P~~---l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      |-|++++-..+..+..|.-+--|+|||-.- |-.++.+... ..=..+|++|..   +..+|-..|+.|+.   .+.+.+
T Consensus       110 PiQeesIPiaLtGrdiLaRaKNGTGKT~a~~IP~Lekid~~~~~IQ~~ilVPtrelALQtSqvc~~lskh~---~i~vmv  186 (459)
T KOG0326         110 PIQEESIPIALTGRDILARAKNGTGKTAAYCIPVLEKIDPKKNVIQAIILVPTRELALQTSQVCKELSKHL---GIKVMV  186 (459)
T ss_pred             CCCCCCCCEEECCHHHHHHCCCCCCCCCCEECHHHHHCCCCCCCEEEEEEEECCHHHHHHHHHHHHHHCCC---CEEEEE
T ss_conf             75302354442351355550189887330441256652822100447999616326678879999986046---849999


Q ss_pred             EECCHHHHHHHHC--CCCCEEEECCCCHHHHHHHCCC-CCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             8589789888730--7798699806420233442000-113220440453100246543115677776654305980799
Q gi|255764515|r   80 ITGTVKQRTKVLK--TPAVLYVINFENLGWLVQELKG-TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIE  156 (458)
Q Consensus        80 ~~g~~~~r~~~~~--~~~~i~i~s~e~~~~~~~~~~~-~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~  156 (458)
                      .+|...-+.++..  ..-+++|-+...+-.+.+.--. ..+-.++|+|||..+-+..-   ......+...-++.+..++
T Consensus       187 ttGGT~lrDDI~Rl~~~VH~~vgTPGRIlDL~~KgVa~ls~c~~lV~DEADKlLs~~F---~~~~e~li~~lP~~rQill  263 (459)
T KOG0326         187 TTGGTSLRDDIMRLNQTVHLVVGTPGRILDLAKKGVADLSDCVILVMDEADKLLSVDF---QPIVEKLISFLPKERQILL  263 (459)
T ss_pred             ECCCCCCCCCEEEECCCEEEEECCCHHHHHHHHCCCCCCHHCEEEEECHHHHHHCHHH---HHHHHHHHHHCCCCCEEEE
T ss_conf             4388654432056158269997287178888862652200114787410554414145---6789999875785420467


Q ss_pred             ECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             65840231001013467751788877532778877736956403300002455554558999997424543320000100
Q gi|255764515|r  157 LTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN  236 (458)
Q Consensus       157 LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~  236 (458)
                      -||| ++.                    ....|..++....                                       
T Consensus       264 ySAT-FP~--------------------tVk~Fm~~~l~kP---------------------------------------  283 (459)
T KOG0326         264 YSAT-FPL--------------------TVKGFMDRHLKKP---------------------------------------  283 (459)
T ss_pred             EECC-CCH--------------------HHHHHHHHHCCCC---------------------------------------
T ss_conf             6313-640--------------------5888999860586---------------------------------------


Q ss_pred             CCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHH
Q ss_conf             10011000345245368998889999998510334520223478888754203541000223430001343333256654
Q gi|255764515|r  237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVII  316 (458)
Q Consensus       237 l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il  316 (458)
                          ..+...-+++..-...|=.+                                          ...+.|+..|..+.
T Consensus       284 ----y~INLM~eLtl~GvtQyYaf------------------------------------------V~e~qKvhCLntLf  317 (459)
T KOG0326         284 ----YEINLMEELTLKGVTQYYAF------------------------------------------VEERQKVHCLNTLF  317 (459)
T ss_pred             ----CEEEHHHHHHHCCHHHHEEE------------------------------------------ECHHHHHHHHHHHH
T ss_conf             ----02204656320352321011------------------------------------------02355556499898


Q ss_pred             HCCCCCEEEEHHHHHHHHHHHHHCCC----------CCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEE
Q ss_conf             12488403422236788866410002----------65334458998764245885589984422111622001785999
Q gi|255764515|r  317 EKANAAPIIVAYHFNSDLARLQKAFP----------QGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILV  386 (458)
Q Consensus       317 ~~~~~~kviif~~~~~~~~~i~~~~~----------~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI  386 (458)
                      .+..=...|||||-..-++.+.+.+.          .-+..+.|..+.-.|.+|.++.|+|| +..--||+.| |.|++|
T Consensus       318 skLqINQsIIFCNS~~rVELLAkKITelGyscyyiHakM~Q~hRNrVFHdFr~G~crnLVct-DL~TRGIDiq-avNvVI  395 (459)
T KOG0326         318 SKLQINQSIIFCNSTNRVELLAKKITELGYSCYYIHAKMAQEHRNRVFHDFRNGKCRNLVCT-DLFTRGIDIQ-AVNVVI  395 (459)
T ss_pred             HHHCCCCEEEEECCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEH-HHHHCCCCCC-EEEEEE
T ss_conf             87500445999636317679898888616436677888877654245565432532012420-2330465541-025999


Q ss_pred             EECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             908998986864456666202202037877528999985899689999999999
Q gi|255764515|r  387 FFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       387 ~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
                      +||.|-|+..+.-++||-     .|.|-  .-..+.|++-+  |...+..++++
T Consensus       396 NFDfpk~aEtYLHRIGRs-----GRFGh--lGlAInLitye--drf~L~~IE~e  440 (459)
T KOG0326         396 NFDFPKNAETYLHRIGRS-----GRFGH--LGLAINLITYE--DRFNLYRIEQE  440 (459)
T ss_pred             ECCCCCCHHHHHHHCCCC-----CCCCC--CCEEEEEEEHH--HHHHHHHHHHH
T ss_conf             637887778999871677-----65787--62479987503--24438899998


No 93 
>KOG4284 consensus
Probab=99.45  E-value=2e-11  Score=87.42  Aligned_cols=152  Identities=16%  Similarity=0.162  Sum_probs=89.5

Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHH-HHHHHHHHHHCC-CCCEEEEECCHHHHHHHHHHHHHHCC-CCCCEEEEEECC
Q ss_conf             999999999679809995889986899-999999999759-99499991604656999999998558-888159998589
Q gi|255764515|r    7 QTKIVDWILDHKRCAIWASMGSGKTVS-VLTALSYIHLWG-EKSVLVIAPLRVAQSVWTSEVQRWSN-FSHMNISVITGT   83 (458)
Q Consensus         7 Q~~~v~~~~~~~~~ll~~~~G~GKT~~-al~~~~~l~~~~-~~~~LIv~P~~l~~~~W~~Ei~kf~~-~~~~~~~~~~g~   83 (458)
                      |..|+-.....--.++-.--|+||||. ++++...|.... .-..+||+|+.-+.-|-.+.|.+.++ +.+.++.++.|.
T Consensus        52 QaaAIP~~~~kmDliVQaKSGTGKTlVfsv~av~sl~~~~~~~q~~Iv~PTREiaVQI~~tv~~v~~sf~g~~csvfIGG  131 (980)
T KOG4284          52 QAAAIPAIFSKMDLIVQAKSGTGKTLVFSVLAVESLDSRSSHIQKVIVTPTREIAVQIKETVRKVAPSFTGARCSVFIGG  131 (980)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCEEEEEEEEEHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCEEEEECC
T ss_conf             34321144315535898137888558998543022275667620699714356645799999986524457605899668


Q ss_pred             HHHHHH-HHCCCCCEEEECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             789888-73077986998064202334420-001132204404531002465431156777766543059807996584
Q gi|255764515|r   84 VKQRTK-VLKTPAVLYVINFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        84 ~~~r~~-~~~~~~~i~i~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      .....+ .-.....|+|-|...+..+.+.- .+.-..+++|+|||..+-....-+  -...-+....++.+.+++.|||
T Consensus       132 T~~~~d~~rlk~~rIvIGtPGRi~qL~el~~~n~s~vrlfVLDEADkL~~t~sfq--~~In~ii~slP~~rQv~a~SAT  208 (980)
T KOG4284         132 TAHKLDLIRLKQTRIVIGTPGRIAQLVELGAMNMSHVRLFVLDEADKLMDTESFQ--DDINIIINSLPQIRQVAAFSAT  208 (980)
T ss_pred             CHHHHHHHHHHHCEEEECCCHHHHHHHHHCCCCCCCEEEEEECCHHHHHCHHHHH--HHHHHHHHHCCHHHEEEEEECC
T ss_conf             5435556665402378438358899987067771102688843177663202478--8899999745000025677335


No 94 
>KOG0339 consensus
Probab=99.45  E-value=6.2e-11  Score=84.49  Aligned_cols=289  Identities=19%  Similarity=0.245  Sum_probs=160.9

Q ss_pred             ECCCCCHHHHHHH-HHHHH----H-HCCCCCE-EEEECCHHHHHHHHHHHHHHCCCCCCEEEEEEC--CHHHHHHHHCCC
Q ss_conf             5889986899999-99999----9-7599949-999160465699999999855888815999858--978988873077
Q gi|255764515|r   24 ASMGSGKTVSVLT-ALSYI----H-LWGEKSV-LVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG--TVKQRTKVLKTP   94 (458)
Q Consensus        24 ~~~G~GKT~~al~-~~~~l----~-~~~~~~~-LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g--~~~~r~~~~~~~   94 (458)
                      .-+|+|||---+. .+.+.    . ..|..|+ ||+||+.-+..|-..|+++|.....+++...+|  +.-+..+.+...
T Consensus       267 AktgSgktaAfi~pm~~himdq~eL~~g~gPi~vilvPTrela~Qi~~eaKkf~K~ygl~~v~~ygGgsk~eQ~k~Lk~g  346 (731)
T KOG0339         267 AKTGSGKTAAFIWPMIVHIMDQPELKPGEGPIGVILVPTRELASQIFSEAKKFGKAYGLRVVAVYGGGSKWEQSKELKEG  346 (731)
T ss_pred             EECCCCCHHHHHHHHHHHHCCHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCC
T ss_conf             21157505677777777741405206899976999806389999999999986311264278863687488877765027


Q ss_pred             CCEEEECCCCHHHHHHHCC-CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHH
Q ss_conf             9869980642023344200-011322044045310024654311567777665430598079965840231001013467
Q gi|255764515|r   95 AVLYVINFENLGWLVQELK-GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQI  173 (458)
Q Consensus        95 ~~i~i~s~e~~~~~~~~~~-~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll  173 (458)
                      ..++|+|.+.+-...+... ....-.++|+||+-++-..+   .....|.|......-...++.|||- .-++.      
T Consensus       347 ~EivVaTPgRlid~VkmKatn~~rvS~LV~DEadrmfdmG---fe~qVrSI~~hirpdrQtllFsaTf-~~kIe------  416 (731)
T KOG0339         347 AEIVVATPGRLIDMVKMKATNLSRVSYLVLDEADRMFDMG---FEPQVRSIKQHIRPDRQTLLFSATF-KKKIE------  416 (731)
T ss_pred             CEEEEECHHHHHHHHHHHCCCCEEEEEEEEECHHHHHCCC---CHHHHHHHHHHCCCCCEEEEEECCC-HHHHH------
T ss_conf             7289966288899988603331003578871111131265---4798999986448864279860310-68899------


Q ss_pred             HHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCHHH
Q ss_conf             75178887753277887773695640330000245555455899999742454332000010010011000345245368
Q gi|255764515|r  174 WFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPV  253 (458)
Q Consensus       174 ~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~l~~~~~~~~~v~l~~~~  253 (458)
                                                                ...+..|.+.+ ++...++...-.  -++..|..-+.+
T Consensus       417 ------------------------------------------~lard~L~dpV-rvVqg~vgean~--dITQ~V~V~~s~  451 (731)
T KOG0339         417 ------------------------------------------KLARDILSDPV-RVVQGEVGEANE--DITQTVSVCPSE  451 (731)
T ss_pred             ------------------------------------------HHHHHHHCCCE-EEEEEEHHCCCC--CHHHEEEECCCC
T ss_conf             ------------------------------------------99999735972-678740102566--524246523681


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHHHCCCCCEEEEHHHHH--
Q ss_conf             998889999998510334520223478888754203541000223430001343333256654124884034222367--
Q gi|255764515|r  254 MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFN--  331 (458)
Q Consensus       254 ~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il~~~~~~kviif~~~~--  331 (458)
                      .+.+.-+.+.+.                                                   +.....++|+|..-+  
T Consensus       452 ~~Kl~wl~~~L~---------------------------------------------------~f~S~gkvlifVTKk~~  480 (731)
T KOG0339         452 EKKLNWLLRHLV---------------------------------------------------EFSSEGKVLIFVTKKAD  480 (731)
T ss_pred             HHHHHHHHHHHH---------------------------------------------------HHCCCCCEEEEEECCCC
T ss_conf             788899999755---------------------------------------------------01367847999942278


Q ss_pred             --HHHHHHH------HCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHH
Q ss_conf             --8886641------00026533445899876424588558998442211162200178599990899898686445666
Q gi|255764515|r  332 --SDLARLQ------KAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER  403 (458)
Q Consensus       332 --~~~~~i~------~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gR  403 (458)
                        .....|.      ..+++++-..+|.+.+.+|+.+..+||+++ +.++-|++.... ..||+||.--+-..+.|++||
T Consensus       481 ~e~i~a~Lklk~~~v~llhgdkdqa~rn~~ls~fKkk~~~Vlvat-DvaargldI~~i-kTVvnyD~ardIdththrigr  558 (731)
T KOG0339         481 AEEIAANLKLKGFNVSLLHGDKDQAERNEVLSKFKKKRKPVLVAT-DVAARGLDIPSI-KTVVNYDFARDIDTHTHRIGR  558 (731)
T ss_pred             HHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEE-EHHHCCCCCCCC-CEEECCCCCCHHHHHHHHHHH
T ss_conf             999998732056325652274566777779998762477548884-076517875220-102343222106778877510


Q ss_pred             HHCCCCHHCCCCCCEEEEEEEECC
Q ss_conf             620220203787752899998589
Q gi|255764515|r  404 IGVTRQRQAGFKRAVFVYYLIAQN  427 (458)
Q Consensus       404 i~~~r~hR~Gq~~~v~v~~li~~~  427 (458)
                      --     |-|-+ . ..|-||++.
T Consensus       559 tg-----Rag~k-G-vayTlvTeK  575 (731)
T KOG0339         559 TG-----RAGEK-G-VAYTLVTEK  575 (731)
T ss_pred             CC-----CCCCC-C-EEEEEECHH
T ss_conf             23-----35556-5-136873355


No 95 
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=99.43  E-value=5e-11  Score=85.07  Aligned_cols=125  Identities=20%  Similarity=0.220  Sum_probs=88.9

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCC-CEEEE-E
Q ss_conf             747899999999967980999588998689999999999975999499991604656999999998558888-15999-8
Q gi|255764515|r    3 LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSH-MNISV-I   80 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~-~~~~~-~   80 (458)
                      +.-.|..=+..++.+..+.+.+++|+|||---+.++.++-..| ++++||+|++++..|=.+-+.+|..... .++.+ +
T Consensus        83 ~ws~QR~WakR~~rg~SFaiiAPTGvGKTTfg~~~sl~~a~kg-kr~yii~PT~~Lv~Q~~~kl~~~~e~~~~~~~~~~y  161 (1187)
T COG1110          83 PWSAQRVWAKRLVRGKSFAIIAPTGVGKTTFGLLMSLYLAKKG-KRVYIIVPTTTLVRQVYERLKKFAEDAGSLDVLVVY  161 (1187)
T ss_pred             CHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             6078899999987378448982788765479999999987558-749999667899999999999988653785246653


Q ss_pred             ECC--HHHHHH----HHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCC
Q ss_conf             589--789888----7307798699806420233442000113220440453100
Q gi|255764515|r   81 TGT--VKQRTK----VLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKL  129 (458)
Q Consensus        81 ~g~--~~~r~~----~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~l  129 (458)
                      ++.  .+++.+    +-+++.+|+|+|-+.+....+.+.. .+||+|.+|..-.+
T Consensus       162 h~~l~~~ekee~le~i~~gdfdIlitTs~FL~k~~e~L~~-~kFdfifVDDVDA~  215 (1187)
T COG1110         162 HSALPTKEKEEALERIESGDFDILITTSQFLSKRFEELSK-LKFDFIFVDDVDAI  215 (1187)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHCC-CCCCEEEECCHHHH
T ss_conf             1236657799999998659963999747878866998404-57778998047889


No 96 
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated
Probab=99.42  E-value=3.4e-10  Score=79.99  Aligned_cols=82  Identities=13%  Similarity=0.190  Sum_probs=53.7

Q ss_pred             CCHHHHHHCCCCCEEEEHHHHHH---HHHHHHHC--------CCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCC
Q ss_conf             32566541248840342223678---88664100--------02653344589987642458855899844221116220
Q gi|255764515|r  310 KALEVIIEKANAAPIIVAYHFNS---DLARLQKA--------FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNL  378 (458)
Q Consensus       310 ~~l~~il~~~~~~kviif~~~~~---~~~~i~~~--------~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL  378 (458)
                      +.+..+++..+|.-.+.|+.+..   +...+...        +.+|.+...|...+++|++++..||+++ .+-.||+|+
T Consensus       746 ~~i~~l~~~~~G~~LVLFtS~~~L~~v~~~l~~~~~~~~~~ll~Qg~~~~sr~~ll~~F~~~~~svLlGt-~SFwEGVDl  824 (932)
T PRK08074        746 AYIAKIAKATKGRMLVLFTSYEMLKKTYYNLKNEEELEGYVLLAQGVTGGSRARLMKKFQQFDKAILLGT-SSFWEGIDI  824 (932)
T ss_pred             HHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEEC-CCCCCCCCC
T ss_conf             9999999872999999926599999999998643335795599878987509999999984798499965-664356227


Q ss_pred             CC-CCCEEEEECCCC
Q ss_conf             01-785999908998
Q gi|255764515|r  379 QY-GGNILVFFSLWW  392 (458)
Q Consensus       379 ~~-a~~~iI~~~~~w  392 (458)
                      .. +.+.||..-+|+
T Consensus       825 pGd~L~~ViI~kLPF  839 (932)
T PRK08074        825 PGDELSCLVIVRLPF  839 (932)
T ss_pred             CCCCEEEEEEEECCC
T ss_conf             998868999980899


No 97 
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype; InterPro: IPR013444    This entry represents a CRISPR-associated putative DEAH-box helicase, or Cas3, subtype found in Actinomyces naeslundii MG1, Geobacter sulfurreducens PCA, Gemmata obscuriglobus UQM 2246, and Desulfotalea psychrophila. The proteins include both DEAH and HD motifs..
Probab=99.40  E-value=2.1e-11  Score=87.32  Aligned_cols=96  Identities=15%  Similarity=0.196  Sum_probs=63.4

Q ss_pred             CCCCEEEEHHHHHHHHHHHHHCCCC----------------CCCHHHHHHHHHHH----CCC------CCCEEEEEHHHC
Q ss_conf             4884034222367888664100026----------------53344589987642----458------855899844221
Q gi|255764515|r  319 ANAAPIIVAYHFNSDLARLQKAFPQ----------------GRTLDKDPCTIQEW----NEG------KIPLLFAHPASC  372 (458)
Q Consensus       319 ~~~~kviif~~~~~~~~~i~~~~~~----------------g~~~~~r~~~i~~f----~~~------~~~vli~s~~~~  372 (458)
                      +.|..|+|||+-...+..+...+.+                +.+..++.+++.+|    +.+      .-.++|+.|.++
T Consensus       309 s~g~~~~Vf~~~~~~v~~v~a~L~k~~~~~~~ltG~vr~~~~d~lar~~~~~~~~Lpp~~~~s~g~~~~g~~~vVaTst~  388 (975)
T TIGR02621       309 SSGEAILVFCNTVDEVKKVVAKLPKEARRLEDLTGTVRGLERDMLARRGEIFNRFLPPYRSGSEGRPQQGTVYVVATSTG  388 (975)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHCCCCCCCHHHHCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCEEEEEECCE
T ss_conf             27866999876843068988645774540776288104334785200131453148764567736689987799973242


Q ss_pred             CCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCC--EEEEEE
Q ss_conf             116220017859999089989868644566662022020378775--289999
Q gi|255764515|r  373 GHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA--VFVYYL  423 (458)
Q Consensus       373 ~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~--v~v~~l  423 (458)
                      .+|.||. +. +++ .|. =....+.||.||++     |.|....  +.|.|.
T Consensus       389 EVGadld-fd-hLv-t~~-~~~~sl~QRfGRvn-----R~G~r~~~~~~iVh~  432 (975)
T TIGR02621       389 EVGADLD-FD-HLV-TDL-APFESLVQRFGRVN-----RFGERLDGSIAIVHS  432 (975)
T ss_pred             EECCCCC-CC-HHH-HCC-CHHHHHHHHHHHHC-----CCCCCCCCEEEEEEC
T ss_conf             5503443-11-122-114-42457865430020-----002231650589856


No 98 
>KOG0334 consensus
Probab=99.36  E-value=4.6e-10  Score=79.19  Aligned_cols=309  Identities=16%  Similarity=0.190  Sum_probs=165.8

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC-----CCCC-EEEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             874789999999996798099958899868999-9999999975-----9994-99991604656999999998558888
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW-----GEKS-VLVIAPLRVAQSVWTSEVQRWSNFSH   74 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~-----~~~~-~LIv~P~~l~~~~W~~Ei~kf~~~~~   74 (458)
                      +.+|-|.+|+=.+...+-++-...+|+|||+-- +-.+.+...+     |.+| .||+||+.-+..|-.+++.+|....+
T Consensus       387 k~~~IQ~qAiP~ImsGrdvIgvakTgSGKT~af~LPmirhi~dQr~~~~gdGPi~li~aPtrela~QI~r~~~kf~k~l~  466 (997)
T KOG0334         387 KPTPIQAQAIPAIMSGRDVIGVAKTGSGKTLAFLLPMIRHIKDQRPLEEGDGPIALILAPTRELAMQIHREVRKFLKLLG  466 (997)
T ss_pred             CCCCHHHHHCCHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCHHCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCC
T ss_conf             98755664301222577458773268862034421155542047971107886479973777899999999999877417


Q ss_pred             CEEEEE-ECCHHHH-HHHHCCCCCEEEECCCCHHHH-H---HHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             159998-5897898-887307798699806420233-4---420001132204404531002465431156777766543
Q gi|255764515|r   75 MNISVI-TGTVKQR-TKVLKTPAVLYVINFENLGWL-V---QELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA  148 (458)
Q Consensus        75 ~~~~~~-~g~~~~r-~~~~~~~~~i~i~s~e~~~~~-~---~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~  148 (458)
                      +.+... .|+.... ...+.....|+|++...+-.. .   ..+.....-..+++|||-++-.. +            . 
T Consensus       467 ir~v~vygg~~~~~qiaelkRg~eIvV~tpGRmiD~l~~n~grvtnlrR~t~lv~deaDrmfdm-g------------f-  532 (997)
T KOG0334         467 IRVVCVYGGSGISQQIAELKRGAEIVVCTPGRMIDILCANSGRVTNLRRVTYLVLDEADRMFDM-G------------F-  532 (997)
T ss_pred             CEEEEECCCCCHHHHHHHHHCCCCEEEECCCHHHHHHHHCCCCCCCCCCCCEEEECHHHHHHHC-C------------C-
T ss_conf             6279842785188789998678965996450323366615776233101103554112354400-4------------5-


Q ss_pred             HCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             05980799658402310010134677517888775327788777369564033000024555545589999974245433
Q gi|255764515|r  149 WESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLS  228 (458)
Q Consensus       149 ~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~  228 (458)
                        .+....     +.++          +.|....-.+-.+|                      .+....+...       
T Consensus       533 --ePq~~~-----Ii~n----------lrpdrQtvlfSatf----------------------pr~m~~la~~-------  566 (997)
T KOG0334         533 --EPQITR-----ILQN----------LRPDRQTVLFSATF----------------------PRSMEALARK-------  566 (997)
T ss_pred             --CCCCEE-----HHHH----------CCHHHHHHHHHHHH----------------------HHHHHHHHHH-------
T ss_conf             --754040-----9764----------66035434566220----------------------6999999988-------


Q ss_pred             HHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCC
Q ss_conf             20000100100110003452453689988899999985103345202234788887542035410002234300013433
Q gi|255764515|r  229 LDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEK  308 (458)
Q Consensus       229 ~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k  308 (458)
                           ....|..    +.|.        ++..        ..+++.                      ..-......+.|
T Consensus       567 -----vl~~Pve----iiv~--------~~sv--------V~k~V~----------------------q~v~V~~~e~eK  599 (997)
T KOG0334         567 -----VLKKPVE----IIVG--------GRSV--------VCKEVT----------------------QVVRVCAIENEK  599 (997)
T ss_pred             -----HHCCCEE----EEEC--------CCEE--------EECCEE----------------------EEEEEECCCHHH
T ss_conf             -----6158808----9974--------6305--------742404----------------------899981483677


Q ss_pred             CCCHHHHHH-CCCCCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCC
Q ss_conf             332566541-2488403422236788866410----------00265334458998764245885589984422111622
Q gi|255764515|r  309 IKALEVIIE-KANAAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN  377 (458)
Q Consensus       309 ~~~l~~il~-~~~~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~Gln  377 (458)
                      +..|.+++. ..+..+.|||+.-....+.+..          .+++|.+...|...++.|+++.+.+|+++ ..++-||+
T Consensus       600 f~kL~eLl~e~~e~~~tiiFv~~qe~~d~l~~~L~~ag~~~~slHGgv~q~dR~sti~dfK~~~~~LLvaT-svvarGLd  678 (997)
T KOG0334         600 FLKLLELLGERYEDGKTIIFVDKQEKADALLRDLQKAGYNCDSLHGGVDQHDRSSTIEDFKNGVVNLLVAT-SVVARGLD  678 (997)
T ss_pred             HHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHCCCCHHHHCCCCCHHHHHHHHHHHHCCCCEEEEEH-HHHHCCCC
T ss_conf             99999999988624887999847147889999998568605430578756778858999745674289851-45426766


Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEEC
Q ss_conf             0017859999089989868644566662022020378775289999858
Q gi|255764515|r  378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQ  426 (458)
Q Consensus       378 L~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~  426 (458)
                      ... -.++|+||.|-...++--+.||-  .|+.|-|     ..|-|+.+
T Consensus       679 v~~-l~Lvvnyd~pnh~edyvhR~gRT--gragrkg-----~AvtFi~p  719 (997)
T KOG0334         679 VKE-LILVVNYDFPNHYEDYVHRVGRT--GRAGRKG-----AAVTFITP  719 (997)
T ss_pred             CCC-EEEEEECCCCHHHHHHHHHHCCC--CCCCCCC-----EEEEEECH
T ss_conf             654-05899736631279999985135--6677763-----37998577


No 99 
>TIGR01054 rgy reverse gyrase; InterPro: IPR005736   DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis , . DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA .   Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.    Reverse gyrase is a type IA topoisomerase that is unique among these enzymes in its requirement for ATP. Reverse gyrase is a hyperthermophile-specific enzyme that acts as a renaturase by positively supercoiling DNA, and by annealing complementary single-strand circles . Hyperthermophilic organisms must protect themselves against heat-induced degradation, and reverse gyrase acts to reduce the rate of double-strand DNA breakage, a function that does not require ATP hydrolysis and which is independent of its positive supercoiling abilities. Reverse gyrase achieves this by recognising nicked DNA and recruiting a protein coat to the site of damage .   More information about this protein can be found at Protein of the Month: DNA Topoisomerase .; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0006268 DNA unwinding during replication, 0005694 chromosome.
Probab=99.34  E-value=2.7e-10  Score=80.60  Aligned_cols=123  Identities=19%  Similarity=0.207  Sum_probs=92.9

Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEE----EEEEC
Q ss_conf             99999999967980999588998689999999999975999499991604656999999998558888159----99858
Q gi|255764515|r    7 QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI----SVITG   82 (458)
Q Consensus         7 Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~----~~~~g   82 (458)
                      |.-=...++.+..+.+..|||.|||.--++++.++..+..++++||.|++++..|=.+-|..+....++..    ..+++
T Consensus        89 Qk~WAKRv~~~~SFai~APTGVGKttFG~~mslflA~kKGkR~y~ilPT~lLv~Qv~~kl~~~~~k~g~~~~~l~~~yhS  168 (1843)
T TIGR01054        89 QKSWAKRVLKGDSFAIVAPTGVGKTTFGLVMSLFLAKKKGKRSYIILPTTLLVKQVAEKLSSLAEKEGVGIVRLLGAYHS  168 (1843)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEC
T ss_conf             79999996417964898058876779999999998654298789994707889999999875200257500002221011


Q ss_pred             --CHHHH----HHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCC
Q ss_conf             --97898----887307798699806420233442000113220440453100
Q gi|255764515|r   83 --TVKQR----TKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKL  129 (458)
Q Consensus        83 --~~~~r----~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~l  129 (458)
                        +.+.+    +.+.+++++|+|+|-.-+....+.+.+.++|++|+||-.=.+
T Consensus       169 ~L~~~~kke~~Eri~~GDfdilitT~~FL~K~~~~L~~~y~F~liFVDDVDa~  221 (1843)
T TIGR01054       169 KLSTKEKKEVKERIENGDFDILITTSMFLSKNFDKLKNQYKFDLIFVDDVDAL  221 (1843)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEHHHHHHHHHHHHHCCCCCEEEEEEEECHHHH
T ss_conf             26545678899987318917861224688876651789851448997153676


No 100
>TIGR01587 cas3_core CRISPR-associated helicase Cas3; InterPro: IPR006474    This entry represents a highly conserved core region of the Cas3 sequences. The proteins are found in association with CRISPR repeat elements in a broad range of bacteria and Archaea . Cas3 appears to be a helicase, containing a DEAD/DEAH box region and conserved C-terminal domain. Some but not all members have an N-terminal HD domain region (IPR006674 from INTERPRO), these sequences are not included within this group..
Probab=99.34  E-value=7e-11  Score=84.16  Aligned_cols=114  Identities=11%  Similarity=0.248  Sum_probs=62.4

Q ss_pred             CCCHHHH-HHCC-CCCEEEEHHHHHHHHHHHHHCCC-----------------CCCCHHHH--HHHHHHHCC----CCCC
Q ss_conf             3325665-4124-88403422236788866410002-----------------65334458--998764245----8855
Q gi|255764515|r  309 IKALEVI-IEKA-NAAPIIVAYHFNSDLARLQKAFP-----------------QGRTLDKD--PCTIQEWNE----GKIP  363 (458)
Q Consensus       309 ~~~l~~i-l~~~-~~~kviif~~~~~~~~~i~~~~~-----------------~g~~~~~r--~~~i~~f~~----~~~~  363 (458)
                      +..+.++ ++.. .+.+++|++|.+.....++..+.                 ...-.++.  ...+.+|.+    ...+
T Consensus       255 ~~~~~~~~~~~~~~~~~~~ii~NtV~~A~~~Y~~~kE~~p~~~~~~L~HsRF~~~DR~~KEde~~~l~e~~~S~~~~~~~  334 (424)
T TIGR01587       255 ISSLERLLLEELKKGGKVLIIVNTVDRAQEFYQKLKEKAPELEEVILLHSRFTEKDRAKKEDEAELLKELKKSAWKDNEK  334 (424)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEECHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             34666677874157786699985438999999998512652002124404477003667767999999851013544577


Q ss_pred             EEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCC--CCCCEEEEEEEECC
Q ss_conf             89984422111622001785999908998986864456666202202037--87752899998589
Q gi|255764515|r  364 LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG--FKRAVFVYYLIAQN  427 (458)
Q Consensus       364 vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~G--q~~~v~v~~li~~~  427 (458)
                      .++++|+++..|||+. + +++| -| .=-+..+.||.||+.|+. .++|  ...+|+|+.-..++
T Consensus       335 ~v~V~TQv~E~SlD~s-~-D~~i-Te-~aP~d~LiQR~GR~~R~~-~~~~d~~~~~~y~~~~~~~~  395 (424)
T TIGR01587       335 FVIVATQVIEVSLDIS-V-DVMI-TE-LAPIDSLIQRLGRLNRYG-RKIGDIENREVYILTILLED  395 (424)
T ss_pred             EEEEEEEEEEEEEECC-C-CHHH-HH-CCCHHHHHHHHHHHCCCC-CCCCCCCCCCEEEEEECCCC
T ss_conf             0699878788864204-4-4134-31-150123355421110113-56578898720378525788


No 101
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=99.33  E-value=3.5e-09  Score=73.85  Aligned_cols=152  Identities=22%  Similarity=0.211  Sum_probs=94.1

Q ss_pred             CCCHHHHHHHHHHHHC----CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCE
Q ss_conf             8747899999999967----98099958899868999999999997599949999160-465699999999855888815
Q gi|255764515|r    2 NLAPHQTKIVDWILDH----KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMN   76 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~----~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~   76 (458)
                      .|.+-|..|++.+...    ..+||...+|+|||=.=+-+++.....| +.+||++|- ++..+.|.+=-.+|.    .+
T Consensus       198 ~Ln~~Q~~a~~~i~~~~~~~~~~Ll~GvTGSGKTEvYl~~i~~~L~~G-kqvLvLVPEI~Ltpq~~~rf~~rFg----~~  272 (730)
T COG1198         198 ALNQEQQAAVEAILSSLGGFAPFLLDGVTGSGKTEVYLEAIAKVLAQG-KQVLVLVPEIALTPQLLARFKARFG----AK  272 (730)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEECCCCCHHHHHHHHHHHHC----CC
T ss_conf             038899999999997505666536767778858999999999999759-8799995653456999999999867----87


Q ss_pred             EEEEEC--CHHHHHHHHC----CCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCC--CCCCCCCCHHHHHHHHHHHH
Q ss_conf             999858--9789888730----779869980642023344200011322044045310--02465431156777766543
Q gi|255764515|r   77 ISVITG--TVKQRTKVLK----TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTK--LKSFRLRQGSKTARALAKPA  148 (458)
Q Consensus        77 ~~~~~g--~~~~r~~~~~----~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~--lkn~~~~~~s~~~~~l~~~~  148 (458)
                      +.+++.  ++.+|...|.    +...++|-+..++-      ....+-.+||+||=|-  +|-.....+..+--++.+..
T Consensus       273 v~vlHS~Ls~~er~~~W~~~~~G~~~vVIGtRSAlF------~Pf~~LGLIIvDEEHD~sYKq~~~prYhARdvA~~Ra~  346 (730)
T COG1198         273 VAVLHSGLSPGERYRVWRRARRGEARVVIGTRSALF------LPFKNLGLIIVDEEHDSSYKQEDGPRYHARDVAVLRAK  346 (730)
T ss_pred             HHHHCCCCCHHHHHHHHHHHHCCCCEEEEEECHHHC------CCHHHCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             453146579278999999985597159997122330------72312576997024564324777777678999999988


Q ss_pred             HCCCEEEEECCCCHHH
Q ss_conf             0598079965840231
Q gi|255764515|r  149 WESERFIELTGTPSPN  164 (458)
Q Consensus       149 ~~~~~~l~LTgTPi~n  164 (458)
                      ....-+++-||||.-.
T Consensus       347 ~~~~pvvLgSATPSLE  362 (730)
T COG1198         347 KENAPVVLGSATPSLE  362 (730)
T ss_pred             HCCCCEEEECCCCCHH
T ss_conf             6099889826887789


No 102
>TIGR00631 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 All proteins in this family for which functions are known are DNA helicases that function in the nucleotide excision repair and are endonucleases that make the 3' incision next to DNA damage. They are part of a pathway requiring UvrA, UvrB, UvrC, and UvrD homologs.; GO: 0009381 excinuclease ABC activity, 0006289 nucleotide-excision repair, 0005737 cytoplasm, 0009380 excinuclease repair complex.
Probab=99.33  E-value=1.6e-10  Score=81.95  Aligned_cols=122  Identities=16%  Similarity=0.170  Sum_probs=80.6

Q ss_pred             CCHHHHHHC-CCCCEEEEHHHHHHHHHHHHHCC----------CCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCC
Q ss_conf             325665412-48840342223678886641000----------2653344589987642458855899844221116220
Q gi|255764515|r  310 KALEVIIEK-ANAAPIIVAYHFNSDLARLQKAF----------PQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNL  378 (458)
Q Consensus       310 ~~l~~il~~-~~~~kviif~~~~~~~~~i~~~~----------~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL  378 (458)
                      |.+.+|-.. ..+++++|=+=.+.|..-|..-|          |.+--.=+|.++|..-+.|+++|||+ +.-.-|||||
T Consensus       435 DL~~EI~~R~~~~ERvLVTTLTKkMAEdLTdYl~E~Gikv~YLHSeIdt~ER~eiirdLR~G~fDVLVG-INLLREGLDl  513 (667)
T TIGR00631       435 DLLSEIRQRVARNERVLVTTLTKKMAEDLTDYLKELGIKVRYLHSEIDTLERVEIIRDLRLGEFDVLVG-INLLREGLDL  513 (667)
T ss_pred             HHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCCEEEEE-CCHHHCCCCC
T ss_conf             889999999972894899820167788999997058837987145578999999999844788408860-0020024651


Q ss_pred             CCCCCEEEEEC-----CCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEE-EEEECCCHHHHHHHHHHHH
Q ss_conf             01785999908-----99898686445666620220203787752899-9985899689999999999
Q gi|255764515|r  379 QYGGNILVFFS-----LWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY-YLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       379 ~~a~~~iI~~~-----~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~-~li~~~tide~i~~~~~~K  440 (458)
                      ..=+=|.| +|     ..-|...+.|-|||.+|   +=-|   .|..| .=|| +|+++.|-++-++.
T Consensus       514 PEVSLVAI-LDADKEGFLRSerSLIQTIGRAAR---N~~G---~VilYAD~iT-~sM~~AI~ET~RRR  573 (667)
T TIGR00631       514 PEVSLVAI-LDADKEGFLRSERSLIQTIGRAAR---NVNG---KVILYADKIT-DSMQKAIEETERRR  573 (667)
T ss_pred             HHHHHHHH-HCCCCCCCCCCCCHHHHHHHHHHH---CCCC---EEEEECCCCC-HHHHHHHHHHHHHH
T ss_conf             14889976-327888998663027889888752---5796---5999728700-78999999878889


No 103
>PRK05298 excinuclease ABC subunit B; Provisional
Probab=99.31  E-value=9.4e-10  Score=77.34  Aligned_cols=86  Identities=13%  Similarity=0.094  Sum_probs=64.1

Q ss_pred             CCCCEEEEHHHHHHHHHHHHHC----------CCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEE
Q ss_conf             4884034222367888664100----------026533445899876424588558998442211162200178599990
Q gi|255764515|r  319 ANAAPIIVAYHFNSDLARLQKA----------FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFF  388 (458)
Q Consensus       319 ~~~~kviif~~~~~~~~~i~~~----------~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~  388 (458)
                      ..+++++|-+-.+.+...+..-          ++.....-+|.+++...+.|+.+||++ +....|||+|... +.|..+
T Consensus       444 ~~~er~LvttlTkkmaEdLt~yl~~~~ik~~YlHs~i~t~eR~eIl~~LR~G~~DVlVG-INLLREGLDlPEV-SLVaIL  521 (657)
T PRK05298        444 AKGERVLVTTLTKRMAEDLTDYLKELGIKVRYLHSDIDTLERVEIIRDLRLGEFDVLVG-INLLREGLDIPEV-SLVAIL  521 (657)
T ss_pred             HCCCEEEEEECHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCCEEEE-ECHHHCCCCCCCE-EEEEEE
T ss_conf             36976999954598999999999967980799626661889999999985888758975-0022045787613-579887


Q ss_pred             CC-----CCCHHHHHHHHHHHHC
Q ss_conf             89-----9898686445666620
Q gi|255764515|r  389 SL-----WWDLEEHQQMIERIGV  406 (458)
Q Consensus       389 ~~-----~wn~~~~~Q~~gRi~~  406 (458)
                      |-     --|...+.|.+||..|
T Consensus       522 DADKeGFLRs~~SLiQtiGRAAR  544 (657)
T PRK05298        522 DADKEGFLRSERSLIQTIGRAAR  544 (657)
T ss_pred             ECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             06852210352059999878862


No 104
>pfam00271 Helicase_C Helicase conserved C-terminal domain. The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.
Probab=99.25  E-value=1e-11  Score=89.23  Aligned_cols=67  Identities=24%  Similarity=0.435  Sum_probs=58.9

Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCC
Q ss_conf             00265334458998764245885589984422111622001785999908998986864456666202202037
Q gi|255764515|r  340 AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG  413 (458)
Q Consensus       340 ~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~G  413 (458)
                      .++++.+.++|...++.|++++.++++++ .++++|+|++. ++++|++++|||+..+.|+.||+     +|.|
T Consensus        12 ~i~g~~~~~~R~~~~~~f~~~~~~ilv~t-~~~~~Gid~~~-~~~vi~~~~~~s~~~~~Q~~GR~-----~R~g   78 (78)
T pfam00271        12 RLHGGLSQEEREEILEDFRNGKSKVLVAT-DVAGRGIDLPD-VNVVINYDLPWNPASYIQRIGRA-----GRAG   78 (78)
T ss_pred             EEECCCCHHHHHHHHHHHHCCCCEEEEEE-CCCCCCCCCCC-CCEEEEECCCCCHHHHHHHHCCC-----CCCC
T ss_conf             98697999999999999987997399992-56525677878-99999978996989999997268-----7799


No 105
>KOG0949 consensus
Probab=99.25  E-value=1.5e-08  Score=70.02  Aligned_cols=154  Identities=17%  Similarity=0.112  Sum_probs=86.6

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHH-HHHHCCCCCEEEEECCHHHHHHHHHHH-HHH-CCCCCCEEEEEEC
Q ss_conf             8999999999679809995889986899999999-999759994999916046569999999-985-5888815999858
Q gi|255764515|r    6 HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIAPLRVAQSVWTSEV-QRW-SNFSHMNISVITG   82 (458)
Q Consensus         6 ~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~-~l~~~~~~~~LIv~P~~l~~~~W~~Ei-~kf-~~~~~~~~~~~~g   82 (458)
                      ||.+-.+-.=.+...+|..++-+|||+..-.+++ .|.....+-++.|+|+-.+.||-..++ .+| ++.....+.. -|
T Consensus       515 WQ~elLDsvDr~eSavIVAPTSaGKTfisfY~iEKVLResD~~VVIyvaPtKaLVnQvsa~VyaRF~~~t~~rg~sl-~g  593 (1330)
T KOG0949         515 WQRELLDSVDRNESAVIVAPTSAGKTFISFYAIEKVLRESDSDVVIYVAPTKALVNQVSANVYARFDTKTFLRGVSL-LG  593 (1330)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCEECCHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCHHH-HH
T ss_conf             88877665505662599820467861005899999985427987999664587766666778876336765631346-76


Q ss_pred             C--HHHHHHHHCCCCCEEEECCCCHHHHHHH----CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             9--7898887307798699806420233442----000113220440453100246543115677776654305980799
Q gi|255764515|r   83 T--VKQRTKVLKTPAVLYVINFENLGWLVQE----LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIE  156 (458)
Q Consensus        83 ~--~~~r~~~~~~~~~i~i~s~e~~~~~~~~----~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~  156 (458)
                      +  ...+.+-|  ..+|.|+-.+-+....-.    ...--....+|+||.|.+.|...   +..-..+..+. . .-.++
T Consensus       594 ~ltqEYsinp~--nCQVLITvPecleslLlspp~~q~~cerIRyiIfDEVH~iG~~ed---~l~~Eqll~li-~-CP~L~  666 (1330)
T KOG0949         594 DLTQEYSINPW--NCQVLITVPECLESLLLSPPHHQKFCERIRYIIFDEVHLIGNEED---GLLWEQLLLLI-P-CPFLV  666 (1330)
T ss_pred             HHHHHHCCCCH--HCEEEEECHHHHHHHHCCCHHHHHHHHCCEEEEECHHHHCCCCCC---CHHHHHHHHHC-C-CCEEE
T ss_conf             66677357841--135999746789988638566530224005897112332465243---41899877745-7-87068


Q ss_pred             ECCCCHHHHCCCH
Q ss_conf             6584023100101
Q gi|255764515|r  157 LTGTPSPNGLIDL  169 (458)
Q Consensus       157 LTgTPi~n~~~el  169 (458)
                      ||||-  ++|..+
T Consensus       667 LSATi--gN~~l~  677 (1330)
T KOG0949         667 LSATI--GNPNLF  677 (1330)
T ss_pred             EECCC--CCHHHH
T ss_conf             74133--888899


No 106
>PRK09401 reverse gyrase; Reviewed
Probab=99.24  E-value=7.6e-09  Score=71.83  Aligned_cols=129  Identities=20%  Similarity=0.163  Sum_probs=89.6

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCC--CCEEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160465699999999855888--815999
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFS--HMNISV   79 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~--~~~~~~   79 (458)
                      ++...|..=+..++.+..+.+.+++|+|||--.+.++.++..+ .+++++|.|+.++..|=.+-+..|....  ..++..
T Consensus        78 ~~w~~Qr~WakR~~~g~SFaiiAPTG~GKTtfgl~~sly~a~k-gkks~~i~PT~~Lv~Q~~~kl~~~~~~~~~~~~~~~  156 (1176)
T PRK09401         78 EPWSLQRTWAKRLLLGESFAIIAPTGVGKTTFGLVMALYLAKK-GKKSYIIFPTRLLVEQVVEKLRKLAEKVGVKVRLLY  156 (1176)
T ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9848899999998668974898889988889999999999865-983999968889999999999999997099840899


Q ss_pred             EECC--HHHHHH----HHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCC-CCCC
Q ss_conf             8589--789888----730779869980642023344200011322044045310-0246
Q gi|255764515|r   80 ITGT--VKQRTK----VLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTK-LKSF  132 (458)
Q Consensus        80 ~~g~--~~~r~~----~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~-lkn~  132 (458)
                      ++|.  .+++.+    +-.++++|+|+|-.-+....+.+ ....|++|.+|-.-. +|+.
T Consensus       157 y~~~~~~~~kee~~~~~~~gdfdIlitT~~fl~kn~~~l-~~~~f~fifvDDVDs~LKss  215 (1176)
T PRK09401        157 YHSSLKKKEKEEFLERLEEGDFDILVTTSQFLSKNFDEL-PKDRFDFVFVDDVDAVLKSS  215 (1176)
T ss_pred             EECCCCHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHC-CCCCCCEEEEECHHHHHHHH
T ss_conf             856776667899998865599868998567676548760-35688889993418777523


No 107
>KOG0332 consensus
Probab=99.22  E-value=1e-09  Score=77.16  Aligned_cols=308  Identities=19%  Similarity=0.214  Sum_probs=155.1

Q ss_pred             CCCCHHHHHHHHHH----------------HHC-CCEEEEE-CCCCCHHHH-HHHHHHHHHHC-CCCCEEEEECCHHHHH
Q ss_conf             98747899999999----------------967-9809995-889986899-99999999975-9994999916046569
Q gi|255764515|r    1 MNLAPHQTKIVDWI----------------LDH-KRCAIWA-SMGSGKTVS-VLTALSYIHLW-GEKSVLVIAPLRVAQS   60 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~----------------~~~-~~~ll~~-~~G~GKT~~-al~~~~~l~~~-~~~~~LIv~P~~l~~~   60 (458)
                      |.|.|.=+.|+..|                +.+ ++-++|- .-|+|||.. +++.+...... .....+.++|..-+..
T Consensus        95 L~LkPellkgly~M~F~kPskIQe~aLPlll~~Pp~nlIaQsqsGtGKTaaFvL~MLsRvd~~~~~PQ~iCLaPtrELA~  174 (477)
T KOG0332          95 LRLKPELLKGLYAMKFQKPSKIQETALPLLLAEPPQNLIAQSQSGTGKTAAFVLTMLSRVDPDVVVPQCICLAPTRELAP  174 (477)
T ss_pred             HCCCHHHHHHHHHHCCCCCCHHHHHHCCHHHCCCCHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCEEECCHHHHHH
T ss_conf             17798998578875268832577752125305982656655017886058999999873483335877405476177799


Q ss_pred             HHHHHHHHHCCCCCCEEE-EEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCC--CCCCCCEEECCCCCCCCCCCCCCH
Q ss_conf             999999985588881599-98589789888730779869980642023344200--011322044045310024654311
Q gi|255764515|r   61 VWTSEVQRWSNFSHMNIS-VITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK--GTWPFATIVVDESTKLKSFRLRQG  137 (458)
Q Consensus        61 ~W~~Ei~kf~~~~~~~~~-~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~--~~~~~~~iIiDEaH~lkn~~~~~~  137 (458)
                      |-.+-+++-..+-.+... .+.|+...|..-  -..+|++-+...+..+...+.  ........++|||-.+-+..+-+.
T Consensus       175 Q~~eVv~eMGKf~~ita~yair~sk~~rG~~--l~eqIviGTPGtv~Dl~~klk~id~~kikvfVlDEAD~Mi~tqG~~D  252 (477)
T KOG0332         175 QTGEVVEEMGKFTELTASYAIRGSKAKRGNK--LTEQIVIGTPGTVLDLMLKLKCIDLEKIKVFVLDEADVMIDTQGFQD  252 (477)
T ss_pred             HHHHHHHHHCCCEEEEEEEEECCCCCCCCCC--CHHHEEECCCCCHHHHHHHHHHHCHHHCEEEEECCHHHHHHCCCCCC
T ss_conf             8989999846701146899853764446773--32221317994289999998742766643888532255543136655


Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             56777766543059807996584023100101346775178887753277887773695640330000245555455899
Q gi|255764515|r  138 SKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKE  217 (458)
Q Consensus       138 s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~  217 (458)
                       +..+. ..........++-|||=..                     ....|..+.....                    
T Consensus       253 -~S~rI-~~~lP~~~QllLFSATf~e---------------------~V~~Fa~kivpn~--------------------  289 (477)
T KOG0332         253 -QSIRI-MRSLPRNQQLLLFSATFVE---------------------KVAAFALKIVPNA--------------------  289 (477)
T ss_pred             -CCHHH-HHHCCCCCEEEEEECHHHH---------------------HHHHHHHHHCCCC--------------------
T ss_conf             -43104-4316876237764010377---------------------9999999854898--------------------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             99974245433200001001001100034524536899888999999851033452022347888875420354100022
Q gi|255764515|r  218 IEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE  297 (458)
Q Consensus       218 l~~~l~~~~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~  297 (458)
                              ..-..+.++..++......  +.                                        |.       
T Consensus       290 --------n~i~Lk~eel~L~~IkQly--v~----------------------------------------C~-------  312 (477)
T KOG0332         290 --------NVIILKREELALDNIKQLY--VL----------------------------------------CA-------  312 (477)
T ss_pred             --------CEEEEEHHHCCCCCHHHHE--EE----------------------------------------CC-------
T ss_conf             --------4036563430642134313--66----------------------------------------55-------


Q ss_pred             CCCCHHCCCCCCCCHHHHHHCCCCCEEEEHHHHHHHHHHHHHC----------CCCCCCHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             3430001343333256654124884034222367888664100----------026533445899876424588558998
Q gi|255764515|r  298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA----------FPQGRTLDKDPCTIQEWNEGKIPLLFA  367 (458)
Q Consensus       298 ~~~~~~~~~~k~~~l~~il~~~~~~kviif~~~~~~~~~i~~~----------~~~g~~~~~r~~~i~~f~~~~~~vli~  367 (458)
                            ....|++++.++..-..=..-||||+.+.....+...          +++..+..+|..++++|++|+.+|||.
T Consensus       313 ------~~~~K~~~l~~lyg~~tigqsiIFc~tk~ta~~l~~~m~~~Gh~V~~l~G~l~~~~R~~ii~~Fr~g~~kVLit  386 (477)
T KOG0332         313 ------CRDDKYQALVNLYGLLTIGQSIIFCHTKATAMWLYEEMRAEGHQVSLLHGDLTVEQRAAIIDRFREGKEKVLIT  386 (477)
T ss_pred             ------CHHHHHHHHHHHHHHHHHHHEEEEEEEHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             ------51667999999870111100589996202699999999843753678506530678899999986576069987


Q ss_pred             EHHHCCCCCCCCCCCCEEEEECCCC------CHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEE
Q ss_conf             4422111622001785999908998------986864456666202202037877528999985
Q gi|255764515|r  368 HPASCGHGLNLQYGGNILVFFSLWW------DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIA  425 (458)
Q Consensus       368 s~~~~~~GlnL~~a~~~iI~~~~~w------n~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~  425 (458)
                      + .+++-||+.++ .+++|+||+|-      .+..+.-|+||-     .|.|-+ .+ .+.|+-
T Consensus       387 T-nV~ARGiDv~q-Vs~VvNydlP~~~~~~pD~etYlHRiGRt-----GRFGkk-G~-a~n~v~  441 (477)
T KOG0332         387 T-NVCARGIDVAQ-VSVVVNYDLPVKYTGEPDYETYLHRIGRT-----GRFGKK-GL-AINLVD  441 (477)
T ss_pred             E-CHHHCCCCCCE-EEEEEECCCCCCCCCCCCHHHHHHHHCCC-----CCCCCC-CE-EEEEEC
T ss_conf             0-11123565313-79999447764557898778898870234-----656655-24-898641


No 108
>KOG0327 consensus
Probab=99.22  E-value=9.1e-10  Score=77.42  Aligned_cols=311  Identities=16%  Similarity=0.168  Sum_probs=165.0

Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHH--HCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE-ECC
Q ss_conf             999999999679809995889986899999999999--75999499991604656999999998558888159998-589
Q gi|255764515|r    7 QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIH--LWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI-TGT   83 (458)
Q Consensus         7 Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~--~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~-~g~   83 (458)
                      |..|+--+........-.+.|+|||.+-...+....  .....-+||++|...+..|=..-...+...-...++.. .|.
T Consensus        53 QqrAI~p~i~G~dv~~qaqsgTgKt~af~i~ilq~iD~~~ke~qalilaPtreLa~q~~~v~~~lg~~~~~~v~~~igg~  132 (397)
T KOG0327          53 QQRAILPCIKGHDVIAQAQSGTGKTAAFLISILQQIDMSVKETQALILAPTRELAQQIQKVVRALGDHMDVSVHACIGGT  132 (397)
T ss_pred             HHCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             76343553468744676302544114667888751374167777988613278889899998864112461466531764


Q ss_pred             HHHHHH--HHCCCCCEEEECCCCHHHHH-HHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             789888--73077986998064202334-420001132204404531002465431156777766543059807996584
Q gi|255764515|r   84 VKQRTK--VLKTPAVLYVINFENLGWLV-QELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        84 ~~~r~~--~~~~~~~i~i~s~e~~~~~~-~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      ...+..  +......+++-+...+.... ...+...+-.+.++|||-.+...+..  .+- ..+.......-..+++|||
T Consensus       133 ~~~~~~~~i~~~~~hivvGTpgrV~dml~~~~l~~~~iKmfvlDEaDEmLs~gfk--dqI-~~if~~lp~~vQv~l~SAT  209 (397)
T KOG0327         133 NVRREDQALLKDKPHIVVGTPGRVFDMLNRGSLSTDGIKMFVLDEADEMLSRGFK--DQI-YDIFQELPSDVQVVLLSAT  209 (397)
T ss_pred             CCHHHHHHHHCCCCEEECCCCHHHHHHHCCCCCCCCCEEEEEECCHHHHHCCCHH--HHH-HHHHHHCCCCHHHEEECCC
T ss_conf             1003455552047635437850577764136456665467752436766305648--999-9999875943220100136


Q ss_pred             CHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             02310010134677517888775327788777369564033000024555545589999974245433200001001001
Q gi|255764515|r  161 PSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP  240 (458)
Q Consensus       161 Pi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~l~~~  240 (458)
                      -    |.|+   +..              ..+|...                           +..+.+++.        
T Consensus       210 ~----p~~v---l~v--------------t~~f~~~---------------------------pv~i~vkk~--------  233 (397)
T KOG0327         210 M----PSDV---LEV--------------TKKFMRE---------------------------PVRILVKKD--------  233 (397)
T ss_pred             C----CHHH---HHH--------------HHHHCCC---------------------------CEEEEECCH--------
T ss_conf             8----5889---999--------------8874047---------------------------568995200--------


Q ss_pred             CEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCCCCCCCCHHHHHHCCC
Q ss_conf             10003452453689988899999985103345202234788887542035410002234300013433332566541248
Q gi|255764515|r  241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKAN  320 (458)
Q Consensus       241 ~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~~~k~~~l~~il~~~~  320 (458)
                             +++       .    +.                    ..|+   +.        .....+|++.+.++.+  +
T Consensus       234 -------~lt-------l----~g--------------------ikq~---~i--------~v~k~~k~~~l~dl~~--~  262 (397)
T KOG0327         234 -------ELT-------L----EG--------------------IKQF---YI--------NVEKEEKLDTLCDLYR--R  262 (397)
T ss_pred             -------HHH-------H----HH--------------------EEEE---EE--------ECCCCCCCCHHHHHHH--H
T ss_conf             -------201-------2----22--------------------0022---20--------1054311227999998--6


Q ss_pred             CCEEEEHHHHHHHHHHHHH----------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECC
Q ss_conf             8403422236788866410----------002653344589987642458855899844221116220017859999089
Q gi|255764515|r  321 AAPIIVAYHFNSDLARLQK----------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSL  390 (458)
Q Consensus       321 ~~kviif~~~~~~~~~i~~----------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~  390 (458)
                      -...++|||....+..+..          ++++....++|.....+|+.|..+|||.| ...+-|+++|. +..+|.|++
T Consensus       263 ~~q~~if~nt~r~v~~l~~~L~~~~~~~s~i~~d~~q~~R~~~~~~f~~g~srvlItt-dl~argidv~~-~slvinydl  340 (397)
T KOG0327         263 VTQAVIFCNTRRKVDNLTDKLRAHGFTVSAIHGDMEQNERDTLMREFRSGSSRVLITT-DLLARGIDVQQ-VSLVVNYDL  340 (397)
T ss_pred             HHCCEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEEC-CCCCCCCCHHH-CCEEEEECC
T ss_conf             4310578510456777899986277337876346430034689998645872377412-21246541110-122565016


Q ss_pred             CCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHH
Q ss_conf             989868644566662022020378775289999858996899999999
Q gi|255764515|r  391 WWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR  438 (458)
Q Consensus       391 ~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~  438 (458)
                      |-+...+.-++||.-     |.|-  +-....++++.  |++.++..+
T Consensus       341 P~r~~~yihR~gr~g-----r~gr--kg~~in~v~~~--d~~~lk~ie  379 (397)
T KOG0327         341 PARKENYIHRIGRAG-----RFGR--KGVAINFVTEE--DVRDLKDIE  379 (397)
T ss_pred             CCCHHHHHHHCCCCC-----CCCC--CCEEEEEEHHH--HHHHHHHHH
T ss_conf             520666665255456-----5677--71355520175--688887389


No 109
>KOG0948 consensus
Probab=99.21  E-value=8.7e-10  Score=77.54  Aligned_cols=146  Identities=21%  Similarity=0.286  Sum_probs=93.8

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHH-HCCCCCCEEEEE
Q ss_conf             8747899999999967980999588998689999999999975999499991604656999999998-558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQR-WSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~k-f~~~~~~~~~~~   80 (458)
                      +|-|+|..|+.-+-++...|+-+-+-.|||+.|-.+++.- ...+.+++.-.|-..+.||=++|+.. |.     +|...
T Consensus       129 ~LDpFQ~~aI~Cidr~eSVLVSAHTSAGKTVVAeYAIA~s-Lr~kQRVIYTSPIKALSNQKYREl~~EF~-----DVGLM  202 (1041)
T KOG0948         129 TLDPFQSTAIKCIDRGESVLVSAHTSAGKTVVAEYAIAMS-LREKQRVIYTSPIKALSNQKYRELLEEFK-----DVGLM  202 (1041)
T ss_pred             CCCCHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHH-HHHCCEEEEECHHHHHCCHHHHHHHHHHC-----CCCEE
T ss_conf             3480676545311279638998405788523799999999-87648589607315541154899998846-----36523


Q ss_pred             ECCHHHHHHHHCCCCCEEEECCCCHHHHHH---HCCCCCCCCEEECCCCCCCCCCCCC-CHHHHHHHHHHHHHCCCEEEE
Q ss_conf             589789888730779869980642023344---2000113220440453100246543-115677776654305980799
Q gi|255764515|r   81 TGTVKQRTKVLKTPAVLYVINFENLGWLVQ---ELKGTWPFATIVVDESTKLKSFRLR-QGSKTARALAKPAWESERFIE  156 (458)
Q Consensus        81 ~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~---~~~~~~~~~~iIiDEaH~lkn~~~~-~~s~~~~~l~~~~~~~~~~l~  156 (458)
                      +|+-.     ++.+..-+|+|-|-++...-   +......|  ||+||.|.+|..... -+.   ..+. +.+..-+.++
T Consensus       203 TGDVT-----InP~ASCLVMTTEILRsMLYRGSEvmrEVaW--VIFDEIHYMRDkERGVVWE---ETII-llP~~vr~VF  271 (1041)
T KOG0948         203 TGDVT-----INPDASCLVMTTEILRSMLYRGSEVMREVAW--VIFDEIHYMRDKERGVVWE---ETII-LLPDNVRFVF  271 (1041)
T ss_pred             ECCEE-----ECCCCCEEEEHHHHHHHHHHCCCHHHHEEEE--EEEEEEHHCCCCCCCEEEE---EEEE-ECCCCCEEEE
T ss_conf             05446-----6898754533799999987433167552314--8862001001344560235---6678-5366603899


Q ss_pred             ECCCCHHHH
Q ss_conf             658402310
Q gi|255764515|r  157 LTGTPSPNG  165 (458)
Q Consensus       157 LTgTPi~n~  165 (458)
                      |||| ++|.
T Consensus       272 LSAT-iPNA  279 (1041)
T KOG0948         272 LSAT-IPNA  279 (1041)
T ss_pred             EECC-CCCH
T ss_conf             9565-8777


No 110
>KOG0352 consensus
Probab=99.20  E-value=5.5e-09  Score=72.68  Aligned_cols=309  Identities=18%  Similarity=0.207  Sum_probs=152.9

Q ss_pred             HHHHHHHHHHHHC-CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCEEEEEE-
Q ss_conf             7899999999967-98099958899868999999999997599949999160-46569999999985588881599985-
Q gi|255764515|r    5 PHQTKIVDWILDH-KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMNISVIT-   81 (458)
Q Consensus         5 p~Q~~~v~~~~~~-~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~~~~~~-   81 (458)
                      |-|+.|+.-+... .-..+.+++|+||++.-  -+-.|...|  -++||.|- .++.+| .+.+.+      ++|.+-+ 
T Consensus        23 ~LQE~A~~c~VK~k~DVyVsMPTGaGKSLCy--QLPaL~~~g--ITIV~SPLiALIkDQ-iDHL~~------LKVp~~SL   91 (641)
T KOG0352          23 RLQEQAINCIVKRKCDVYVSMPTGAGKSLCY--QLPALVHGG--ITIVISPLIALIKDQ-IDHLKR------LKVPCESL   91 (641)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCHHHHH--HCHHHHHCC--EEEEECHHHHHHHHH-HHHHHH------HCCCHHHH
T ss_conf             5789989998834673799646887601454--265877288--189930789999999-877874------05616664


Q ss_pred             ---CCHHHHHHHHC------CCCCEEEECCCCHH-----HHHHHCCCCCCCCEEECCCCCCCCCCCC--CCHHHHHHHHH
Q ss_conf             ---89789888730------77986998064202-----3344200011322044045310024654--31156777766
Q gi|255764515|r   82 ---GTVKQRTKVLK------TPAVLYVINFENLG-----WLVQELKGTWPFATIVVDESTKLKSFRL--RQGSKTARALA  145 (458)
Q Consensus        82 ---g~~~~r~~~~~------~~~~i~i~s~e~~~-----~~~~~~~~~~~~~~iIiDEaH~lkn~~~--~~~s~~~~~l~  145 (458)
                         -+.++|..++-      ....++-||.|...     .+.+.+-.......+++||||-+.-++-  .....+...++
T Consensus        92 NSKlSt~ER~ri~~DL~~ekp~~K~LYITPE~AAt~~FQ~lLn~L~~r~~L~Y~vVDEAHCVSQWGHDFRPDYL~LG~LR  171 (641)
T KOG0352          92 NSKLSTVERSRIMGDLAKEKPTIKMLYITPEGAATDGFQKLLNGLANRDVLRYIVVDEAHCVSQWGHDFRPDYLTLGSLR  171 (641)
T ss_pred             HCHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHHHHHHHHCEEEEEEECHHHHHHHHCCCCCCCHHHHHHHH
T ss_conf             01210788999988887437751489976315556668999998874140224773346667762666682044466677


Q ss_pred             HHHHCCCEEEEECCCCHHHHCCCHHHHHHHCCCCCCCCCCHHHHHHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             54305980799658402310010134677517888775327788777369564033000024555545589999974245
Q gi|255764515|r  146 KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDC  225 (458)
Q Consensus       146 ~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l~~~~~l~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~  225 (458)
                      ...... -.++||||.-..--.|+|.+|.+-.|--.+..  -.|+.+-+-..                            
T Consensus       172 S~~~~v-pwvALTATA~~~VqEDi~~qL~L~~PVAiFkT--P~FR~NLFYD~----------------------------  220 (641)
T KOG0352         172 SVCPGV-PWVALTATANAKVQEDIAFQLKLRNPVAIFKT--PTFRDNLFYDN----------------------------  220 (641)
T ss_pred             HHCCCC-CEEEEECCCCHHHHHHHHHHHHCCCCHHHHCC--CCHHHHHHHHH----------------------------
T ss_conf             446999-66985434677677999999760585444057--41454445788----------------------------


Q ss_pred             HHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHCC
Q ss_conf             43320000100100110003452453689988899999985103345202234788887542035410002234300013
Q gi|255764515|r  226 CLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVH  305 (458)
Q Consensus       226 ~~~~~~~~~~~l~~~~~~~~~v~l~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~q~~~~~~~~~~~~~~~~~~  305 (458)
                      .+...+.|.                      |..+..-....+ +.                    |.            
T Consensus       221 ~~K~~I~D~----------------------~~~LaDF~~~~L-G~--------------------~~------------  245 (641)
T KOG0352         221 HMKSFITDC----------------------LTVLADFSSSNL-GK--------------------HE------------  245 (641)
T ss_pred             HHHHHHCCH----------------------HHHHHHHHHHHC-CC--------------------CH------------
T ss_conf             888764137----------------------778999999862-89--------------------04------------


Q ss_pred             CCCCCCHHHHHHCCCCCEEEEHHHHHHHHHHH----------HHCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCC
Q ss_conf             43333256654124884034222367888664----------10002653344589987642458855899844221116
Q gi|255764515|r  306 DEKIKALEVIIEKANAAPIIVAYHFNSDLARL----------QKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHG  375 (458)
Q Consensus       306 ~~k~~~l~~il~~~~~~kviif~~~~~~~~~i----------~~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~G  375 (458)
                           ...+- ++.-...-||||......+.+          ..+++.|-...+|.++-+.+-+++.+|+.++ .+-|.|
T Consensus       246 -----~~~~~-~K~~~GCGIVYCRTR~~cEq~AI~l~~~Gi~A~AYHAGLK~~ERTeVQe~WM~~~~PvI~AT-~SFGMG  318 (641)
T KOG0352         246 -----KASQN-KKTFTGCGIVYCRTRNECEQVAIMLEIAGIPAMAYHAGLKKKERTEVQEKWMNNEIPVIAAT-VSFGMG  318 (641)
T ss_pred             -----HHHCC-CCCCCCCEEEEECCHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHCCCCCEEEEE-ECCCCC
T ss_conf             -----44117-87777732799602889998988753247626776500141126889999862788779996-024446


Q ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEE
Q ss_conf             220017859999089989868644566662022020378775289999
Q gi|255764515|r  376 LNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL  423 (458)
Q Consensus       376 lnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~l  423 (458)
                      ++=. ....|||.+++-|.+-+.|--||.     .|.|-..-|+.||-
T Consensus       319 VDKp-~VRFViHW~~~qn~AgYYQESGRA-----GRDGk~SyCRLYYs  360 (641)
T KOG0352         319 VDKP-DVRFVIHWSPSQNLAGYYQESGRA-----GRDGKRSYCRLYYS  360 (641)
T ss_pred             CCCC-CEEEEEECCHHHHHHHHHHHCCCC-----CCCCCCCCEEEEEC
T ss_conf             6877-615999517056578998861535-----66777252013332


No 111
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated
Probab=99.19  E-value=1.6e-08  Score=69.84  Aligned_cols=87  Identities=15%  Similarity=0.099  Sum_probs=53.8

Q ss_pred             CCCCCEEEEHHHHHHH---HHHHHHC----CCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCC-CCCEEEEEC
Q ss_conf             2488403422236788---8664100----0265334458998764245885589984422111622001-785999908
Q gi|255764515|r  318 KANAAPIIVAYHFNSD---LARLQKA----FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQY-GGNILVFFS  389 (458)
Q Consensus       318 ~~~~~kviif~~~~~~---~~~i~~~----~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~-a~~~iI~~~  389 (458)
                      ..+|+-.+.|+++..+   .+.+...    +.+|... .+...+++|++++..||+++ .+-.||+|+.. +...+|..-
T Consensus       645 ~~~g~~LVLFTS~~~l~~v~~~L~~~~~~~L~Qg~~g-s~~~l~~rF~~~~~siLlGt-~SFWEGVDlpG~~L~~vVI~k  722 (820)
T PRK07246        645 QEGQPILVLFNSKKHLLAVSDYLDQWQVSHLAQEKNG-TAYNIKKRFDRGEQTILLGL-GSFWEGVDFIQADRMIEVITR  722 (820)
T ss_pred             HCCCCEEEEECHHHHHHHHHHHHHHCCCCEEEECCCC-CHHHHHHHHHHCCCEEEEEC-CCCCCCCCCCCCCEEEEEEEE
T ss_conf             7499999995309999999999853799778867976-79999999984899699976-676466448998779999886


Q ss_pred             CCCC----H--------------------------HHHHHHHHHHHC
Q ss_conf             9989----8--------------------------686445666620
Q gi|255764515|r  390 LWWD----L--------------------------EEHQQMIERIGV  406 (458)
Q Consensus       390 ~~wn----~--------------------------~~~~Q~~gRi~~  406 (458)
                      +||-    |                          -.+.|+.||.+|
T Consensus       723 LPF~~P~dPl~~a~~~~l~~~G~npF~~~~LP~AvlrlkQg~GRLIR  769 (820)
T PRK07246        723 LPFDNPEDPFVKKMSQYLLEEGKNPFYDYFLPMTILRLKQAIGRTMR  769 (820)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999980999999999998289952562299999999995703676


No 112
>smart00490 HELICc helicase superfamily c-terminal domain.
Probab=99.18  E-value=3.6e-11  Score=85.89  Aligned_cols=66  Identities=26%  Similarity=0.452  Sum_probs=58.0

Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCHHCC
Q ss_conf             0265334458998764245885589984422111622001785999908998986864456666202202037
Q gi|255764515|r  341 FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG  413 (458)
Q Consensus       341 ~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~G  413 (458)
                      ++++.+.++|...++.|++++.+||++ +.++++|+||+. ++++|++++|||+..+.|+.||+     +|.|
T Consensus        17 i~g~~~~~~R~~~~~~f~~~~~~ilv~-t~~~~~Gidl~~-~~~vI~~~~~~~~~~~~Q~~GR~-----~R~g   82 (82)
T smart00490       17 LHGGLSQEEREEILEKFNNGKIKVLVA-TDVAERGLDLPG-VDLVIIYDLPWSPASYIQRIGRA-----GRAG   82 (82)
T ss_pred             EECCCCHHHHHHHHHHHHCCCCEEEEE-EEEEEEECCCCC-CCEEEEECCCCCHHHHHHHHCCC-----CCCC
T ss_conf             989699999999999998799719999-502421148988-99999978996989999997258-----7899


No 113
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]
Probab=99.16  E-value=9.4e-08  Score=65.22  Aligned_cols=65  Identities=22%  Similarity=0.193  Sum_probs=45.3

Q ss_pred             CCCHHHHHHHHHH---HHCCC-EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHH
Q ss_conf             8747899999999---96798-09995889986899999999999759994999916046569999999
Q gi|255764515|r    2 NLAPHQTKIVDWI---LDHKR-CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEV   66 (458)
Q Consensus         2 ~L~p~Q~~~v~~~---~~~~~-~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei   66 (458)
                      +.||+|.+....+   +.++. .++=.++|+|||+..|+.+.........+++|.+++..+..|-.+|.
T Consensus        15 ~~r~~Q~~~~~~v~~a~~~~~~~~iEapTGtGKTl~yL~~al~~~~~~~~~viist~t~~lq~q~~~~~   83 (654)
T COG1199          15 EPRPEQREMAEAVAEALKGGEGLLIEAPTGTGKTLAYLLPALAYAREEGKKVIISTRTKALQEQLLEED   83 (654)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHH
T ss_conf             989899999999999981687189988998517599999999867752975999899576888987621


No 114
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative; InterPro: IPR006310   These are a family of proteins in Gram-positive bacteria. The N-terminal region of about 200 amino acids resembles the epsilon subunit of E. coli DNA polymerase III and the homologous region of the Gram-positive type DNA polymerase III alpha subunit. The epsilon subunit contains an exonuclease domain. The remainder of this protein family resembles a predicted ATP-dependent helicase, the DNA damage-inducible protein DinG of Escherichia coli. .
Probab=99.15  E-value=3.8e-08  Score=67.58  Aligned_cols=136  Identities=15%  Similarity=0.171  Sum_probs=78.3

Q ss_pred             HHHHHHCCCCCEEEEHHHHHH---HHHHHH--------HCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCC
Q ss_conf             566541248840342223678---886641--------000265334458998764245885589984422111622001
Q gi|255764515|r  312 LEVIIEKANAAPIIVAYHFNS---DLARLQ--------KAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQY  380 (458)
Q Consensus       312 l~~il~~~~~~kviif~~~~~---~~~~i~--------~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~  380 (458)
                      +.++.+-..++-++.|+.+.-   +.+.+.        ..+.++.+...+..++++|++|+-.||+++ .+-=||+||+.
T Consensus       757 I~e~~~~~~~~~LVLFTS~~mL~~V~~~l~~l~~~~~~~~LaQ~~nsGs~~ki~K~F~~ge~~ILLG~-~SFWEGvDf~~  835 (944)
T TIGR01407       757 IVELAALESPKILVLFTSKEMLKAVYDLLKELSEEEGLEVLAQGINSGSRAKIKKRFEKGEKAILLGA-SSFWEGVDFPG  835 (944)
T ss_pred             HHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHCCHHCCCEEEEECCCCCCHHHHHHHHHCCCCCEEECC-CCEECCCCCCC
T ss_conf             99997206896275164899999999985302002580667412677857899998614787566115-54002401179


Q ss_pred             CCCE-EEEECCCCCH------------------------------HHHHHHHHHHHCCCCHHCCCCCC-EEEEE--EEEC
Q ss_conf             7859-9990899898------------------------------68644566662022020378775-28999--9858
Q gi|255764515|r  381 GGNI-LVFFSLWWDL------------------------------EEHQQMIERIGVTRQRQAGFKRA-VFVYY--LIAQ  426 (458)
Q Consensus       381 a~~~-iI~~~~~wn~------------------------------~~~~Q~~gRi~~~r~hR~Gq~~~-v~v~~--li~~  426 (458)
                      ...+ +|..=+|+.+                              -++.|+.||++     |.-+.+. +.|.+  |+++
T Consensus       836 ~~~~~lvi~RLPF~nP~~pL~kk~~~~~~~EG~npF~~~~lP~A~~RlrQalGRli-----R~e~drg~~~~LD~Rl~~~  910 (944)
T TIGR01407       836 NELVILVIPRLPFANPKEPLTKKKLQKLEEEGKNPFYDYALPMAILRLRQALGRLI-----RRENDRGSILVLDKRLVTK  910 (944)
T ss_pred             CCCEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCHHCCCCHHHHHHHHHHHHHC-----CCCCCCEEEEEECCCCCCC
T ss_conf             97179998528677885389999998854311464111013079999877510002-----5523554689971101160


Q ss_pred             C---CHHHHHHHHHHHHHHH--HHHHHHHHHC
Q ss_conf             9---9689999999999999--9999855413
Q gi|255764515|r  427 N---TIDELVLQRLRTKSTI--QDLLLNALKK  453 (458)
Q Consensus       427 ~---tide~i~~~~~~K~~~--~~~~~~~~~~  453 (458)
                      .   -+.+..-+...-|...  ...++.++|+
T Consensus       911 ~Ygk~~~~~L~~~~~~K~~~qq~~~~~~~ik~  942 (944)
T TIGR01407       911 RYGKRFLKSLPEVLSVKGLSQQLEELLEEIKE  942 (944)
T ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH
T ss_conf             47899998400015467603568999999972


No 115
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]
Probab=99.15  E-value=1.3e-08  Score=70.35  Aligned_cols=122  Identities=14%  Similarity=0.119  Sum_probs=75.9

Q ss_pred             CHHHHHH-CCCCCEEEEHHHHHHHHHHHHHCC----------CCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCC
Q ss_conf             2566541-248840342223678886641000----------26533445899876424588558998442211162200
Q gi|255764515|r  311 ALEVIIE-KANAAPIIVAYHFNSDLARLQKAF----------PQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQ  379 (458)
Q Consensus       311 ~l~~il~-~~~~~kviif~~~~~~~~~i~~~~----------~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~  379 (458)
                      .+.+|-+ ...++.++|-+-.+.+..-+..-+          +.+--.-+|.+++..-+.|.++||++ +.-..|||+|.
T Consensus       435 L~~EI~~r~~~~eRvLVTtLTKkmAEdLT~Yl~e~gikv~YlHSdidTlER~eIirdLR~G~~DvLVG-INLLREGLDiP  513 (663)
T COG0556         435 LLSEIRKRVAKNERVLVTTLTKKMAEDLTEYLKELGIKVRYLHSDIDTLERVEIIRDLRLGEFDVLVG-INLLREGLDLP  513 (663)
T ss_pred             HHHHHHHHHHCCCEEEEEEEHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCCEEEE-EHHHHCCCCCC
T ss_conf             99999999964972999843688899999999866964786424403899999999975778748985-01331347886


Q ss_pred             CCCCEEEEEC-----CCCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             1785999908-----998986864456666202202037877528999985899689999999999
Q gi|255764515|r  380 YGGNILVFFS-----LWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK  440 (458)
Q Consensus       380 ~a~~~iI~~~-----~~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K  440 (458)
                      .. +.|..+|     .--|...+.|-+||..     |.-.- .|..|-=...+|+++.|-+..++.
T Consensus       514 EV-sLVAIlDADKeGFLRse~SLIQtIGRAA-----RN~~G-kvIlYAD~iT~sM~~Ai~ET~RRR  572 (663)
T COG0556         514 EV-SLVAILDADKEGFLRSERSLIQTIGRAA-----RNVNG-KVILYADKITDSMQKAIDETERRR  572 (663)
T ss_pred             CE-EEEEEEECCCCCCCCCCCHHHHHHHHHH-----HCCCC-EEEEECCHHHHHHHHHHHHHHHHH
T ss_conf             45-5798860685444345325999987886-----35797-399971011499999999888899


No 116
>KOG0346 consensus
Probab=99.11  E-value=6.5e-08  Score=66.20  Aligned_cols=151  Identities=17%  Similarity=0.168  Sum_probs=85.4

Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHC-----C--CCCEEEEECCHHHHHHHHHHHHHHCCCC--CCE
Q ss_conf             9999999996798099958899868999-9999999975-----9--9949999160465699999999855888--815
Q gi|255764515|r    7 QTKIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLW-----G--EKSVLVIAPLRVAQSVWTSEVQRWSNFS--HMN   76 (458)
Q Consensus         7 Q~~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~-----~--~~~~LIv~P~~l~~~~W~~Ei~kf~~~~--~~~   76 (458)
                      |..|+-..++++..+--+-+|+|||..- |-++..+...     +  ....+|++|+.-+-.|-+.++++....-  .++
T Consensus        46 Qs~aIplaLEgKDvvarArTGSGKT~AYliPllqkll~~k~t~~~e~~~sa~iLvPTkEL~qQvy~viekL~~~c~k~lr  125 (569)
T KOG0346          46 QSSAIPLALEGKDVVARARTGSGKTAAYLIPLLQKLLAEKKTNDGEQGPSAVILVPTKELAQQVYKVIEKLVEYCSKDLR  125 (569)
T ss_pred             HHCCCCHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             43221243248631465226887137889999999997640364324630699925099999999999999998787655


Q ss_pred             EEEEE---CCHHHHHHHHCCCCCEEEECCCCHHHHHHH--CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             99985---897898887307798699806420233442--0001132204404531002465431156777766543059
Q gi|255764515|r   77 ISVIT---GTVKQRTKVLKTPAVLYVINFENLGWLVQE--LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWES  151 (458)
Q Consensus        77 ~~~~~---g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~--~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~  151 (458)
                      +.-+.   .++..+ .++....+|+|.|...+-.....  +.....-..+|+|||--+-+.+.   ..-.+.+....+..
T Consensus       126 ~~nl~s~~sdsv~~-~~L~d~pdIvV~TP~~ll~~~~~~~~~~~~~l~~LVvDEADLllsfGY---eedlk~l~~~LPr~  201 (569)
T KOG0346         126 AINLASSMSDSVNS-VALMDLPDIVVATPAKLLRHLAAGVLEYLDSLSFLVVDEADLLLSFGY---EEDLKKLRSHLPRI  201 (569)
T ss_pred             HHHHHCCCCHHHHH-HHHCCCCCEEEECHHHHHHHHHHCCCHHHHHEEEEEECHHHHHHHCCC---HHHHHHHHHHCCCH
T ss_conf             54210331167778-887059975871718899998606302120102578503566642360---88899998748825


Q ss_pred             CEEEEECCCC
Q ss_conf             8079965840
Q gi|255764515|r  152 ERFIELTGTP  161 (458)
Q Consensus       152 ~~~l~LTgTP  161 (458)
                      ...++||||-
T Consensus       202 ~Q~~LmSATl  211 (569)
T KOG0346         202 YQCFLMSATL  211 (569)
T ss_pred             HHHEEEHHHH
T ss_conf             6502003135


No 117
>KOG0950 consensus
Probab=99.10  E-value=2.2e-08  Score=69.00  Aligned_cols=158  Identities=20%  Similarity=0.201  Sum_probs=89.6

Q ss_pred             CCCHHHHHHHH--HHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             87478999999--9996798099958899868999999999997599949999160-46569999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVD--WILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~--~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~~~   78 (458)
                      +|+.||.+...  .++++++++...+++.|||+.|-..+......-.+.+|.+.|- +++. -=..+..-|....+..+.
T Consensus       223 ~~fewq~ecls~~~~~e~~nliys~Pts~gktlvaeilml~~~l~~rr~~llilp~vsiv~-Ek~~~l~~~~~~~G~~ve  301 (1008)
T KOG0950         223 KLFEWQAECLSLPRLLERKNLIYSLPTSAGKTLVAEILMLREVLCRRRNVLLILPYVSIVQ-EKISALSPFSIDLGFPVE  301 (1008)
T ss_pred             HHHHHHHHHHCCHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHCEEEECCEEEHHH-HHHHHHHHHCCCCCCCCH
T ss_conf             8999999871465342356558857876406799999999999887421167424210258-777640022033588622


Q ss_pred             EEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCC---CCCEEECCCCCCCCCCCCCCHHHH----HHHHHHHHHCC
Q ss_conf             98589789888730779869980642023344200011---322044045310024654311567----77766543059
Q gi|255764515|r   79 VITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW---PFATIVVDESTKLKSFRLRQGSKT----ARALAKPAWES  151 (458)
Q Consensus        79 ~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~---~~~~iIiDEaH~lkn~~~~~~s~~----~~~l~~~~~~~  151 (458)
                      -+.|...  .........+.+++.|+...+...+...-   ..++|++||-|.+-...  .+.-.    .+.+......+
T Consensus       302 ~y~g~~~--p~~~~k~~sv~i~tiEkanslin~lie~g~~~~~g~vvVdElhmi~d~~--rg~~lE~~l~k~~y~~~~~~  377 (1008)
T KOG0950         302 EYAGRFP--PEKRRKRESVAIATIEKANSLINSLIEQGRLDFLGMVVVDELHMIGDKG--RGAILELLLAKILYENLETS  377 (1008)
T ss_pred             HHCCCCC--CCCCCCCEEEEEEEHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEEECCC--CCHHHHHHHHHHHHHCCCCC
T ss_conf             1126689--9886441045542037667688888761783304728975224640356--35589999999999632563


Q ss_pred             CEEEEECCCCHHHH
Q ss_conf             80799658402310
Q gi|255764515|r  152 ERFIELTGTPSPNG  165 (458)
Q Consensus       152 ~~~l~LTgTPi~n~  165 (458)
                      -..++|||| ++|.
T Consensus       378 ~~iIGMSAT-i~N~  390 (1008)
T KOG0950         378 VQIIGMSAT-IPNN  390 (1008)
T ss_pred             EEEEEEECC-CCCH
T ss_conf             467655241-4774


No 118
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=99.07  E-value=1.8e-08  Score=69.61  Aligned_cols=154  Identities=15%  Similarity=0.147  Sum_probs=74.4

Q ss_pred             HHHHHHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCCCCCEEEEECCHHHHH---HHHHHHHHHCCCCC--CEEEEEEC
Q ss_conf             99999996798099958899868999-99999999759994999916046569---99999998558888--15999858
Q gi|255764515|r    9 KIVDWILDHKRCAIWASMGSGKTVSV-LTALSYIHLWGEKSVLVIAPLRVAQS---VWTSEVQRWSNFSH--MNISVITG   82 (458)
Q Consensus         9 ~~v~~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~~~~~LIv~P~~l~~~---~W~~Ei~kf~~~~~--~~~~~~~g   82 (458)
                      +.++.+.+++..+|..++|+|||=+. ..++..-.  ...++++.-|..+..-   .+..+.  -....+  +.|.+-..
T Consensus        12 ~i~~~l~~~~~~vl~a~tGsGKtTqvP~~ll~~~~--~~g~I~~~qPRR~AA~s~A~RvA~e--~~e~~G~~VGY~vR~e   87 (812)
T PRK11664         12 ELLTALKTAPQVLLKAPTGAGKSTWLPLQLLQQGG--INGKIIMLEPRRLAARNVAQRLAEQ--LGEKPGETVGYRMRAE   87 (812)
T ss_pred             HHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHCCC--CCCCEEEECCHHHHHHHHHHHHHHH--HCCCCCCEEEEEECCC
T ss_conf             99999997997999908999989999999996468--8993899388399999999999997--2999998675782567


Q ss_pred             CHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH---HCCCEEEEECC
Q ss_conf             978988873077986998064202334420001132204404531002465431156777766543---05980799658
Q gi|255764515|r   83 TVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA---WESERFIELTG  159 (458)
Q Consensus        83 ~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~---~~~~~~l~LTg  159 (458)
                      + +     ......+.++|...+-.....--....+++||+||+|.= +   -...-..-.+..+.   ...-++++|||
T Consensus        88 ~-~-----~s~~Tri~~~T~GiLlr~l~~dp~L~~~~~vI~DE~HER-~---l~~Dl~l~l~~~~~~~~r~dLklvvMSA  157 (812)
T PRK11664         88 S-K-----VGPNTRLEVVTEGILTRMIQRDPELSGVGLVILDEFHER-S---LQADLALALLLDVQQGLRDDLKLLIMSA  157 (812)
T ss_pred             C-C-----CCCCCEEEEECHHHHHHHHHHCCCCCCCCEEEEECCCCC-C---HHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             7-8-----899857999755899999724977677888999575468-7---5189999999999986189828999847


Q ss_pred             CCHHHHCCCHHHHHHHC
Q ss_conf             40231001013467751
Q gi|255764515|r  160 TPSPNGLIDLWGQIWFL  176 (458)
Q Consensus       160 TPi~n~~~el~~ll~~l  176 (458)
                      |.-.....++++-+..+
T Consensus       158 Tld~~~~~~~~~~~~~i  174 (812)
T PRK11664        158 TLDNDRLQQLLPDAPYI  174 (812)
T ss_pred             CCCHHHHHHHCCCCCEE
T ss_conf             88848899758999889


No 119
>KOG0353 consensus
Probab=99.07  E-value=2.6e-08  Score=68.62  Aligned_cols=159  Identities=18%  Similarity=0.228  Sum_probs=87.5

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160-4656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL-RVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~-~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      +++|-|+++++.........+..++|-||++.-  -+-.|.  ...-+|||||- |++++|-. .+.. .   +++...+
T Consensus        94 kfrplq~~ain~~ma~ed~~lil~tgggkslcy--qlpal~--adg~alvi~plislmedqil-~lkq-l---gi~as~l  164 (695)
T KOG0353          94 KFRPLQLAAINATMAGEDAFLILPTGGGKSLCY--QLPALC--ADGFALVICPLISLMEDQIL-QLKQ-L---GIDASML  164 (695)
T ss_pred             HCCHHHHHHHHHHHCCCCEEEEEECCCCCCHHH--HHHHHH--CCCCEEEECHHHHHHHHHHH-HHHH-H---CCCHHHC
T ss_conf             347037877555222674699983799612452--235876--28745761026888899999-9998-0---8644430


Q ss_pred             E-CCHHHHHH-----HHCCCCC--EEEECCCCHHH------HHHHCCCCCCCCEEECCCCCCCCCCCC--CCHHHHHHHH
Q ss_conf             5-89789888-----7307798--69980642023------344200011322044045310024654--3115677776
Q gi|255764515|r   81 T-GTVKQRTK-----VLKTPAV--LYVINFENLGW------LVQELKGTWPFATIVVDESTKLKSFRL--RQGSKTARAL  144 (458)
Q Consensus        81 ~-g~~~~r~~-----~~~~~~~--i~i~s~e~~~~------~~~~~~~~~~~~~iIiDEaH~lkn~~~--~~~s~~~~~l  144 (458)
                      . +++++-.+     +.+.++.  .+-++.|.+..      ..+.-..-..|.++-+||.|-+.-++-  ....+....+
T Consensus       165 nansske~~k~v~~~i~nkdse~kliyvtpekiaksk~~mnkleka~~~~~~~~iaidevhccsqwghdfr~dy~~l~il  244 (695)
T KOG0353         165 NANSSKEEAKRVEAAITNKDSEFKLIYVTPEKIAKSKKFMNKLEKALEAGFFKLIAIDEVHCCSQWGHDFRPDYKALGIL  244 (695)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHCCEEEEEEECCEEEHHHHCCCCCCCHHHHHHH
T ss_conf             57554888989999870777615899964899877799999999876426048985310232654376657416888899


Q ss_pred             HHHHHCCCEEEEECCCCHHHHCCCHH
Q ss_conf             65430598079965840231001013
Q gi|255764515|r  145 AKPAWESERFIELTGTPSPNGLIDLW  170 (458)
Q Consensus       145 ~~~~~~~~~~l~LTgTPi~n~~~el~  170 (458)
                      .+-.. .--.++||||...|-+.|.-
T Consensus       245 krqf~-~~~iigltatatn~vl~d~k  269 (695)
T KOG0353         245 KRQFK-GAPIIGLTATATNHVLDDAK  269 (695)
T ss_pred             HHHCC-CCCEEEEEHHHHCCHHHHHH
T ss_conf             97579-99656323110000356788


No 120
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional
Probab=99.00  E-value=1.3e-07  Score=64.35  Aligned_cols=153  Identities=17%  Similarity=0.115  Sum_probs=70.2

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE--CCHHHH---HHHHH-HHHHHCCCCCCEEEE
Q ss_conf             899999999967980999588998689999999999975999499991--604656---99999-999855888815999
Q gi|255764515|r    6 HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIA--PLRVAQ---SVWTS-EVQRWSNFSHMNISV   79 (458)
Q Consensus         6 ~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~--P~~l~~---~~W~~-Ei~kf~~~~~~~~~~   79 (458)
                      |-.+.++.+.+|.=.+++.|+|+|||=|.=-++... -.|. ...|+|  |..+..   ..... |... .-...+.|.+
T Consensus        78 ~r~~i~~~i~~nqVvii~GeTGsGKTTQiPq~~le~-g~g~-~~~I~~TQPRRiAA~svA~RVA~E~~~-~lG~~VGY~V  154 (1295)
T PRK11131         78 KKQDILEAIRDHQVVIVAGETGSGKTTQLPKICLEL-GRGI-KGLIGHTQPRRLAARTVANRIAEELET-ELGGCVGYKV  154 (1295)
T ss_pred             HHHHHHHHHHHCCEEEEECCCCCCHHHHHHHHHHHC-CCCC-CCEEEECCCHHHHHHHHHHHHHHHHCC-CCCCEEEEEE
T ss_conf             999999999979969997689998788999999962-7999-998997796599999999999998199-9899888894


Q ss_pred             EECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC--CCEEEEE
Q ss_conf             85897898887307798699806420233442000113220440453100246543115677776654305--9807996
Q gi|255764515|r   80 ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE--SERFIEL  157 (458)
Q Consensus        80 ~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~--~~~~l~L  157 (458)
                      -..      +.......+..+|-..+-.....-.....++.||+||+|.=    +-..--..-.+..+..+  .-++++|
T Consensus       155 Rf~------~~~s~~t~i~~~TdGiLL~e~~~d~~L~~y~~iIiDEaHER----sl~~D~LLg~Lk~ll~~R~dLKvIim  224 (1295)
T PRK11131        155 RFN------DQVSDNTMVKLMTDGILLAEIQQDRLLMQYDTIIIDEAHER----SLNIDFILGYLKELLPRRPDLKVIIT  224 (1295)
T ss_pred             CCC------CCCCCCCEEEEECCHHHHHHHHHCCCCCCCCEEEEECCCCC----CCHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             569------88799977999765699998620998788777998685568----80199999999999833999889995


Q ss_pred             CCCCHHHHCCCHHH
Q ss_conf             58402310010134
Q gi|255764515|r  158 TGTPSPNGLIDLWG  171 (458)
Q Consensus       158 TgTPi~n~~~el~~  171 (458)
                      |||.-.......|+
T Consensus       225 SATid~e~fs~yF~  238 (1295)
T PRK11131        225 SATIDPERFSRHFN  238 (1295)
T ss_pred             CCCCCHHHHHHHCC
T ss_conf             58689799996579


No 121
>pfam07652 Flavi_DEAD Flavivirus DEAD domain.
Probab=98.98  E-value=5.5e-09  Score=72.66  Aligned_cols=127  Identities=20%  Similarity=0.136  Sum_probs=72.6

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEEE
Q ss_conf             99958899868999999999997599949999160465699999999855888815999858978988873077986998
Q gi|255764515|r   21 AIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVI  100 (458)
Q Consensus        21 ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i~  100 (458)
                      .+-.-+|+|||-..|--+..-......++||++|+.++.    +|...-......+  ..+..   ..........+.++
T Consensus         6 ~ld~HPGaGKTr~vLP~~v~~~i~~~lRtlVLaPTRVV~----~Em~eAL~g~~vr--~~t~a---~~~~~~~~~ivdvm   76 (146)
T pfam07652         6 VLDLHPGAGKTRKVLPELVRECIDRRLRTLVLAPTRVVL----AEMEEALRGLPIR--YHTPA---VSSEHTGREIVDVM   76 (146)
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHHCCCEEEEECCHHHHH----HHHHHHHCCCCCE--EECHH---HHCCCCCCCEEEEE
T ss_conf             985389999702248999999997286189977279999----9999997589946--75234---31366888418897


Q ss_pred             CCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHH-HH-HCCCEEEEECCCC
Q ss_conf             0642023344200011322044045310024654311567777665-43-0598079965840
Q gi|255764515|r  101 NFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAK-PA-WESERFIELTGTP  161 (458)
Q Consensus       101 s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~-~~-~~~~~~l~LTgTP  161 (458)
                      .+-++....-.-....+|.++|+||||.. ++    .|-+.+-... .. ..-...++|||||
T Consensus        77 CHAT~t~r~l~~~~~~ny~viIMDE~H~~-DP----~SIAarG~~~~~~~~g~~a~i~mTATP  134 (146)
T pfam07652        77 CHATFTQRLLSPVRVPNYEVIIMDEAHFT-DP----ASIAARGYISTLVELGEAAAIFMTATP  134 (146)
T ss_pred             CHHHHHHHHHCCCCCCCEEEEEEECCCCC-CH----HHHHHHHHHHHHHHCCCEEEEEEECCC
T ss_conf             15988889736888564479998512238-98----999988999988543865799995689


No 122
>PRK12906 secA preprotein translocase subunit SecA; Reviewed
Probab=98.90  E-value=4.3e-06  Score=55.17  Aligned_cols=124  Identities=19%  Similarity=0.282  Sum_probs=70.9

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+--+.+|=|||++|... .++..-..+++-||+..--+   -..|...+-.|.   ++.+
T Consensus        77 lg~r~ydvQl~Gg~~L~~G~iaEM~TGEGKTL~atlp-~ylnaL~GkgvhvvTvNdYLA~RDae~m~~vy~~l---Gltv  152 (823)
T PRK12906         77 LGLYPFDVQIIGGIALHFGNIAEMRTGEGKTLTATLP-VYLNALEGKGVHVVTVNEYLAKRDATEMGELYRWL---GLTV  152 (823)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHC---CCEE
T ss_conf             3897647899989998369525650688589999999-99986469980898054465586799999999980---9667


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
                      .++.+  ++..|...+..+ ..+.++.+. |..+.+.      ..-..++...||||+-.+
T Consensus       153 g~i~~~~~~~err~aY~~D-ItY~Tn~e~gFDYLRDnm~~~~~~~vqr~~~~aIvDEvDSi  212 (823)
T PRK12906        153 GLNLNDMSPDEKREAYNCD-ITYSTNSELGFDYLRDNMVVYKEQMVQRPLNYAIVDEVDSI  212 (823)
T ss_pred             EEECCCCCHHHHHHHHCCC-CEEECCCCEECCCCCCCCCCCHHHHCCCCCCEEEEECHHHH
T ss_conf             1208999989999985078-44625655021113544126888834788855898541465


No 123
>KOG0337 consensus
Probab=98.85  E-value=1.4e-07  Score=64.20  Aligned_cols=138  Identities=16%  Similarity=0.142  Sum_probs=75.7

Q ss_pred             EEEEE-CCCCCHHHHH-HHHHHHHHH--CCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEE-EEECCHHHH-HHHHCC
Q ss_conf             09995-8899868999-999999997--59994999916046569999999985588881599-985897898-887307
Q gi|255764515|r   20 CAIWA-SMGSGKTVSV-LTALSYIHL--WGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS-VITGTVKQR-TKVLKT   93 (458)
Q Consensus        20 ~ll~~-~~G~GKT~~a-l~~~~~l~~--~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~-~~~g~~~~r-~~~~~~   93 (458)
                      -+.++ -+|+|||..- |-+++.|..  +..-+.||+.|+.-+.-|=.+-++.+..+-.++.. .+.|+..+. ...+..
T Consensus        60 dvv~martgsgktaaf~ipm~e~Lk~~s~~g~RalilsptreLa~qtlkvvkdlgrgt~lr~s~~~ggD~~eeqf~~l~~  139 (529)
T KOG0337          60 DVVGMARTGSGKTAAFLIPMIEKLKSHSQTGLRALILSPTRELALQTLKVVKDLGRGTKLRQSLLVGGDSIEEQFILLNE  139 (529)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCCCEEECCCCHHHHHHHHHHHHHHCCCCCHHHHHHCCCCHHHHHHHHHCC
T ss_conf             21005522786104678899999861364462024326708899999999998515421121011263248899998415


Q ss_pred             CCCEEEECCCCHHHHHHH-CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             798699806420233442-0001132204404531002465431156777766543059807996584
Q gi|255764515|r   94 PAVLYVINFENLGWLVQE-LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        94 ~~~i~i~s~e~~~~~~~~-~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      ..++++.|...+....-+ .........||+||+.++--.+-  ..+..+.+.++.- +.-.+++|||
T Consensus       140 npDii~ATpgr~~h~~vem~l~l~sveyVVfdEadrlfemgf--qeql~e~l~rl~~-~~QTllfSat  204 (529)
T KOG0337         140 NPDIIIATPGRLLHLGVEMTLTLSSVEYVVFDEADRLFEMGF--QEQLHEILSRLPE-SRQTLLFSAT  204 (529)
T ss_pred             CCCEEEECCCEEEEEEHHEECCCCCEEEEEEHHHHHHHHHHH--HHHHHHHHHHCCC-CCEEEEEECC
T ss_conf             998798248513420021001213225664101347876536--8999999875777-6307998523


No 124
>PRK09200 preprotein translocase subunit SecA; Reviewed
Probab=98.79  E-value=7.6e-06  Score=53.66  Aligned_cols=150  Identities=17%  Similarity=0.265  Sum_probs=79.6

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH---HHHHHHHHHHCCCCCCEE
Q ss_conf             98747899999999967980999588998689999999999975999499991604656---999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ---SVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~---~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+--+.+|=|||++|... .++..-..+++-||+...-+.   ..|...+-.|+   ++.|
T Consensus        75 lg~~~~dvQl~g~~~l~~g~iaEm~TGEGKTL~a~l~-~~l~al~g~~vhvvTvNdYLA~RDa~~m~~iy~~l---Gl~v  150 (799)
T PRK09200         75 LGMRPYDVQLIGALVLHEGNIAEMQTGEGKTLTATMP-LYLNALEGKGVHLITTNDYLAKRDFEEMGQVYEFL---GLTV  150 (799)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHHC---CCEE
T ss_conf             5997656899989998469524551788589999999-99997469981898005577788799999999982---9658


Q ss_pred             EEEEC-------CHHHHHHHHCCCCCEEEECCCC-HHHHHHHC------CCCCCCCEEECCCCCCCCCCCCCCHHHHHHH
Q ss_conf             99858-------9789888730779869980642-02334420------0011322044045310024654311567777
Q gi|255764515|r   78 SVITG-------TVKQRTKVLKTPAVLYVINFEN-LGWLVQEL------KGTWPFATIVVDESTKLKSFRLRQGSKTARA  143 (458)
Q Consensus        78 ~~~~g-------~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~~------~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~  143 (458)
                      .+..+       ++..|...+..+ .++.++.+. +..+.+.+      .-..++...||||+-.+             .
T Consensus       151 g~~~~~~~~~~~~~~~r~~~Y~~d-i~Y~tn~e~gfDyLrDn~~~~~~~~v~r~~~~aivDEvDsi-------------L  216 (799)
T PRK09200        151 GLNFSDIDDYEYQAGEKKAIYEAD-IIYTTNSELGFDYLRDNLADSKEDKVLRPLNYAIIDEVDSI-------------L  216 (799)
T ss_pred             EECCCCCCCCCCCHHHHHHHHHCC-CEECCCCCCHHHHHCCCCCCCHHHCCCCCCCEEEEECHHHH-------------H
T ss_conf             333688864437979999887477-22235654003453012015676525778966898532667-------------7


Q ss_pred             HHHHHHCCCEEEEECCCCHHHHCCCHHHHHH
Q ss_conf             6654305980799658402310010134677
Q gi|255764515|r  144 LAKPAWESERFIELTGTPSPNGLIDLWGQIW  174 (458)
Q Consensus       144 l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~  174 (458)
                      +    ..|..=+.+||.|-.  ..++|..++
T Consensus       217 i----DeArtPliisg~~~~--~~~~~~~~~  241 (799)
T PRK09200        217 L----DEAQTPLVISGAPRV--QSNLYHIAA  241 (799)
T ss_pred             H----HCCCCCCEECCCCCC--CHHHHHHHH
T ss_conf             7----413564121489876--527999999


No 125
>PRK13104 secA preprotein translocase subunit SecA; Reviewed
Probab=98.78  E-value=1.3e-05  Score=52.26  Aligned_cols=123  Identities=18%  Similarity=0.283  Sum_probs=69.4

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+--+.+|=|||++|... .+|..-..+++-||+..--+   -..|...+-.|+   ++.+
T Consensus        79 lg~r~~dvQl~gg~~lh~g~iaEM~TGEGKTL~atlp-~ylnal~g~gvhvvTvNdYLA~RDae~m~~~y~~l---Gltv  154 (896)
T PRK13104         79 LGLRHFDVQLIGGMVLHEGNIAEMRTGEGKTLVATLP-AYLNAISGRGVHIVTVNDYLAKRDSQWMKPIYEFL---GLTV  154 (896)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             3897647999989998458514651788559999999-99987559971997265354464499999999981---9767


Q ss_pred             EEEEC--CHHHHHHHHCCCCCE-EEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--978988873077986-9980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVL-YVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i-~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
                      .++..  +...|...+..  +| +.++.+. |..+.+.      ..-..++...||||+-.+
T Consensus       155 g~i~~~~~~~~r~~aY~~--DitY~Tn~e~gFDyLrDnm~~~~~~~vqr~~~~aivDEvDSi  214 (896)
T PRK13104        155 GVIYPDMSHKEKQEAYKA--DIVYGTNNEYGFDYLRDNMAFSLTDKVQRELNFAIVDEVDSI  214 (896)
T ss_pred             EEECCCCCHHHHHHHHCC--CEEEECCCCCCCCCCCCCHHCCHHHHCCCCCCEEEEECHHHH
T ss_conf             341899997999997149--937967865415235721113847625667764787422354


No 126
>PRK13103 secA preprotein translocase subunit SecA; Reviewed
Probab=98.75  E-value=1.3e-05  Score=52.32  Aligned_cols=124  Identities=17%  Similarity=0.238  Sum_probs=69.1

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+--+.+|=|||++|... .+|..-..+++-||+..--+   -..|...+-.|+   ++.|
T Consensus        79 lg~r~~dvQl~gg~~lh~g~iaEM~TGEGKTL~atlp-~ylnal~g~gvhvvTvNdYLA~RDae~m~~~y~~l---Gltv  154 (913)
T PRK13103         79 MGMRHFDVQLIGGMTLHEGKIAEMRTGEGKTLVGTLA-VYLNALSGKGVHVVTVNDYLARRDANWMRPLYEFL---GLSV  154 (913)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             4897646899989998468514651788559999999-99987559970997265365586699999999981---9768


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
                      .++..  ++..|...+..+ ..+.++.+. |..+.+.      ..-..++...||||+-.+
T Consensus       155 g~i~~~~~~~~r~~aY~~D-itY~tn~e~gFDyLRDnm~~~~~~~vqr~~~~aivDEvDSi  214 (913)
T PRK13103        155 GIVTPFQPPEEKRAAYAAD-ITYGTNNEFGFDYLRDNMAFSLDDKFQRELNFAVIDEVDSI  214 (913)
T ss_pred             EECCCCCCHHHHHHHCCCC-CEEECCCCCCCCCCCCCHHCCHHHHCCCCCCEEEEECHHHH
T ss_conf             5518999979999746688-64435764335345733104878843667764787423555


No 127
>PRK12904 preprotein translocase subunit SecA; Reviewed
Probab=98.74  E-value=1.3e-05  Score=52.29  Aligned_cols=124  Identities=16%  Similarity=0.263  Sum_probs=69.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+--+.+|=|||++|... .++..-..+++-||+..--+   -..|...+-+|+   ++.|
T Consensus        78 lg~~~~dvQl~gg~~l~~g~iaEM~TGEGKTL~atlp-~ylnal~g~gvhvvTvNdYLA~RDa~~m~~~~~~l---Gltv  153 (833)
T PRK12904         78 LGMRHFDVQLIGGMVLHEGKIAEMKTGEGKTLVATLP-AYLNALTGKGVHVVTVNDYLAKRDAEWMGPLYNFL---GLSV  153 (833)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEECCCCHHHHHHHH-HHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             5897647899989999469524650688589999999-99997369981998155577787799999999981---9788


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
                      .++..  ++..|...+..+ ..+.++.+. |..+.+.      ..-..++...||||+-.+
T Consensus       154 g~i~~~~~~~~r~~aY~~d-itY~tn~e~gFDyLrDnm~~~~~~~v~r~~~~aivDE~DSi  213 (833)
T PRK12904        154 GVILSGMSPEERREAYAAD-ITYGTNNEFGFDYLRDNMVFSLEDRVQRGLNYAIVDEVDSI  213 (833)
T ss_pred             EEECCCCCHHHHHHHHHCC-EEEECCCCCCCCCCCCCCCCCHHHHHHHCCCEEEEECCHHH
T ss_conf             0438999839999986377-13412543245412555437889875012572688641132


No 128
>KOG1802 consensus
Probab=98.74  E-value=1.6e-07  Score=63.75  Aligned_cols=67  Identities=25%  Similarity=0.315  Sum_probs=58.4

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             8747899999999967980999588998689999999999975999499991604656999999998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQR   68 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~k   68 (458)
                      +|.--|..||...+.++=.||-.++|+|||+++-++.-++...+..++||++|.++..+|-.+-|.+
T Consensus       410 kLN~SQ~~AV~~VL~rplsLIQGPPGTGKTvtsa~IVyhl~~~~~~~VLvcApSNiAVDqLaeKIh~  476 (935)
T KOG1802         410 KLNASQSNAVKHVLQRPLSLIQGPPGTGKTVTSATIVYHLARQHAGPVLVCAPSNIAVDQLAEKIHK  476 (935)
T ss_pred             HHCHHHHHHHHHHHCCCCEEEECCCCCCCEEHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
T ss_conf             2246789999999759851554699988331168999999985289569981650028999999986


No 129
>smart00489 DEXDc3 DEAD-like helicases superfamily.
Probab=98.69  E-value=8.5e-07  Score=59.40  Aligned_cols=37  Identities=30%  Similarity=0.375  Sum_probs=26.7

Q ss_pred             CCCHHHHHHHHHH---HHC-CCEEEEECCCCCHHHHHHHHH
Q ss_conf             8747899999999---967-980999588998689999999
Q gi|255764515|r    2 NLAPHQTKIVDWI---LDH-KRCAIWASMGSGKTVSVLTAL   38 (458)
Q Consensus         2 ~L~p~Q~~~v~~~---~~~-~~~ll~~~~G~GKT~~al~~~   38 (458)
                      +-||.|.+.++.+   ++. +.+++-.++|+|||+..|..+
T Consensus         8 ~py~~Q~e~m~~v~~~l~~~~~~llEaPTGtGKTlalL~~a   48 (289)
T smart00489        8 EPYPIQYEFMEELKRVLDRGKIGILESPTGTGKTLSLLCLT   48 (289)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHH
T ss_conf             99989999999999999749979998999651899999999


No 130
>smart00488 DEXDc2 DEAD-like helicases superfamily.
Probab=98.69  E-value=8.5e-07  Score=59.40  Aligned_cols=37  Identities=30%  Similarity=0.375  Sum_probs=26.7

Q ss_pred             CCCHHHHHHHHHH---HHC-CCEEEEECCCCCHHHHHHHHH
Q ss_conf             8747899999999---967-980999588998689999999
Q gi|255764515|r    2 NLAPHQTKIVDWI---LDH-KRCAIWASMGSGKTVSVLTAL   38 (458)
Q Consensus         2 ~L~p~Q~~~v~~~---~~~-~~~ll~~~~G~GKT~~al~~~   38 (458)
                      +-||.|.+.++.+   ++. +.+++-.++|+|||+..|..+
T Consensus         8 ~py~~Q~e~m~~v~~~l~~~~~~llEaPTGtGKTlalL~~a   48 (289)
T smart00488        8 EPYPIQYEFMEELKRVLDRGKIGILESPTGTGKTLSLLCLT   48 (289)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHH
T ss_conf             99989999999999999749979998999651899999999


No 131
>PRK12903 secA preprotein translocase subunit SecA; Reviewed
Probab=98.69  E-value=2.4e-05  Score=50.63  Aligned_cols=124  Identities=15%  Similarity=0.212  Sum_probs=69.4

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+--+.+|=|||++|... .++..-..+++-||+..--+   -..|...+-+|+   ++.|
T Consensus        75 lg~r~ydvQl~gg~~l~~G~iaEM~TGEGKTL~atlp-~ylnal~g~gvhvvTvNdYLA~RDae~m~~~y~~l---Gltv  150 (885)
T PRK12903         75 LGKRPYDVQIIGGIILDLGSVAEMKTGEGKTITSIAP-VYLNALEGKGVIVSTVNEYLAERDAEEMGKVFKFL---GLSV  150 (885)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             1898637899989998459514650688579999999-99987469980898064565585599999999982---9656


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
                      .++..  ++..|...+..+ ..+.++.+. +..+.+.      ..-..++...|+||+-.+
T Consensus       151 g~~~~~~~~~~r~~aY~~d-itY~tn~e~gFDyLrDnm~~~~~~~vqr~~~~aIvDEvDSi  210 (885)
T PRK12903        151 GINKANMDPNLKREAYNCD-ITYSTHSELGFDYLRDNMVSSYEEKVQRGLNFCLIDEVDSI  210 (885)
T ss_pred             EECCCCCCHHHHHHHHCCC-CEEECCCCEEECCCCCCCCCCHHHHCCCCCCEEEEECCHHH
T ss_conf             0118999979999985699-67977865030114001135837725889980366541144


No 132
>KOG0953 consensus
Probab=98.65  E-value=1.1e-06  Score=58.72  Aligned_cols=84  Identities=17%  Similarity=0.240  Sum_probs=56.4

Q ss_pred             CCCEEEEHHHHH-----HHHHH----HHHCCCCCCCHHHHHHHHHHHCC--CCCCEEEEEHHHCCCCCCCCCCCCEEEEE
Q ss_conf             884034222367-----88866----41000265334458998764245--88558998442211162200178599990
Q gi|255764515|r  320 NAAPIIVAYHFN-----SDLAR----LQKAFPQGRTLDKDPCTIQEWNE--GKIPLLFAHPASCGHGLNLQYGGNILVFF  388 (458)
Q Consensus       320 ~~~kviif~~~~-----~~~~~----i~~~~~~g~~~~~r~~~i~~f~~--~~~~vli~s~~~~~~GlnL~~a~~~iI~~  388 (458)
                      .|..++-|+...     ..++.    ....+.++-+++.|..--..||+  ++++||++| +|.|.||||.  -++|||+
T Consensus       357 ~GDCvV~FSkk~I~~~k~kIE~~g~~k~aVIYGsLPPeTr~aQA~~FNd~~~e~dvlVAs-DAIGMGLNL~--IrRiiF~  433 (700)
T KOG0953         357 PGDCVVAFSKKDIFTVKKKIEKAGNHKCAVIYGSLPPETRLAQAALFNDPSNECDVLVAS-DAIGMGLNLN--IRRIIFY  433 (700)
T ss_pred             CCCEEEEEEHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEE-CCCCCCCCCC--EEEEEEE
T ss_conf             887699941114888899999855855489955899730688898737988762568862-3214554443--1179875


Q ss_pred             CCC---------CCHHHHHHHHHHHHC
Q ss_conf             899---------898686445666620
Q gi|255764515|r  389 SLW---------WDLEEHQQMIERIGV  406 (458)
Q Consensus       389 ~~~---------wn~~~~~Q~~gRi~~  406 (458)
                      ++-         -+.+...|.-||.-|
T Consensus       434 sl~Kysg~e~~~it~sqikQIAGRAGR  460 (700)
T KOG0953         434 SLIKYSGRETEDITVSQIKQIAGRAGR  460 (700)
T ss_pred             ECCCCCCCCCEECCHHHHHHHHHCCCC
T ss_conf             035677662102568999988510154


No 133
>PRK12898 secA preprotein translocase subunit SecA; Reviewed
Probab=98.65  E-value=3.2e-05  Score=49.87  Aligned_cols=124  Identities=13%  Similarity=0.112  Sum_probs=69.4

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+--+.+|=|||++|... .+++.-..+++-||+..--+   -..|...+-.|+   ++.+
T Consensus       115 lg~r~ydvQliGg~~Lh~G~IaEM~TGEGKTL~atlp-aylnAL~G~gVHvvTvNDYLA~RDae~mg~iy~fL---GLsv  190 (673)
T PRK12898        115 LGMRHFPVQLMGGLALLEGWLAEMQTGEGKTLTATLP-AGTAALAGRPVHVITVNDYLAERDAEQMRPLYEAL---GVTV  190 (673)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEECCCCHHHHHHHH-HHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             3898646899989998458435750788589999999-99997369970898045577787699999999982---9778


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHHC-------------------------CCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-02334420-------------------------00113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQEL-------------------------KGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~~-------------------------~~~~~~~~iIiDEaH~l  129 (458)
                      .++..  ++.+|...+..+ ..+.+|-|. |..+.+.+                         .-..++...||||+-.+
T Consensus       191 g~i~~~~~~~eRr~aY~~D-ItYgTn~E~GFDYLRDnm~~~~~~~~~~~~~~~l~~~~~~~~~~vqR~l~fAIVDEvDSI  269 (673)
T PRK12898        191 GCVIEDQDPEERRAAYGAD-VTYCTNKELVFDYLRDRIALGQRAGDARLALESLRGGSERSGQLLLRGLHFAIVDEADSV  269 (673)
T ss_pred             EEECCCCCHHHHHHHHCCC-CEEECCHHHHHHHHHHHHHCCCCCCCCCCCCHHHCCCCCCHHHHHCCCCCEEEEECHHHE
T ss_conf             4517999979999972699-579565233245776413023343211111011013346677751356753787330331


No 134
>PRK13107 preprotein translocase subunit SecA; Reviewed
Probab=98.58  E-value=5e-05  Score=48.68  Aligned_cols=124  Identities=13%  Similarity=0.200  Sum_probs=69.5

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+--+.+|=|||++|... .+|..-..+++-||+..--+   -..|...+-.|+   ++.+
T Consensus        79 lg~r~ydvQl~gg~~Lh~G~iaEM~TGEGKTL~atlp-~ylnal~g~gvhvvTvNdYLA~RDae~m~~vy~~l---Glsv  154 (908)
T PRK13107         79 FEMRHFDVQLLGGMVLDSNRIAEMRTGEGKTLTATLP-AYLNALTGKGVHVITVNDYLARRDAENNRPLFEFL---GLTV  154 (908)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             3897547999989998469514651788559999999-99987559970997265355475499999999981---9757


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
                      .++..  ++..|...+..+ ..+.+|.|. |..+.+.      ..-..++...||||+-.+
T Consensus       155 g~i~~~~~~~er~~aY~~D-itY~Tn~e~gFDYLRDnm~~~~~~~vqr~~~~aivDEvDSi  214 (908)
T PRK13107        155 GINVAGLGQQEKKAAYNAD-ITYGTNNEFGFDYLRDNMAFSPQERVQRPLHYALIDEVDSI  214 (908)
T ss_pred             EECCCCCCHHHHHHHCCCC-CEEECCCCCCCCCCCCCCCCCHHHHCCCCCCEEEEECHHHH
T ss_conf             3317999969999845688-64535764234235743015758753567764887422354


No 135
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional
Probab=98.57  E-value=2.7e-06  Score=56.37  Aligned_cols=65  Identities=18%  Similarity=0.126  Sum_probs=39.5

Q ss_pred             CCCHHHHHHHHH---HHH---CCCE-EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHH-HHHHH
Q ss_conf             874789999999---996---7980-99958899868999999999997599949999160465699-99999
Q gi|255764515|r    2 NLAPHQTKIVDW---ILD---HKRC-AIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSV-WTSEV   66 (458)
Q Consensus         2 ~L~p~Q~~~v~~---~~~---~~~~-ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~-W~~Ei   66 (458)
                      +-||-|.+-...   .+.   +++. ++=+++|+|||+--|.-+........++++|-+++..+++| +.+++
T Consensus        25 e~R~~Q~~Ma~~V~~al~~~~~~~~l~iEAgTGtGKTlaYL~Pai~~a~~~~~~vvIST~T~~LQeQL~~kDl   97 (697)
T PRK11747         25 IPRAGQRQMIAEVAKTLAGEYGRHILVIEAGTGVGKSLAYLLAGIPIARAEKKKLVISTATVALQEQLVHKDL   97 (697)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHH
T ss_conf             7187899999999999616667866999899972089999999999999829979998898899999987079


No 136
>pfam02562 PhoH PhoH-like protein. PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation.
Probab=98.55  E-value=2e-06  Score=57.12  Aligned_cols=133  Identities=17%  Similarity=0.201  Sum_probs=73.6

Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCC-CCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEEC
Q ss_conf             4789999999996798099958899868999999999997599-949999160465699999999855888815999858
Q gi|255764515|r    4 APHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG   82 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~-~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g   82 (458)
                      -+.|..+++.+.++.-..+..+.|+|||+.|++++..+...+. .+++|+=|.  ++.  .+++           ..+.|
T Consensus         6 ~~~Q~~~~~~l~~~~iv~~~GpAGtGKT~la~~~al~~l~~~~~~kiii~Rp~--v~~--g~~i-----------GfLPG   70 (205)
T pfam02562         6 TLGQKRYVEAIRKNDIVFGIGPAGTGKTYLAVAAAVDALKDGKVKRIILTRPA--VEA--GEKL-----------GFLPG   70 (205)
T ss_pred             CHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECC--CCC--CCCC-----------CCCCC
T ss_conf             88899999997179807998999860999999999999971894379997577--125--7754-----------55889


Q ss_pred             CHHHH--------------------HHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHH
Q ss_conf             97898--------------------8873077986998064202334420001132204404531002465431156777
Q gi|255764515|r   83 TVKQR--------------------TKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTAR  142 (458)
Q Consensus        83 ~~~~r--------------------~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~  142 (458)
                      +-.++                    .+.+.....+-+.+...++.      -++.-..||+|||+++      ...+..-
T Consensus        71 ~~~eK~~p~~~p~~d~l~~~~~~~~~~~l~~~~~Ie~~pl~~iRG------rTf~n~~iIvDEaQN~------t~~~lk~  138 (205)
T pfam02562        71 DLEEKVDPYLRPLYDALYDMLGAEKVEKLIERGVIEIAPLAYMRG------RTLNDAFIILDEAQNT------TPEQMKM  138 (205)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCEEECCHHHHCC------CCCCCCEEEEECHHCC------CHHHHHH
T ss_conf             789999999999999999872899999999759756614676554------7625688999722139------9999999


Q ss_pred             HHHHHHHCCCEEEEECCCCHHHH
Q ss_conf             76654305980799658402310
Q gi|255764515|r  143 ALAKPAWESERFIELTGTPSPNG  165 (458)
Q Consensus       143 ~l~~~~~~~~~~l~LTgTPi~n~  165 (458)
                      .+.++...+  ++.++|-|.|..
T Consensus       139 ilTRiG~~S--K~vi~GD~~Q~D  159 (205)
T pfam02562       139 FLTRIGFNS--KMVVTGDITQID  159 (205)
T ss_pred             HHHHCCCCC--EEEEECCHHHCC
T ss_conf             984217996--899947866517


No 137
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]
Probab=98.53  E-value=2.8e-06  Score=56.33  Aligned_cols=154  Identities=16%  Similarity=0.069  Sum_probs=68.2

Q ss_pred             HHHHHHHCCCEEEEECCCCCHHHHHH-HHHHHHHHCCCCCEEEEECCHHHH-HHHHHHHHHHCCCCC--CEEEEEECCHH
Q ss_conf             99999967980999588998689999-999999975999499991604656-999999998558888--15999858978
Q gi|255764515|r   10 IVDWILDHKRCAIWASMGSGKTVSVL-TALSYIHLWGEKSVLVIAPLRVAQ-SVWTSEVQRWSNFSH--MNISVITGTVK   85 (458)
Q Consensus        10 ~v~~~~~~~~~ll~~~~G~GKT~~al-~~~~~l~~~~~~~~LIv~P~~l~~-~~W~~Ei~kf~~~~~--~~~~~~~g~~~   85 (458)
                      ..+.+.++...+|..++|+|||=+.= .+++.-. .+...+.+.=|..+.. +.=.+-.+.+....+  +.|.+-..+..
T Consensus        58 i~~ai~~~~vvii~getGsGKTTqlP~~lle~g~-~~~g~I~~tQPRRlAArsvA~RvAeel~~~~G~~VGY~iRfe~~~  136 (845)
T COG1643          58 ILKAIEQNQVVIIVGETGSGKTTQLPQFLLEEGL-GIAGKIGCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKV  136 (845)
T ss_pred             HHHHHHHCCEEEEECCCCCCHHHHHHHHHHHHHC-CCCCEEEECCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEECCC
T ss_conf             9999986978998679988758788999996001-668759965843899999999999983898676543799962267


Q ss_pred             HHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHH---HHHCCCEEEEECCCCH
Q ss_conf             9888730779869980642023344200011322044045310024654311567777665---4305980799658402
Q gi|255764515|r   86 QRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAK---PAWESERFIELTGTPS  162 (458)
Q Consensus        86 ~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~---~~~~~~~~l~LTgTPi  162 (458)
                            .....+-++|=..+-.....-.....+++||+||+|.=    +-...-....+..   ....--+++.||||-=
T Consensus       137 ------s~~Trik~mTdGiLlrei~~D~~Ls~ys~vIiDEaHER----Sl~tDilLgllk~~~~~rr~DLKiIimSATld  206 (845)
T COG1643         137 ------SPRTRIKVMTDGILLREIQNDPLLSGYSVVIIDEAHER----SLNTDILLGLLKDLLARRRDDLKLIIMSATLD  206 (845)
T ss_pred             ------CCCCEEEEECCHHHHHHHHHCCCCCCCCEEEEECHHHH----HHHHHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             ------87714689514799999843802045877997013355----68889999999999864688705999725358


Q ss_pred             HHHCCCHHHHHH
Q ss_conf             310010134677
Q gi|255764515|r  163 PNGLIDLWGQIW  174 (458)
Q Consensus       163 ~n~~~el~~ll~  174 (458)
                      ..+.+.+|+..-
T Consensus       207 ~~rfs~~f~~ap  218 (845)
T COG1643         207 AERFSAYFGNAP  218 (845)
T ss_pred             HHHHHHHCCCCC
T ss_conf             899997628998


No 138
>PRK12326 preprotein translocase subunit SecA; Reviewed
Probab=98.53  E-value=6.8e-05  Score=47.89  Aligned_cols=124  Identities=18%  Similarity=0.156  Sum_probs=68.7

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+.-+.+|=|||++|... .++..-..+++-||+..--+   -..|...+-.|+   ++.+
T Consensus        86 lG~r~ydVQliGg~~L~~G~IaEM~TGEGKTL~atlp-aylnAL~GkgVHvVTvNDYLA~RDaewm~piy~fL---GLtv  161 (775)
T PRK12326         86 LGLRPFDVQLLGALRLLAGDVVEMATGEGKTLAGAIA-AAGYALGGRRVHVITVNDYLARRDAEWMGPLLEAF---GLTV  161 (775)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEECCCCHHHHHHHH-HHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             3898646899989998459536760688589999999-99996369980898225687887699999999982---9776


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
                      .++..  ++..|...+..+ ..+.++.+. |..+.+.      ..-..+++..||||+-.+
T Consensus       162 g~i~~~~~~~err~aY~~D-ItY~Tn~E~GFDYLRDnm~~~~~~~vqr~~~faIVDEvDSI  221 (775)
T PRK12326        162 GWITEESTAEERRAAYACD-VTYASVNEIGFDVLRDQLVTDVADLVSPNPDVAIIDEADSV  221 (775)
T ss_pred             CCCCCCCCHHHHHHHCCCC-CCCCCCCCCCCCCCHHHHCCCHHHHCCCCCCEEEEECCCHH
T ss_conf             5378999979999844687-73115555324455132126988843677875998642000


No 139
>CHL00122 secA preprotein translocase subunit SecA; Validated
Probab=98.49  E-value=8.5e-05  Score=47.30  Aligned_cols=124  Identities=19%  Similarity=0.337  Sum_probs=70.9

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+--+.+|=|||++|... .++..-..+++-||+..--+   -..|...+-+|+   ++.|
T Consensus        73 lg~r~~dvQl~gg~~Lh~G~iaEM~TGEGKTL~atlp-~ylnal~GkgvhvvTvNdYLA~RDae~m~~vy~~l---Glsv  148 (891)
T CHL00122         73 LGLRHFDVQLIGGLVLNDGKIAEMKTGEGKTLVATLP-AYLNALTGKGVHIVTVNDYLARRDSEWMGQIYRFL---GLSV  148 (891)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             4897646999989998459524650688579999999-99997559972998064565686699999999982---9667


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHH------CCCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-0233442------000113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQE------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~------~~~~~~~~~iIiDEaH~l  129 (458)
                      .++..  ++..|...+..+ ..+.+|.+. |..+.+.      ..-..++...||||+-.+
T Consensus       149 g~i~~~~~~~er~~aY~~D-ItY~Tn~e~gFDyLRDnm~~~~~~~vqr~~~~aIvDEvDSi  208 (891)
T CHL00122        149 GLIQEDMSIEERKQNYKAD-ITYVTNSELGFDYLRDNMALSLSEVVQRPFNYCIIDEVDSI  208 (891)
T ss_pred             EEECCCCCHHHHHHHHCCC-CEEECCCCEECCCCCCCCCCCHHHHHCCCCCEEEEECHHHH
T ss_conf             0208999979999983589-27978876222566633236878840889973788640455


No 140
>PRK10875 recD exonuclease V subunit alpha; Provisional
Probab=98.41  E-value=2.2e-06  Score=56.95  Aligned_cols=138  Identities=17%  Similarity=0.123  Sum_probs=72.1

Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHH---CCCCCEEEEECCHHHHHHHHHH-HHHHCCCCCCEEEEE
Q ss_conf             789999999996798099958899868999999999997---5999499991604656999999-998558888159998
Q gi|255764515|r    5 PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL---WGEKSVLVIAPLRVAQSVWTSE-VQRWSNFSHMNISVI   80 (458)
Q Consensus         5 p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~---~~~~~~LIv~P~~l~~~~W~~E-i~kf~~~~~~~~~~~   80 (458)
                      +||+.|+...+.++-++|-..+|+|||-+...++..+..   ....++...+|+.-...- -.| +..-...-.+     
T Consensus       150 dwQk~A~a~Al~~~~~vIsGGPGTGKTttV~~lLa~l~~~~~~~~l~I~LaAPTGKAAaR-L~Esi~~~~~~l~~-----  223 (607)
T PRK10875        150 NWQKVAAAVALTRRISVISGGPGTGKTTTVAKLLAALIQLADGERCRIRLAAPTGKAAAR-LTESLGKALRQLPL-----  223 (607)
T ss_pred             CHHHHHHHHHHHCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHH-HHHHHHHHHHHCCC-----
T ss_conf             189999999875577899679998778899999999999645899708998822899999-99999878753476-----


Q ss_pred             ECCHHHHHHHHCCCCCEEEECCCCH-------HHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCE
Q ss_conf             5897898887307798699806420-------233442000113220440453100246543115677776654305980
Q gi|255764515|r   81 TGTVKQRTKVLKTPAVLYVINFENL-------GWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESER  153 (458)
Q Consensus        81 ~g~~~~r~~~~~~~~~i~i~s~e~~-------~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~  153 (458)
                        +...+. .+..    -..|...+       .....+-.+..++|+||||||-.+      ...-..+.+..+..  .-
T Consensus       224 --~~~~~~-~~p~----~a~TiHRLLg~~p~~~~f~~~~~nPL~~DvlIVDEASMV------Dl~Lm~~LL~Alp~--~a  288 (607)
T PRK10875        224 --TDEQKK-RIPE----DASTLHRLLGAQPGSQRLRYHAGNPLHLDVLVVDEASMI------DLPMMSRLIDALPD--HA  288 (607)
T ss_pred             --CHHHHH-CCCC----CCEEHHHHCCCCCCCCCCCCCCCCCCCCCEEEEECCHHH------HHHHHHHHHHHCCC--CC
T ss_conf             --656663-3765----566589752967898765657799998898999073366------59999999982899--98


Q ss_pred             EEEECCCCHH
Q ss_conf             7996584023
Q gi|255764515|r  154 FIELTGTPSP  163 (458)
Q Consensus       154 ~l~LTgTPi~  163 (458)
                      +++|=|-|-|
T Consensus       289 RLILvGD~dQ  298 (607)
T PRK10875        289 RVIFLGDRDQ  298 (607)
T ss_pred             EEEEECCHHH
T ss_conf             8999656232


No 141
>KOG1803 consensus
Probab=98.40  E-value=2.4e-06  Score=56.71  Aligned_cols=58  Identities=31%  Similarity=0.375  Sum_probs=45.2

Q ss_pred             CCHHHHHHHHHHHHCCC-EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHH
Q ss_conf             74789999999996798-099958899868999999999997599949999160465699
Q gi|255764515|r    3 LAPHQTKIVDWILDHKR-CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSV   61 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~-~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~   61 (458)
                      |.+-|..|+.+...++. .++-.+||+|||.+...++..+..++ +++||.+|+++..+.
T Consensus       186 ln~SQk~Av~~~~~~k~l~~I~GPPGTGKT~TlvEiI~qlvk~~-k~VLVcaPSn~AVdN  244 (649)
T KOG1803         186 LNSSQKAAVSFAINNKDLLIIHGPPGTGKTRTLVEIISQLVKQK-KRVLVCAPSNVAVDN  244 (649)
T ss_pred             CCHHHHHHHHHHHCCCCCEEEECCCCCCCEEEHHHHHHHHHHCC-CEEEEECCCHHHHHH
T ss_conf             23779999999735688357557998884043999999999728-859997673678999


No 142
>KOG0349 consensus
Probab=98.40  E-value=2.3e-06  Score=56.79  Aligned_cols=94  Identities=16%  Similarity=0.282  Sum_probs=75.1

Q ss_pred             HCCCCCEEEEHHHHHHHHHHHHH-------------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCCC
Q ss_conf             12488403422236788866410-------------00265334458998764245885589984422111622001785
Q gi|255764515|r  317 EKANAAPIIVAYHFNSDLARLQK-------------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN  383 (458)
Q Consensus       317 ~~~~~~kviif~~~~~~~~~i~~-------------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~a~~  383 (458)
                      ++..-.++||||..+..-+.+.+             .++++..+++|.+-++.|...+++.|||+ ++++-||+++ +-.
T Consensus       501 ~~h~mdkaiifcrtk~dcDnLer~~~qkgg~~~scvclhgDrkP~Erk~nle~Fkk~dvkflict-dvaargldi~-g~p  578 (725)
T KOG0349         501 RRHAMDKAIIFCRTKQDCDNLERMMNQKGGKHYSCVCLHGDRKPDERKANLESFKKFDVKFLICT-DVAARGLDIT-GLP  578 (725)
T ss_pred             HHHCCCCEEEEEECCCCCHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHHHCCEEEEEEE-HHHHCCCCCC-CCC
T ss_conf             55346745999703566167999998727864036888247882677887876652572799971-0443566542-772


Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCHHCCC
Q ss_conf             9999089989868644566662022020378
Q gi|255764515|r  384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGF  414 (458)
Q Consensus       384 ~iI~~~~~wn~~~~~Q~~gRi~~~r~hR~Gq  414 (458)
                      .+|+..+|-....+--++||+  .||.|.|-
T Consensus       579 ~~invtlpd~k~nyvhrigrv--graermgl  607 (725)
T KOG0349         579 FMINVTLPDDKTNYVHRIGRV--GRAERMGL  607 (725)
T ss_pred             EEEEEECCCCCCHHHHHHHCC--CHHHHCCE
T ss_conf             599985586541154564020--14544050


No 143
>PRK12900 secA preprotein translocase subunit SecA; Reviewed
Probab=98.37  E-value=0.00017  Score=45.42  Aligned_cols=123  Identities=18%  Similarity=0.277  Sum_probs=69.7

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160465---69999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~~   78 (458)
                      +|+||-.+-+--+.-+.+.+--+.+|=|||++|... .+|..-..+++-||+..--+   -..|...+-+|+   ++.|.
T Consensus        92 ~m~~ydvQliGg~~Lh~G~IaEM~TGEGKTLvatlp-~ylnaL~GkgvHvvTvNdYLA~RDae~m~~vy~fL---Glsvg  167 (983)
T PRK12900         92 DMVPYDVQLIGGIVLHSGKISEMATGEGKTLVSTLP-TFLNALTGRGVHVVTVNDYLAQRDKEWMNPVFEFH---GLSVG  167 (983)
T ss_pred             CCCCCCHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCCEEECCCHHHHHHHHHHHHHHHHHH---CCEEE
T ss_conf             677774699979998368314551788589999999-99986369982898145676786799999999984---97770


Q ss_pred             EEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHHC------CCCCCCCEEECCCCCCC
Q ss_conf             9858--9789888730779869980642-02334420------00113220440453100
Q gi|255764515|r   79 VITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQEL------KGTWPFATIVVDESTKL  129 (458)
Q Consensus        79 ~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~~------~~~~~~~~iIiDEaH~l  129 (458)
                      ++..  ++..|...+..+ ..+.+|-|. |..+.+.+      .-..++...||||+-.+
T Consensus       168 ~i~~~~~~~err~aY~~D-ItYgTn~E~gFDYLRDnm~~~~~~~vqr~~~~aIVDEvDSi  226 (983)
T PRK12900        168 VILNSMRPEERREQYLCD-ITYGTNNEFGFDYLRDNMAGSPEEMVQRDFYFAIVDEVDSV  226 (983)
T ss_pred             EECCCCCHHHHHHHHCCC-CEEECCCCCCCCCCHHCCCCCHHHHCCCCCCEEEEECHHHH
T ss_conf             308999989999987599-57878985424021004477868842788855898441566


No 144
>PRK09694 hypothetical protein; Provisional
Probab=98.37  E-value=5.8e-06  Score=54.36  Aligned_cols=152  Identities=19%  Similarity=0.114  Sum_probs=77.3

Q ss_pred             CHHHHHHHHHHHHCCC-EEEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCHHHHHHHHHHHHHHC--CCCCCEEEE
Q ss_conf             4789999999996798-09995889986899999999999759-9949999160465699999999855--888815999
Q gi|255764515|r    4 APHQTKIVDWILDHKR-CAIWASMGSGKTVSVLTALSYIHLWG-EKSVLVIAPLRVAQSVWTSEVQRWS--NFSHMNISV   79 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~-~ll~~~~G~GKT~~al~~~~~l~~~~-~~~~LIv~P~~l~~~~W~~Ei~kf~--~~~~~~~~~   79 (458)
                      +|=|.. ++-+-..++ .+|-++||.|||=-|+.++..|...+ ...+.+..|+..-.|+=.+-+..|.  .++...+..
T Consensus       290 rplQ~~-~~~l~~~PgL~IiEAptG~GKTEAAL~~A~~L~~~~~~~Gl~faLPT~ATaNaMf~Rv~~~~~~~~~~~~v~L  368 (878)
T PRK09694        290 RQLQTL-VDALPLAPGLTVIEAPTGSGKTETALAYAWKLIDQQLADSVIFALPTQATANAMLSRMEAAASKLFPSPNLIL  368 (878)
T ss_pred             CHHHHH-HHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             679999-9845679987999758999758999999999997348983699774798899999999999997368997697


Q ss_pred             EECCHHHH---H-------------------HHHCC-------CCCEEEECCCCHH-H-------HHHHCCCCCCCCEEE
Q ss_conf             85897898---8-------------------87307-------7986998064202-3-------344200011322044
Q gi|255764515|r   80 ITGTVKQR---T-------------------KVLKT-------PAVLYVINFENLG-W-------LVQELKGTWPFATIV  122 (458)
Q Consensus        80 ~~g~~~~r---~-------------------~~~~~-------~~~i~i~s~e~~~-~-------~~~~~~~~~~~~~iI  122 (458)
                      .+|.....   .                   ..|..       -..+.|.|.+.+- .       ..+.+  ...-..||
T Consensus       369 aHg~a~l~~~~~~l~~~~~~~~~~~~~~~~~~~W~~~~~Kr~LLap~~VGTiDQaLla~L~~kH~~LR~~--gLa~kvvI  446 (878)
T PRK09694        369 AHGNSRFNHLFQSIKSRAITEQGQEEAWVQCCQWLSQSNKRVFLGQIGVCTIDQVLISVLPVKHRFIRGL--GIGRSVLI  446 (878)
T ss_pred             ECCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCHHHHHCCCCEECCHHHHHHHHHCCCHHHHHHH--HHCCCEEE
T ss_conf             4473655056665101367654454301577766411102231377154679999998746148999999--86287489


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             045310024654311567777665430598079965840
Q gi|255764515|r  123 VDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTP  161 (458)
Q Consensus       123 iDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTP  161 (458)
                      |||+|..   ......-..+.+.-+......+++||||-
T Consensus       447 iDEVHAY---D~Ym~~lL~~lL~wl~~~g~~viLLSATL  482 (878)
T PRK09694        447 VDEVHAY---DAYMNGLLEAVLKAQAQVGGSVILLSATL  482 (878)
T ss_pred             EECCCCC---CHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             7253334---58899999999999998399889992789


No 145
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344   This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. C-terminal part of the protein matches a domain found in viral RNA helicase, superfamily 1, IPR000606 from INTERPRO. ; GO: 0008854 exodeoxyribonuclease V activity, 0009338 exodeoxyribonuclease V complex.
Probab=98.36  E-value=4.5e-06  Score=55.01  Aligned_cols=145  Identities=18%  Similarity=0.179  Sum_probs=74.1

Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHH----HHHHHCCC--CCEEEEECCHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             47899999999967980999588998689999999----99997599--9499991604656999999998558888159
Q gi|255764515|r    4 APHQTKIVDWILDHKRCAIWASMGSGKTVSVLTAL----SYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~----~~l~~~~~--~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~   77 (458)
                      .++|..|++..+.+.-++|...||||||.|+.-++    .....+|.  .++-+++|+.-... =-.|+-+-. ...+. 
T Consensus       229 ~D~Q~~a~~~aL~~~f~li~GGPGTGKTTTv~~LL~al~~~~~~~G~~~~~I~l~APTGKAa~-RL~esl~~~-~~~L~-  305 (753)
T TIGR01447       229 TDWQKVAVALALKSNFSLITGGPGTGKTTTVARLLLALIKQSPKQGKPRLRIALAAPTGKAAA-RLAESLRKA-VKKLA-  305 (753)
T ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHH-HHHHHHHHH-HHHHH-
T ss_conf             379999999986087689987988977899999999999989864997404788668447999-999999988-63223-


Q ss_pred             EEEECCHHHHHHHHCCCCCEEEECCCCH--------HHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9985897898887307798699806420--------23344200011322044045310024654311567777665430
Q gi|255764515|r   78 SVITGTVKQRTKVLKTPAVLYVINFENL--------GWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        78 ~~~~g~~~~r~~~~~~~~~i~i~s~e~~--------~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                       .-.+.-+.  +.+ .+-.+-+.|.+.+        .....+..+..++|.||||||-.+      .-.-..+.+..+..
T Consensus       306 -~~~~aid~--~~~-~~~~~~~~TiHrLLG~~~I~~~~fr~h~~N~L~~DVLvvDEaSMV------dl~lm~kL~~A~~~  375 (753)
T TIGR01447       306 -AENMAIDE--DLI-AALPSEATTIHRLLGIKPIDTKRFRHHERNPLPLDVLVVDEASMV------DLPLMAKLLKALPP  375 (753)
T ss_pred             -HHCCCCCH--HHH-CCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEECCCHHC------CHHHHHHHHHHCCC
T ss_conf             -42366587--985-487204568888616614787677677778898552787060022------67999999972263


Q ss_pred             CCC------EEEEECCCC
Q ss_conf             598------079965840
Q gi|255764515|r  150 ESE------RFIELTGTP  161 (458)
Q Consensus       150 ~~~------~~l~LTgTP  161 (458)
                      .++      .++.|=|=+
T Consensus       376 ~~k~~KLy~~~LIllGD~  393 (753)
T TIGR01447       376 NTKDKKLYADRLILLGDK  393 (753)
T ss_pred             CCCCCCHHHCCCCEECCC
T ss_conf             001320101020012267


No 146
>COG3587 Restriction endonuclease [Defense mechanisms]
Probab=98.35  E-value=4.5e-06  Score=55.06  Aligned_cols=135  Identities=15%  Similarity=0.200  Sum_probs=71.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCHHH-HHHHHH------HH-HHHCCCCCCEEEEEECCHHHHHH
Q ss_conf             8099958899868999999999997-599949999160465-699999------99-98558888159998589789888
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHL-WGEKSVLVIAPLRVA-QSVWTS------EV-QRWSNFSHMNISVITGTVKQRTK   89 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~-~~~~~~LIv~P~~l~-~~~W~~------Ei-~kf~~~~~~~~~~~~g~~~~r~~   89 (458)
                      ++=+-+|+|+|||++=+-.+-.|+. .|-.+.+||||...+ +.+...      +| ..+-....++..++.........
T Consensus        76 NiDI~METGTGKTy~YlrtmfeLhk~YG~~KFIivVPs~AIkeGv~~~s~~~~ehF~k~~Yent~~e~~i~~~~~~~~~~  155 (985)
T COG3587          76 NIDILMETGTGKTYTYLRTMFELHKKYGLFKFIIVVPSLAIKEGVFLTSKETTEHFFKSEYENTRLESYIYDEDIEKFKF  155 (985)
T ss_pred             EEEEEEECCCCCEEEHHHHHHHHHHHHCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHH
T ss_conf             45689832788433179999999997484559999353898744577789999998651215730268972327788750


Q ss_pred             HHCCCCCEEEECCCCHHHH---HHH-------CCC-----CCCC-------CEEECCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             7307798699806420233---442-------000-----1132-------20440453100246543115677776654
Q gi|255764515|r   90 VLKTPAVLYVINFENLGWL---VQE-------LKG-----TWPF-------ATIVVDESTKLKSFRLRQGSKTARALAKP  147 (458)
Q Consensus        90 ~~~~~~~i~i~s~e~~~~~---~~~-------~~~-----~~~~-------~~iIiDEaH~lkn~~~~~~s~~~~~l~~~  147 (458)
                      .-+....+++++.+++...   ...       ...     ..+.       -.+|+||-|++...     .++.+++..+
T Consensus       156 ~~~~~~~vLl~~~~A~nk~~inan~iN~~s~~~~~~~~~~~spvd~la~~rPIvIvDEPh~f~~~-----~k~~~~i~~l  230 (985)
T COG3587         156 KSNNKPCVLLIFVSAFNKEEINANMINSESMENTNLFNGATSPVDALASMRPIVIVDEPHRFLGD-----DKTYGAIKQL  230 (985)
T ss_pred             CCCCCCEEEEEEHHHHCCCCCCCCCCCCHHHCCCCCCCCCCCHHHHHHHCCCEEEECCHHHCCCC-----HHHHHHHHHC
T ss_conf             14788559998413325332111331605440057420015877898742987996471003541-----3788988730


Q ss_pred             HHCCCEEEEECCC
Q ss_conf             3059807996584
Q gi|255764515|r  148 AWESERFIELTGT  160 (458)
Q Consensus       148 ~~~~~~~l~LTgT  160 (458)
                        ++-..+=-+||
T Consensus       231 --~pl~ilRfgAT  241 (985)
T COG3587         231 --NPLLILRFGAT  241 (985)
T ss_pred             --CCEEEEEECCC
T ss_conf             --86079995564


No 147
>PRK10536 hypothetical protein; Provisional
Probab=98.29  E-value=9.8e-06  Score=52.98  Aligned_cols=142  Identities=13%  Similarity=0.154  Sum_probs=70.0

Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCHHHHHHHHHHH--------HHHCCC--C
Q ss_conf             789999999996798099958899868999999999997-59994999916046569999999--------985588--8
Q gi|255764515|r    5 PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL-WGEKSVLVIAPLRVAQSVWTSEV--------QRWSNF--S   73 (458)
Q Consensus         5 p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~-~~~~~~LIv~P~~l~~~~W~~Ei--------~kf~~~--~   73 (458)
                      +.|...++.+.++.-.+...+-|+|||+.|++++..+.. ....+++++=|.  ++.  .+++        +|+.+.  |
T Consensus        62 ~~Q~~yi~~i~~~~ivf~~GpAGTGKT~lA~a~Al~~l~~~~~~kIIltRP~--V~~--ge~lGfLPGdl~EK~~Pyl~P  137 (262)
T PRK10536         62 EAQLHYLKAIESKQLIFATGEAGCGKTWISAAKAAEALIHKDVDRIIVTRPV--LQA--DEDLGFLPGDIAEKFAPYFRP  137 (262)
T ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC--CCC--CCCCCCCCCCHHHHHHHHHHH
T ss_conf             6499999998619839998999875899999999999985888689996678--756--766676989879988788878


Q ss_pred             CCE-EEEEECCHHHHHHHHC-CCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             815-9998589789888730-77986998064202334420001132204404531002465431156777766543059
Q gi|255764515|r   74 HMN-ISVITGTVKQRTKVLK-TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWES  151 (458)
Q Consensus        74 ~~~-~~~~~g~~~~r~~~~~-~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~  151 (458)
                      -.+ .....|.. .....+. ....+-+.+...++..      .++-..||+|||+++      ...+..-.+.++...+
T Consensus       138 i~D~L~~~lg~~-~~~~~~~~e~G~Iei~PlafmRGr------Tf~na~IIvDEaQN~------T~~qmk~iLTRiG~~S  204 (262)
T PRK10536        138 VYDVLVRRLGAS-FMQYCLRPEIGKVEIAPFAYMRGR------TFENAVVILDEAQNV------TAAQMKMFLTRLGENV  204 (262)
T ss_pred             HHHHHHHHHCHH-HHHHHHHHHCCCEEEEEHHHHCCC------CCCCEEEEEEHHHCC------CHHHHHHHHHHCCCCC
T ss_conf             999999996859-999998730594899875874477------514428998412128------9999988985425996


Q ss_pred             CEEEEECCCCHHHH
Q ss_conf             80799658402310
Q gi|255764515|r  152 ERFIELTGTPSPNG  165 (458)
Q Consensus       152 ~~~l~LTgTPi~n~  165 (458)
                        ++.+||-|-|..
T Consensus       205 --KiVi~GD~~Q~D  216 (262)
T PRK10536        205 --TVIVNGDITQCD  216 (262)
T ss_pred             --EEEEECCCCCCC
T ss_conf             --899968820226


No 148
>KOG0329 consensus
Probab=98.27  E-value=2.3e-05  Score=50.69  Aligned_cols=134  Identities=22%  Similarity=0.252  Sum_probs=81.4

Q ss_pred             CCCCCHHHHH-HHHHHHHH-HCCCCCEEEEECCHHHHHHHHHHHHHHCC-CCCCEEEEEECC--HHHHHHHHCCCCCEEE
Q ss_conf             8899868999-99999999-75999499991604656999999998558-888159998589--7898887307798699
Q gi|255764515|r   25 SMGSGKTVSV-LTALSYIH-LWGEKSVLVIAPLRVAQSVWTSEVQRWSN-FSHMNISVITGT--VKQRTKVLKTPAVLYV   99 (458)
Q Consensus        25 ~~G~GKT~~a-l~~~~~l~-~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~-~~~~~~~~~~g~--~~~r~~~~~~~~~i~i   99 (458)
                      --|.|||..- ++.+..+. ..|.-.+||+|.+.-+.-|-..|.++|.. .|..++.++.|.  .+...+.+..--.+++
T Consensus        87 ksgmgktavfvl~tlqqiepv~g~vsvlvmchtrelafqi~~ey~rfskymP~vkvaVFfGG~~Ikkdee~lk~~PhivV  166 (387)
T KOG0329          87 KSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLFIKKDEELLKNCPHIVV  166 (387)
T ss_pred             CCCCCCEEEEEHHHHHHCCCCCCEEEEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEECCEECCCCHHHHHCCCEEEE
T ss_conf             25788436552223552378898079999962189999988999999754888458999755310346998827990897


Q ss_pred             ECCCCHHHHHHHC-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             8064202334420-001132204404531002465431156777766543059807996584
Q gi|255764515|r  100 INFENLGWLVQEL-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      -+...+..+.++. +....-...|+|||..+-..-  ..-+-.+.+-+..+..+.++..|||
T Consensus       167 gTPGrilALvr~k~l~lk~vkhFvlDEcdkmle~l--DMrRDvQEifr~tp~~KQvmmfsat  226 (387)
T KOG0329         167 GTPGRILALVRNRSLNLKNVKHFVLDECDKMLEQL--DMRRDVQEIFRMTPHEKQVMMFSAT  226 (387)
T ss_pred             CCCHHHHHHHHHCCCCHHHCCEEEHHHHHHHHHHH--HHHHHHHHHHHCCCCCCEEEEEEEE
T ss_conf             68288999987245753203211233377899987--8888799986328653203454201


No 149
>KOG0951 consensus
Probab=98.25  E-value=8.3e-05  Score=47.35  Aligned_cols=105  Identities=22%  Similarity=0.252  Sum_probs=70.9

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHH----HHHHHHHHHCCCCCCEEEEEECCHHHHHHHHC
Q ss_conf             79809995889986899999999999759994999916046569----99999998558888159998589789888730
Q gi|255764515|r   17 HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS----VWTSEVQRWSNFSHMNISVITGTVKQRTKVLK   92 (458)
Q Consensus        17 ~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~----~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~   92 (458)
                      |.+.+++.+.|+|||++|=-++  +......++..++|...+..    -|..   +|....++.+..++|...-..+. .
T Consensus      1159 nd~v~vga~~gsgkt~~ae~a~--l~~~~~~~~vyi~p~~~i~~~~~~~w~~---~f~~~~G~~~~~l~ge~s~dlkl-~ 1232 (1674)
T KOG0951        1159 NDNVLVGAPNGSGKTACAELAL--LRPDTIGRAVYIAPLEEIADEQYRDWEK---KFSKLLGLRIVKLTGETSLDLKL-L 1232 (1674)
T ss_pred             CCEEEEECCCCCCHHHHHHHHH--CCCCCCEEEEEECCHHHHHHHHHHHHHH---HHCCCCCCEEEECCCCCCCCHHH-H
T ss_conf             6618994578873448899986--2886632799843668999999999987---53104580688517865525677-6


Q ss_pred             CCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCC
Q ss_conf             779869980642023344200011322044045310024
Q gi|255764515|r   93 TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKS  131 (458)
Q Consensus        93 ~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn  131 (458)
                      ...+++|.+.+....+.    ....-++.|+||.|.+..
T Consensus      1233 ~~~~vii~tpe~~d~lq----~iQ~v~l~i~d~lh~igg 1267 (1674)
T KOG0951        1233 QKGQVIISTPEQWDLLQ----SIQQVDLFIVDELHLIGG 1267 (1674)
T ss_pred             HHCCEEEECHHHHHHHH----HHHHCCEEEEEHHHHHCC
T ss_conf             42455886635777775----543211686102344146


No 150
>KOG0922 consensus
Probab=98.20  E-value=6.2e-06  Score=54.21  Aligned_cols=158  Identities=15%  Similarity=0.173  Sum_probs=73.8

Q ss_pred             HHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCC---CCCEEEEECCHHHHHHHH-HHHHHHCCCCC--CEEEEEECC
Q ss_conf             999999679809995889986899999999999759---994999916046569999-99998558888--159998589
Q gi|255764515|r   10 IVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG---EKSVLVIAPLRVAQSVWT-SEVQRWSNFSH--MNISVITGT   83 (458)
Q Consensus        10 ~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~---~~~~LIv~P~~l~~~~W~-~Ei~kf~~~~~--~~~~~~~g~   83 (458)
                      .+..+.++.-.++..|+|+|||=|.=   .+|...|   .+.+-+.=|..+..-.-. +-.+......+  ..+.+-..+
T Consensus        59 il~~ve~nqvlIviGeTGsGKSTQip---QyL~eaG~~~~g~I~~TQPRRVAavslA~RVAeE~~~~lG~~VGY~IRFed  135 (674)
T KOG0922          59 ILYAVEDNQVLIVIGETGSGKSTQIP---QYLAEAGFASSGKIACTQPRRVAAVSLAKRVAEEMGCQLGEEVGYTIRFED  135 (674)
T ss_pred             HHHHHHHCCEEEEECCCCCCCCCCHH---HHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHHHHCCCCCCEEEEEEEECC
T ss_conf             99999878779998489898533276---999862656688277506716778889999999858976762226998456


Q ss_pred             HHHHHHHHCCCCCEEEECCCCHHHHHHHCC---CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-C-CEEEEEC
Q ss_conf             789888730779869980642023344200---0113220440453100246543115677776654305-9-8079965
Q gi|255764515|r   84 VKQRTKVLKTPAVLYVINFENLGWLVQELK---GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-S-ERFIELT  158 (458)
Q Consensus        84 ~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~-~~~l~LT  158 (458)
                      ...      ....+..+|-..   +.++..   ...+|+.||+||||.    ++-.+.-....+.++..+ . -+++++|
T Consensus       136 ~ts------~~TrikymTDG~---LLRE~l~Dp~LskYsvIIlDEAHE----Rsl~TDiLlGlLKki~~~R~~LklIimS  202 (674)
T KOG0922         136 STS------KDTRIKYMTDGM---LLREILKDPLLSKYSVIILDEAHE----RSLHTDILLGLLKKILKKRPDLKLIIMS  202 (674)
T ss_pred             CCC------CCEEEEEECCHH---HHHHHHCCCCCCCCCEEEEECHHH----HHHHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             678------733699961359---999885087645444899832231----0157889999999987327783699992


Q ss_pred             CCCHHHHCCCHHHHHHHCC-CCCCCC
Q ss_conf             8402310010134677517-888775
Q gi|255764515|r  159 GTPSPNGLIDLWGQIWFLD-KGKRLG  183 (458)
Q Consensus       159 gTPi~n~~~el~~ll~~l~-~~~~l~  183 (458)
                      ||-=....+++|+.+..+. ||..++
T Consensus       203 ATlda~kfS~yF~~a~i~~i~GR~fP  228 (674)
T KOG0922         203 ATLDAEKFSEYFNNAPILTIPGRTFP  228 (674)
T ss_pred             EEECHHHHHHHHCCCCEEEECCCCCC
T ss_conf             35248999998647956766688775


No 151
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]
Probab=98.19  E-value=0.00024  Score=44.59  Aligned_cols=143  Identities=18%  Similarity=0.283  Sum_probs=78.2

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHH---HHHHHHHHHHHHCCCCCCEEE
Q ss_conf             87478999999999679809995889986899999999999759994999916046---569999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRV---AQSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l---~~~~W~~Ei~kf~~~~~~~~~   78 (458)
                      -++||-.+-+.-+.-+.+.+.-+-+|=|||++|... .++..-..+++.||+..--   ....|...+-.|..   +.+.
T Consensus        78 g~r~~dVQliG~i~lh~g~iaEM~TGEGKTL~atlp-~ylnaL~gkgVhvVTvNdYLA~RDae~m~~l~~~LG---LsvG  153 (822)
T COG0653          78 GMRHFDVQLLGGIVLHLGDIAEMRTGEGKTLVATLP-AYLNALAGKGVHVVTVNDYLARRDAEWMGPLYEFLG---LSVG  153 (822)
T ss_pred             CCCHHHHHHHHCHHHCCCCEEEEECCCCHHHHHHHH-HHHHHCCCCCCEEEEEHHHHHHHCHHHHHHHHHHCC---CCEE
T ss_conf             897236999612352378144554377359998899-999723899748950048774428999899998768---8232


Q ss_pred             EEE--CCHHHHHHHHCCCCCEEEECCCC---H--HHHH------HHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             985--89789888730779869980642---0--2334------420001132204404531002465431156777766
Q gi|255764515|r   79 VIT--GTVKQRTKVLKTPAVLYVINFEN---L--GWLV------QELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA  145 (458)
Q Consensus        79 ~~~--g~~~~r~~~~~~~~~i~i~s~e~---~--~~~~------~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~  145 (458)
                      +..  -++..+...+..+     ++|.+   +  ..+.      .+-....+....|+||+-.+                
T Consensus       154 ~~~~~m~~~ek~~aY~~D-----ItY~TnnElGFDYLRDNm~~~~ee~vqr~~~faIvDEvDSI----------------  212 (822)
T COG0653         154 VILAGMSPEEKRAAYACD-----ITYGTNNELGFDYLRDNMVTSQEEKVQRGLNFAIVDEVDSI----------------  212 (822)
T ss_pred             ECCCCCCHHHHHHHHHCC-----CEECCCCCCCCCHHHHHHHCCHHHHHHCCCCEEEECCHHHE----------------
T ss_conf             235889867868887337-----54305500175522214320587755036883887551440----------------


Q ss_pred             HHHHCCCEEEEECCCCHHHHCCCHHHH
Q ss_conf             543059807996584023100101346
Q gi|255764515|r  146 KPAWESERFIELTGTPSPNGLIDLWGQ  172 (458)
Q Consensus       146 ~~~~~~~~~l~LTgTPi~n~~~el~~l  172 (458)
                       +...+.--+.+|| |...+ .++|..
T Consensus       213 -LIDEARtPLiISG-~~~~~-~~~Y~~  236 (822)
T COG0653         213 -LIDEARTPLIISG-PAEDS-SELYKK  236 (822)
T ss_pred             -EEECCCCCEEEEC-CCCCC-CHHHHH
T ss_conf             -0000366523216-66567-259999


No 152
>pfam09848 DUF2075 Uncharacterized conserved protein (DUF2075). This domain, found in various prokaryotic proteins (including putative ATP/GTP binding proteins), has no known function.
Probab=98.12  E-value=1.6e-05  Score=51.76  Aligned_cols=90  Identities=17%  Similarity=0.185  Sum_probs=46.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEE
Q ss_conf             09995889986899999999999759-99499991604656999999998558888159998589789888730779869
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWG-EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLY   98 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~-~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~   98 (458)
                      +++-.++|+|||+.++.++..+.... ......+.+..-..+.-++.+.+-.  +...           ...+.... -+
T Consensus         4 ~~V~G~pGtGKTvv~l~l~~~l~~~~~~~~~~~l~~N~~~~~~l~~~l~~~~--~~~~-----------~~~~~~~~-~f   69 (348)
T pfam09848         4 FLVTGGPGTGKTVVALNLFAELSDSDLGRTAVFLSGNHPLVLVLYEALAGDL--KVRK-----------KKLFRKPT-SF   69 (348)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHHC--CHHH-----------CCCCCCCH-HH
T ss_conf             9997779938999999999998644026820899578669999999986041--2001-----------02000725-23


Q ss_pred             EECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCC
Q ss_conf             9806420233442000113220440453100246
Q gi|255764515|r   99 VINFENLGWLVQELKGTWPFATIVVDESTKLKSF  132 (458)
Q Consensus        99 i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~  132 (458)
                      |-+.+         ....+++.+|+||||++.+.
T Consensus        70 i~~~~---------~~~~~~dvvivDEAhRl~~k   94 (348)
T pfam09848        70 INNLH---------KAPPHEDVVIVDEAHRLWTK   94 (348)
T ss_pred             HCCCC---------CCCCCCCEEEEEHHHHHHHC
T ss_conf             16523---------57986778998317866543


No 153
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf4 (CRISPR/cas Subtype as in A. ferrooxidans protein 1), as it lies farthest (fourth closest) from the repeats in the A. ferrooxidans genome.
Probab=98.03  E-value=0.00023  Score=44.68  Aligned_cols=84  Identities=15%  Similarity=0.197  Sum_probs=53.9

Q ss_pred             CCHHHHHHCCCCCEEEEHHHHHHHH---HHHHHC-----CCCC--CC-HHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCC
Q ss_conf             3256654124884034222367888---664100-----0265--33-44589987642458855899844221116220
Q gi|255764515|r  310 KALEVIIEKANAAPIIVAYHFNSDL---ARLQKA-----FPQG--RT-LDKDPCTIQEWNEGKIPLLFAHPASCGHGLNL  378 (458)
Q Consensus       310 ~~l~~il~~~~~~kviif~~~~~~~---~~i~~~-----~~~g--~~-~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL  378 (458)
                      +.+..+++...|+-.+.|+.+..+.   +.+...     +.+|  .+ ..-+...++.|++++..||+++ .+.-||+|+
T Consensus       460 ~~l~~li~~~~Gr~LvLFTS~r~~~~~ae~l~~~l~~~~l~Qge~~~~~~l~~~~~~~f~~~~~svLfGT-~SfWEGVDv  538 (636)
T TIGR03117       460 LSTAAILRKAQGGTLVLTTAFSHISAIGQLVELGIPAEIVIQSEKNRLASAEQQFLALYANGIQPVLIAA-GGAWTGIDL  538 (636)
T ss_pred             HHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCEEEEC-CCCCCCCCC
T ss_conf             9999999870798899704099999999999722788658745764035689999998727899689867-764066257


Q ss_pred             CCC---------CCEEEEECCCCCH
Q ss_conf             017---------8599990899898
Q gi|255764515|r  379 QYG---------GNILVFFSLWWDL  394 (458)
Q Consensus       379 ~~a---------~~~iI~~~~~wn~  394 (458)
                      +..         .+.||..-+|+-+
T Consensus       539 pG~~~~~~~Gd~Ls~VII~rLPF~~  563 (636)
T TIGR03117       539 THKPVSPDKDNLLTDLIITCAPFGL  563 (636)
T ss_pred             CCCCCCCCCCCCCEEEEEECCCCCC
T ss_conf             8866678877742066575699899


No 154
>TIGR00595 priA primosomal protein N'; InterPro: IPR005259    All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.; GO: 0003677 DNA binding, 0006260 DNA replication.
Probab=98.00  E-value=0.0001  Score=46.85  Aligned_cols=138  Identities=18%  Similarity=0.136  Sum_probs=78.5

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE-ECCHHHHHHHHC----CCC
Q ss_conf             999588998689999999999975999499991604656999999998558888159998-589789888730----779
Q gi|255764515|r   21 AIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI-TGTVKQRTKVLK----TPA   95 (458)
Q Consensus        21 ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~-~g~~~~r~~~~~----~~~   95 (458)
                      ++...+|+|||=.-+.+++.....| +.+|+++|.--+..||.+.+.........-++.- . +...+...|.    ...
T Consensus         1 ll~G~tGsGkte~y~~~~~~~l~~g-~~~~~l~Pei~l~~q~~~~~~~~fg~~~~~~h~~~l-~~~~~~~~w~~~~~g~~   78 (524)
T TIGR00595         1 LLFGVTGSGKTEVYLQAIEKVLALG-KSALVLVPEIALTPQTLQRFKGRFGSQVAVLHSGKL-SDSEKLDAWRKVKLGEA   78 (524)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHHHHHHCCCHHHHCCCCC-CCHHHHHHHHHHHCCCC
T ss_conf             9545678861688899999997337-717897042110167899999971872010100136-73456889999851860


Q ss_pred             CEEEECCCCHHHHHHHCCCCCCCCEEECCCCCC--CCCCCC-CCHHHHHHHHHHHHHCCCEEEEECCCCHHHHC
Q ss_conf             869980642023344200011322044045310--024654-31156777766543059807996584023100
Q gi|255764515|r   96 VLYVINFENLGWLVQELKGTWPFATIVVDESTK--LKSFRL-RQGSKTARALAKPAWESERFIELTGTPSPNGL  166 (458)
Q Consensus        96 ~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~--lkn~~~-~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~  166 (458)
                      .++|-+...+      +....+..++|+||-|-  +|.... ..+..+--++........-.++-||||..++.
T Consensus        79 ~~v~G~rsa~------f~P~~~lglii~deehd~~yk~~~~~p~y~ar~~~~~~~~~~~~p~~lgsatP~le~~  146 (524)
T TIGR00595        79 LVVIGTRSAL------FLPLKNLGLIIVDEEHDSSYKQEELPPRYHARDVAVYRAKLFNCPVVLGSATPSLESY  146 (524)
T ss_pred             EEEECCCHHH------HCCCCCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEECCCCCCHHHH
T ss_conf             0564030343------2462114547873464521001368855206788988764048857880567227899


No 155
>PRK12899 secA preprotein translocase subunit SecA; Reviewed
Probab=97.94  E-value=0.0014  Score=40.01  Aligned_cols=123  Identities=20%  Similarity=0.347  Sum_probs=69.3

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160465---69999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~~   78 (458)
                      +|+||-.+-+--+.-+.+.+--+.+|=|||++|... .+|..-..+++-||+..--+   -..|..-+-.|+   ++.+.
T Consensus        92 ~mrhydVQliGgivLh~G~IAEM~TGEGKTLvAtlp-ayLnAL~GkgVHVVTVNDYLA~RDaewMg~iy~fL---GLtVg  167 (969)
T PRK12899         92 DMVPYDVQILGAIAMHKGFITEMQTGEGKTLTAVMP-LYLNALTGKPVHLVTVNDYLAQRDCEWVGSVLRWL---GLTTG  167 (969)
T ss_pred             CCCCCCHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCCEEECCCHHHHHHHHHHHHHHHHHH---CCEEE
T ss_conf             777651799989998268413551788489999999-99986459970997264365686699999999980---97785


Q ss_pred             EEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHH-------CCCCCCCCEEECCCCCCC
Q ss_conf             9858--9789888730779869980642-0233442-------000113220440453100
Q gi|255764515|r   79 VITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQE-------LKGTWPFATIVVDESTKL  129 (458)
Q Consensus        79 ~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~-------~~~~~~~~~iIiDEaH~l  129 (458)
                      ++..  ++..|...+..+ ..+.++.|. |..+.+.       ..-..++...||||+-.+
T Consensus       168 ~i~~~~~~~eRr~aY~~D-ItYgTn~E~GFDYLRDN~~a~~~~~~vqR~~~faIVDEvDSI  227 (969)
T PRK12899        168 VLVSGSPLEKRKAIYQCD-VVYGTASEFGFDYLRDNSIATRKEEQVGRGFYFAIIDEVDSI  227 (969)
T ss_pred             EECCCCCHHHHHHHHCCC-CEEECCCCCCCCCCCCCCCCCCHHHHHCCCCCEEEEECCCCE
T ss_conf             638998989999986699-678788666764013764426867751777744675233120


No 156
>pfam02399 Herpes_ori_bp Origin of replication binding protein. This Pfam family represents the herpesvirus origin of replication binding protein, probably involved in DNA replication.
Probab=97.90  E-value=0.00012  Score=46.49  Aligned_cols=133  Identities=19%  Similarity=0.247  Sum_probs=72.4

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEE-ECCHHHHHHHHHH-HHHHCCCCCCEEEEEECCHHHHHHHHCCCCCE
Q ss_conf             099958899868999999999997599949999-1604656999999-99855888815999858978988873077986
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVI-APLRVAQSVWTSE-VQRWSNFSHMNISVITGTVKQRTKVLKTPAVL   97 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv-~P~~l~~~~W~~E-i~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i   97 (458)
                      .++=.+||+|||=--|..+..........+||| |-.|     +..+ +.+|....-.....+..+... . +-...+.-
T Consensus        52 ~VVRAPMGSGKTTALi~wL~~~L~~~d~SvLVVSCRRS-----FT~tL~~Rf~~aGL~gFvtY~~s~~y-i-m~~~~f~R  124 (829)
T pfam02399        52 LVVRAPMGSGKTTALIEWLRAALDSPDTSVLVVSCRRS-----FTQTLLDRFNDAGLTGFVTYLDSTDY-V-MNGRPFRR  124 (829)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEECHHH-----HHHHHHHHHHHCCCCCCEEEEECCCE-E-ECCCCCCE
T ss_conf             89976888871899999999973786654999970167-----89999999986698651357504434-7-67875323


Q ss_pred             EEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCC----CCCCCHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             9980642023344200011322044045310024----654311567777665430598079965840
Q gi|255764515|r   98 YVINFENLGWLVQELKGTWPFATIVVDESTKLKS----FRLRQGSKTARALAKPAWESERFIELTGTP  161 (458)
Q Consensus        98 ~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn----~~~~~~s~~~~~l~~~~~~~~~~l~LTgTP  161 (458)
                      .++-.|++.+....+..+  ||.+|+||.-..-+    +.-.+-.+.-..+..+-.+++++++|-||-
T Consensus       125 LiVQiESLHRV~~~ll~~--YDvLILDEVMSti~QlySpTM~~L~~VDall~~LLr~CprIIAMDAT~  190 (829)
T pfam02399       125 LIVQIESLHRVDENLLNN--YDVLILDEVMSTIGQLYSPTMRRLKEVDALLLRLLRNCPRIIAMDATV  190 (829)
T ss_pred             EEEEEECCCCCCHHHCCC--CCEEEEHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHCCCCEEEECCHH
T ss_conf             688851111388334256--677985778888887606888999999999999985498279840204


No 157
>KOG1805 consensus
Probab=97.74  E-value=0.00045  Score=42.90  Aligned_cols=122  Identities=17%  Similarity=0.215  Sum_probs=63.1

Q ss_pred             CCCHHHHHHHHHHHHCC-CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEE---
Q ss_conf             87478999999999679-80999588998689999999999975999499991604656999999998558888159---
Q gi|255764515|r    2 NLAPHQTKIVDWILDHK-RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI---   77 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~-~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~---   77 (458)
                      .|..-|.+|+.+.+.-. +.++..=||+|||-+...++..|...| +++|..+=++...+.----+..|. .+.++.   
T Consensus       669 ~LN~dQr~A~~k~L~aedy~LI~GMPGTGKTTtI~~LIkiL~~~g-kkVLLtsyThsAVDNILiKL~~~~-i~~lRLG~~  746 (1100)
T KOG1805         669 RLNNDQRQALLKALAAEDYALILGMPGTGKTTTISLLIKILVALG-KKVLLTSYTHSAVDNILIKLKGFG-IYILRLGSE  746 (1100)
T ss_pred             HCCHHHHHHHHHHHHCCCHHEEECCCCCCCHHHHHHHHHHHHHCC-CEEEEEEHHHHHHHHHHHHHHCCC-CCEEECCCC
T ss_conf             318899999999873033220326998981225999999999738-818998505678899999875067-110344872


Q ss_pred             EEEECCHHH--------------HHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCC
Q ss_conf             998589789--------------8887307798699806420233442000113220440453100
Q gi|255764515|r   78 SVITGTVKQ--------------RTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g~~~~--------------r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~l  129 (458)
                      ..++..-++              ..+.+++ -.|+.+|--.+.   .-++....||.+|+|||-.+
T Consensus       747 ~kih~~v~e~~~~~~~s~ks~~~l~~~~~~-~~IVa~TClgi~---~plf~~R~FD~cIiDEASQI  808 (1100)
T KOG1805         747 EKIHPDVEEFTLTNETSEKSYADLKKFLDQ-TSIVACTCLGIN---HPLFVNRQFDYCIIDEASQI  808 (1100)
T ss_pred             CCCCHHHHHHHCCCCCCHHHHHHHHHHHCC-CCEEEEECCCCC---CHHHHCCCCCEEEECCCCCC
T ss_conf             224468998712344545339999997289-767999715788---65552142678998651111


No 158
>PRK12901 secA preprotein translocase subunit SecA; Reviewed
Probab=97.72  E-value=0.0032  Score=37.75  Aligned_cols=123  Identities=16%  Similarity=0.245  Sum_probs=68.9

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEEE
Q ss_conf             874789999999996798099958899868999999999997599949999160465---69999999985588881599
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNIS   78 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~~   78 (458)
                      .|+||-.+-+--+.-+.+.+--+.+|=|||++|... .+|..-..+++-||+..--+   -..|...+-+|+   ++.|.
T Consensus       169 gm~hydVQliGg~~Lh~G~IAEM~TGEGKTLvatlp-~yLnAL~GkgVHvVTvNDYLA~RDaewmg~iy~fL---Gltvg  244 (1111)
T PRK12901        169 DMVHYDVQLIGGVVLHKGKIAEMATGEGKTLVATLP-VFLNALTGNGVHVVTVNDYLAKRDSEWMGPLYMFH---GLSVD  244 (1111)
T ss_pred             CCCCCCHHHHHHHHHHCCCEEEEECCCCHHHHHHHH-HHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHH---CCEEE
T ss_conf             885655799879998268515650688579999999-99997369980898315677887599889999994---98652


Q ss_pred             EEE--C-CHHHHHHHHCCCCCEEEECCCC-HHHHHHHC------CCCCCCCEEECCCCCCC
Q ss_conf             985--8-9789888730779869980642-02334420------00113220440453100
Q gi|255764515|r   79 VIT--G-TVKQRTKVLKTPAVLYVINFEN-LGWLVQEL------KGTWPFATIVVDESTKL  129 (458)
Q Consensus        79 ~~~--g-~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~~------~~~~~~~~iIiDEaH~l  129 (458)
                      ++.  . ++..|...+..+ ..+.||.+. |..+.+.+      .-..++...||||+-.+
T Consensus       245 ~i~~~~~~~~~rr~aY~~D-ItYgTn~EfGFDYLRDnm~~~~~~~vqr~~~~aIVDEvDSI  304 (1111)
T PRK12901        245 CIDKHQPNSDARRKAYEAD-ITYGTNNEFGFDYLRDNMAVSPKDLVQRKHNYAIVDEVDSV  304 (1111)
T ss_pred             EECCCCCCHHHHHHHHHCC-CEECCCCCCCHHHHHHHCCCCHHHHCCCCCCEEEEECHHHH
T ss_conf             3269999979999987378-63415654102435640157878725677765888423666


No 159
>PRK10919 ATP-dependent DNA helicase Rep; Provisional
Probab=97.70  E-value=7.4e-05  Score=47.68  Aligned_cols=54  Identities=24%  Similarity=0.405  Sum_probs=42.9

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHC-CCC--CEEEEECCH
Q ss_conf             98747899999999967980999588998689999999999975-999--499991604
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLW-GEK--SVLVIAPLR   56 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~-~~~--~~LIv~P~~   56 (458)
                      |+|.|.|.+||.+.  .+.+++.+.+|+|||-+...-+.+|... +..  .+|+|+=+.
T Consensus         1 M~Ln~~Q~~AV~~~--~gp~lVlAGaGSGKT~tLt~Ria~Li~~~~v~P~~ILalTFT~   57 (672)
T PRK10919          1 MRLNPGQQQAVEFV--TGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTN   57 (672)
T ss_pred             CCCCHHHHHHHCCC--CCCEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCHH
T ss_conf             99998999998399--9998999738558799999999999866898933385442179


No 160
>TIGR00963 secA preprotein translocase, SecA subunit; InterPro: IPR000185   Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component. . From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins. The translocase protein subunits are encoded on the bacterial chromosome.     The translocase itself comprises 7 proteins, including a chaperone protein (SecB), an ATPase (SecA), an integral membrane complex (SecCY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) . The chaperone protein SecB  is a highly acidic homotetrameric protein that exists as a "dimer of dimers" in the bacterial cytoplasm. SecB maintains preproteins in an unfolded state after translation, and targets these to the peripheral membrane protein ATPase SecA for secretion .   SecA is a cytoplasmic protein of 800 to 960 amino acid residues. Homologs of secA are also encoded in the chloroplast genome of some algae  as well as in the nuclear genome of plants . It could be involved in the intraorganellar protein transport into thylakoids.; GO: 0005524 ATP binding, 0006605 protein targeting, 0006886 intracellular protein transport.
Probab=97.69  E-value=0.0019  Score=39.07  Aligned_cols=124  Identities=22%  Similarity=0.369  Sum_probs=76.7

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCH---HHHHHHHHHHHHHCCCCCCEE
Q ss_conf             98747899999999967980999588998689999999999975999499991604---656999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLR---VAQSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~---l~~~~W~~Ei~kf~~~~~~~~   77 (458)
                      +.|+||-.+-+--+.=|.+.+-=+=||=||||+|... ++|+.=..++|=||+=.=   ---..|...+-+|+   ++.|
T Consensus        57 lG~r~fDVQliGg~~LH~G~IAEMkTGEGKTL~AtLp-aYLNAL~GkGVHvVTVNdYLA~RD~e~m~~v~~FL---GL~V  132 (904)
T TIGR00963        57 LGLRPFDVQLIGGIVLHKGKIAEMKTGEGKTLVATLP-AYLNALTGKGVHVVTVNDYLARRDAEWMGQVYRFL---GLSV  132 (904)
T ss_pred             HCCCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHC---CCEE
T ss_conf             3785618999999998089667831488628999999-99876517962799635044488899878999684---9368


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHHC------CCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-02334420------00113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQEL------KGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~~------~~~~~~~~iIiDEaH~l  129 (458)
                      .++..  ++.+|...+..+ ..+.||-|. |..+.+..      .-..+|...||||.=.+
T Consensus       133 Gl~~~~m~~~eRr~aY~cD-ITY~TNnELGFDYLRDNM~~~~ee~vqR~f~FAIIDEVDSI  192 (904)
T TIGR00963       133 GLILSSMSPEERREAYACD-ITYGTNNELGFDYLRDNMALSKEEKVQRPFNFAIIDEVDSI  192 (904)
T ss_pred             EEECCCCCHHHHHHHHCCC-EEEECCCCCCHHHHHHHHHCCHHHHHCCCCCCEEEEEECCE
T ss_conf             8861799858999985498-16532654202466676411501210167222688642446


No 161
>pfam05621 TniB Bacterial TniB protein. This family consists of several bacterial TniB NTP-binding proteins. TniB is a probable ATP-binding protein which is involved in Tn5053 mercury resistance transposition.
Probab=97.69  E-value=0.0012  Score=40.23  Aligned_cols=121  Identities=14%  Similarity=-0.003  Sum_probs=63.3

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHC------CCCCEEEE-ECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHH
Q ss_conf             980999588998689999999999975------99949999-16046569999999985588881599985897898887
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLW------GEKSVLVI-APLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKV   90 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~------~~~~~LIv-~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~   90 (458)
                      ++.+|..|.|-|||..+=-+... +-.      ...|+++| +|.+.-+...+..|-.-...|...    +++.....  
T Consensus        62 p~lLlvGdsnnGKT~Iv~rF~~~-hp~~~d~~~~~~PVl~vq~P~~p~~~~lY~~IL~~l~aP~~~----~~~~~~~~--  134 (302)
T pfam05621        62 PNLLLVGPTNNGKSMIVEKFRRA-HPAGSDADQEHIPVLVVQMPSEPSVIRFYVALLAAMGAPLRP----RPRLPEME--  134 (302)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHH-CCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCC----CCCHHHHH--
T ss_conf             75588707988789999999996-799878666702189997699988689999999983787788----87789999--


Q ss_pred             HCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             30779869980642023344200011322044045310024654311567777665430598079965840
Q gi|255764515|r   91 LKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTP  161 (458)
Q Consensus        91 ~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTP  161 (458)
                                      .....++....-.++||||.|++-......-.....++..++...+--+.+-||+
T Consensus       135 ----------------~~~~~ll~~~~vrmLIIDEiHnlL~Gs~~~qr~~ln~LK~L~Nel~IpiV~vGt~  189 (302)
T pfam05621       135 ----------------QLALALLRKVGVRMLVIDELHNVLAGNSVNRREFLNLLRFLGNELRIPLVGVGTR  189 (302)
T ss_pred             ----------------HHHHHHHHHCCCCEEEEECHHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCH
T ss_conf             ----------------9999999974987899854365604868899999999999863658786995319


No 162
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=97.68  E-value=0.0005  Score=42.64  Aligned_cols=31  Identities=23%  Similarity=0.395  Sum_probs=18.8

Q ss_pred             HHHHHHCCC--EEEEECCCCCHHHHHHHHHHHH
Q ss_conf             999996798--0999588998689999999999
Q gi|255764515|r   11 VDWILDHKR--CAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        11 v~~~~~~~~--~ll~~~~G~GKT~~al~~~~~l   41 (458)
                      +.+.+..++  +++..|+|+|||...=.++..+
T Consensus        35 L~~~l~~~~g~~lltGe~GtGKTtllr~l~~~l   67 (269)
T TIGR03015        35 LEYGLSQREGFILITGEVGAGKTTLIRNLLKRL   67 (269)
T ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             999996489659997299898899999999845


No 163
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]
Probab=97.68  E-value=0.00012  Score=46.36  Aligned_cols=174  Identities=23%  Similarity=0.221  Sum_probs=83.7

Q ss_pred             CCCHHHHHHHHH-HHH-CCCEEEEECCCCC--HHHHHHHHHHHHHHCC-CCCEEEEECCHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             874789999999-996-7980999588998--6899999999999759-9949999160465699999999855888815
Q gi|255764515|r    2 NLAPHQTKIVDW-ILD-HKRCAIWASMGSG--KTVSVLTALSYIHLWG-EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN   76 (458)
Q Consensus         2 ~L~p~Q~~~v~~-~~~-~~~~ll~~~~G~G--KT~~al~~~~~l~~~~-~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~   76 (458)
                      .+.|+|...... +.. ..+..++++.|.|  ||+.+..........+ ..+.++++|..+. .+|..|...+...+.. 
T Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~e~~~~~~~~~~-  161 (866)
T COG0553          84 ILIPHQLDIALEVLNELALRVLIADEVGLGDLKTIEAGAILKELLLRGEIKRVLILVPKTLR-AQWVVELLEKFNIRLA-  161 (866)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHH-HHHHHHHHHHCCCCHH-
T ss_conf             21322036777766543034444310143333303332356666655543201103640245-5677877764155367-


Q ss_pred             EEEEECCHHHHHHHHCC-----CCCEEEECCCCHHHH---HHHCCCCCCC---CEEECCCCCCCCCCCC-----CCHHHH
Q ss_conf             99985897898887307-----798699806420233---4420001132---2044045310024654-----311567
Q gi|255764515|r   77 ISVITGTVKQRTKVLKT-----PAVLYVINFENLGWL---VQELKGTWPF---ATIVVDESTKLKSFRL-----RQGSKT  140 (458)
Q Consensus        77 ~~~~~g~~~~r~~~~~~-----~~~i~i~s~e~~~~~---~~~~~~~~~~---~~iIiDEaH~lkn~~~-----~~~s~~  140 (458)
                      +....+.. .....+..     .....+++.+.....   .........|   +++++||+|.+.+...     ......
T Consensus       162 ~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (866)
T COG0553         162 VLDKEGLR-YLLKQYDAYNPFSTEDLVLISLDLAKRSDSKRREALLEAEWGERDLLVIDEAHNLGSSEGTRKLAPLETLE  240 (866)
T ss_pred             HHHHHHHH-HHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCHHHHCCCCCCCCCCCHHHHHH
T ss_conf             77542224-44320122343222102444323676542000133202210023555405776412342111100245678


Q ss_pred             HHHHHHHHHCCC------EEEEECCCCHHHHCCCHHHHHHHCCC
Q ss_conf             777665430598------07996584023100101346775178
Q gi|255764515|r  141 ARALAKPAWESE------RFIELTGTPSPNGLIDLWGQIWFLDK  178 (458)
Q Consensus       141 ~~~l~~~~~~~~------~~l~LTgTPi~n~~~el~~ll~~l~~  178 (458)
                      .........+..      ....+++||......+.++...+.++
T Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  284 (866)
T COG0553         241 YELLKQLAEKIPSKLLDLKVLLLSATPEQLKEEDLFARLRLLDP  284 (866)
T ss_pred             HHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCC
T ss_conf             88866566404431122214441000433020000113201131


No 164
>KOG0920 consensus
Probab=97.65  E-value=0.001  Score=40.80  Aligned_cols=148  Identities=18%  Similarity=0.093  Sum_probs=67.4

Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHH-HHHHCCCCCEEEEE--CCH--HHH-HHHHHHHHHHCCCCC--C
Q ss_conf             478999999999679809995889986899999999-99975999499991--604--656-999999998558888--1
Q gi|255764515|r    4 APHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIA--PLR--VAQ-SVWTSEVQRWSNFSH--M   75 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~-~l~~~~~~~~LIv~--P~~--l~~-~~W~~Ei~kf~~~~~--~   75 (458)
                      +.++...++.+.++.-.++..++|.|||-|+--++. .....+ ...=|||  |..  .+. ..+.. -++. ...+  .
T Consensus       175 ~~~r~~Il~~i~~~qVvvIsGeTGcGKtTQvpQfiLd~~~~~~-~~~~IicTQPRRIsAIsvAeRVa-~ER~-~~~g~~V  251 (924)
T KOG0920         175 YKMRDTILDAIEENQVVVISGETGCGKTTQVPQFILDEAIESG-AACNIICTQPRRISAISVAERVA-KERG-ESLGEEV  251 (924)
T ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHHHHHHHHHCC-CCCEEEECCCCHHHHHHHHHHHH-HHHC-CCCCCEE
T ss_conf             7789999999974966999578898712246699999998628-99738866775177899999998-8754-6668713


Q ss_pred             EEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             59998589789888730779869980642023344200011322044045310024654311567777665430598079
Q gi|255764515|r   76 NISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFI  155 (458)
Q Consensus        76 ~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l  155 (458)
                      .+.+-......+      ...+..+|...+-..............||+||.|.= +..+.--=-..+.+.... ..-+++
T Consensus       252 GYqvrl~~~~s~------~t~L~fcTtGvLLr~L~~~~~l~~~thiivDEVHER-~i~~DflLi~lk~lL~~~-p~LkvI  323 (924)
T KOG0920         252 GYQVRLESKRSR------ETRLLFCTTGVLLRRLQSDPTLSGVTHIIVDEVHER-SINTDFLLILLKDLLPRN-PDLKVI  323 (924)
T ss_pred             EEEEEEECCCCC------CEEEEEECHHHHHHHHCCCCCCCCCCEEEEEEEEEC-CCCCCCHHHHHHHHHHHC-CCCEEE
T ss_conf             689862013677------516898406899987546862145866544227971-677521799999886228-885699


Q ss_pred             EECCCCH
Q ss_conf             9658402
Q gi|255764515|r  156 ELTGTPS  162 (458)
Q Consensus       156 ~LTgTPi  162 (458)
                      +||||--
T Consensus       324 LMSAT~d  330 (924)
T KOG0920         324 LMSATLD  330 (924)
T ss_pred             EEEEECC
T ss_conf             8621126


No 165
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IPR010222   This entry represents HrpA, one of two related but uncharacterised DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterised, is about 800 amino acids long. Related characterised eukaryotic proteins are RNA helicases associated with pre-mRNA processing.; GO: 0005524 ATP binding, 0008026 ATP-dependent helicase activity.
Probab=97.65  E-value=9.6e-05  Score=46.98  Aligned_cols=105  Identities=9%  Similarity=0.047  Sum_probs=60.6

Q ss_pred             CCCHHHHHHCCCC-----CEEEEHHHH----HHHHHHHHHCCCCC---------CCHHHHHHHHHHHCCCCCCEEEEEHH
Q ss_conf             3325665412488-----403422236----78886641000265---------33445899876424588558998442
Q gi|255764515|r  309 IKALEVIIEKANA-----APIIVAYHF----NSDLARLQKAFPQG---------RTLDKDPCTIQEWNEGKIPLLFAHPA  370 (458)
Q Consensus       309 ~~~l~~il~~~~~-----~kviif~~~----~~~~~~i~~~~~~g---------~~~~~r~~~i~~f~~~~~~vli~s~~  370 (458)
                      +++++++.++...     .-|+||-.-    ...++.|.+.-..+         -|..|+++   =|+.+..+.+|+||.
T Consensus       281 ~~AvdEL~~e~~~eGkGPGDiLIFlpGEREIRDaAE~L~k~~~rhtEIlPLYARLS~~EQ~R---vF~pHsGRRIVLaTN  357 (1320)
T TIGR01967       281 LAAVDELVAEGPDEGKGPGDILIFLPGEREIRDAAEILRKRNLRHTEILPLYARLSNKEQQR---VFQPHSGRRIVLATN  357 (1320)
T ss_pred             HHHHHHHHHCCCCCCCCCCCEEEECCCCCCHHHHHHHHHCCCCCCEEEECCHHHCCHHHCCC---CCCCCCCCEEEEECC
T ss_conf             99999997427555789972676378886368999998446878704405522158644744---006859623453301


Q ss_pred             HCCCCCCCCCCCCEEEEECCC--------------------CCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEEEECC
Q ss_conf             211162200178599990899--------------------898686445666620220203787752899998589
Q gi|255764515|r  371 SCGHGLNLQYGGNILVFFSLW--------------------WDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN  427 (458)
Q Consensus       371 ~~~~GlnL~~a~~~iI~~~~~--------------------wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~  427 (458)
                      ++.+.|+-. +-++||  |+-                    =|=+.-.||.|||     -|.+   +=.+++|-+++
T Consensus       358 VAETSLTVP-GI~YVI--DtGtARiSRYS~RTKVQRLPIEpISQASANQRkGRC-----GRV~---~GICIRLYSE~  423 (1320)
T TIGR01967       358 VAETSLTVP-GIRYVI--DTGTARISRYSYRTKVQRLPIEPISQASANQRKGRC-----GRVA---PGICIRLYSEE  423 (1320)
T ss_pred             HHHHHCCCC-CCCCEE--CCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCC-----CCCC---CCEEEECCCHH
T ss_conf             013305788-711135--688532000100330133676603122320068875-----4147---77047557757


No 166
>PRK12902 secA preprotein translocase subunit SecA; Reviewed
Probab=97.64  E-value=0.0017  Score=39.44  Aligned_cols=124  Identities=20%  Similarity=0.343  Sum_probs=71.3

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996798099958899868999999999997599949999160465---6999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA---QSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~---~~~W~~Ei~kf~~~~~~~~   77 (458)
                      |-|+||-.+-+--+.-+.+.+--+.+|=|||++|... .+|..-..+++-||+..--+   -..|...+-.|+   ++.|
T Consensus        82 lg~r~ydvQliGg~~Lh~G~iaEM~TGEGKTL~atlp-~ylnAL~GkgvHvvTvNdYLA~RDae~m~~vy~fL---Gltv  157 (946)
T PRK12902         82 LGMRHFDVQLIGGMVLHEGQIAEMKTGEGKTLVATLP-SYLNALTGKGVHVVTVNDYLARRDAEWMGQVHRFL---GLSV  157 (946)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHH-HHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHH---CCEE
T ss_conf             4897557999989998468413541788479999999-99986559970997265265686799999999981---9778


Q ss_pred             EEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHHC------CCCCCCCEEECCCCCCC
Q ss_conf             99858--9789888730779869980642-02334420------00113220440453100
Q gi|255764515|r   78 SVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQEL------KGTWPFATIVVDESTKL  129 (458)
Q Consensus        78 ~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~~------~~~~~~~~iIiDEaH~l  129 (458)
                      .++..  ++..|...+..+ ..+.+|.|. |..+.+..      .-..++...||||+-.+
T Consensus       158 g~i~~~~~~~er~~aY~~D-ItY~Tn~E~gFDYLRDnm~~~~~~~vqr~~~~aIvDEvDSi  217 (946)
T PRK12902        158 GLIQQDMSPEERKKNYACD-ITYATNSELGFDYLRDNMATDISEVVQRPFNYCVIDEVDSI  217 (946)
T ss_pred             EEECCCCCHHHHHHHHCCC-CEEECCCCCCCCCCCCCCCCCHHHHHCCCCCEEEEECHHHH
T ss_conf             3548998989999985898-27978887577235304478868843879965898542566


No 167
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345   These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. .
Probab=97.63  E-value=0.00034  Score=43.63  Aligned_cols=130  Identities=18%  Similarity=0.207  Sum_probs=70.9

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHH---HHH-----H----CCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             987478999999999679809995889986899999999---999-----7----5999499991604656999999998
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS---YIH-----L----WGEKSVLVIAPLRVAQSVWTSEVQR   68 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~---~l~-----~----~~~~~~LIv~P~~l~~~~W~~Ei~k   68 (458)
                      ++|-.-|.+|+..+.+++=.+|-..||+|||=+.=++++   .+.     .    ....+++.=||+.-.. -=-.|+  
T Consensus       349 ~~l~~~Qk~AL~~~~~~Kv~iLTGGPGTGKtT~t~~i~~~~~~~~gl~l~~~~~vndd~~v~LaAPTGrAA-kRl~E~--  425 (769)
T TIGR01448       349 LKLSEEQKEALKTAIQDKVVILTGGPGTGKTTITKAIIELYEELKGLDLDKDDYVNDDLPVVLAAPTGRAA-KRLAEV--  425 (769)
T ss_pred             CCHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCHHHH-HHCCCC--
T ss_conf             77068899999998609489985778886168999999999871687755312456776488737743788-851100--


Q ss_pred             HCCCCCCEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             55888815999858978988873077986998064202334420001132204404531002465431156777766543
Q gi|255764515|r   69 WSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA  148 (458)
Q Consensus        69 f~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~  148 (458)
                       |+.+...++-+-|.        ..         +. ....+.+....+.|+|||||+-.+      ..--..+.+..+.
T Consensus       426 -TG~~a~TIHRLlG~--------~~---------~~-~~~~k~~~~~~~~DL~IvDE~SM~------Dt~L~~~lL~a~P  480 (769)
T TIGR01448       426 -TGLEALTIHRLLGY--------GS---------DT-KSENKNLEDPIDADLLIVDESSMV------DTWLASSLLAAVP  480 (769)
T ss_pred             -CCCHHHHHHHHHCC--------CC---------CC-CCCCHHHCCCCCCCEEEEECCCHH------HHHHHHHHHHHCC
T ss_conf             -26212347786368--------98---------88-732110113478776998146218------8999999986179


Q ss_pred             HCCCEEEEECCC
Q ss_conf             059807996584
Q gi|255764515|r  149 WESERFIELTGT  160 (458)
Q Consensus       149 ~~~~~~l~LTgT  160 (458)
                      ..|  +++|=|=
T Consensus       481 ~~a--~lllVGD  490 (769)
T TIGR01448       481 DHA--RLLLVGD  490 (769)
T ss_pred             CCC--EEEEECC
T ss_conf             777--7988837


No 168
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=97.63  E-value=0.00015  Score=45.82  Aligned_cols=26  Identities=23%  Similarity=0.262  Sum_probs=20.9

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             98099958899868999999999997
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHL   43 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~   43 (458)
                      +..++..++|+|||-.|.+++..+.-
T Consensus        37 phlLf~GPpG~GKTt~A~~lA~~l~~   62 (337)
T PRK12402         37 PHLVVYGPSGSGKTAAVRALARELYG   62 (337)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             76988892984899999999999679


No 169
>PRK05707 DNA polymerase III subunit delta'; Validated
Probab=97.62  E-value=0.00055  Score=42.39  Aligned_cols=110  Identities=12%  Similarity=0.095  Sum_probs=62.2

Q ss_pred             CCCCHHHHHHHHHHHHCCC----EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             9874789999999996798----099958899868999999999997599949999160465699999999855888815
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKR----CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN   76 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~----~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~   76 (458)
                      ..|||||...-+.+.+.+|    .|+..+.|+||+-.|..++..+.=......   -|...     ...+.++....+.+
T Consensus         2 ~~~yPW~~~~w~~l~~~~rl~HA~Lf~G~~G~GK~~lA~~~A~~LlC~~~~~~---~~Cg~-----C~sC~~~~~~~HPD   73 (328)
T PRK05707          2 AEIYPWQQSLWQQLAGRGRHAHAYLLHGPAGIGKRALAERLAAFLLCEAPQGG---GACGS-----CKGCQLLAAGSHPD   73 (328)
T ss_pred             CCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCC---CCCCC-----CHHHHHHHCCCCCC
T ss_conf             86766748999999977982204644799986799999999999848999998---99988-----88999987589998


Q ss_pred             EEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCC---CCCCCEEECCCCCCC
Q ss_conf             99985897898887307798699806420233442000---113220440453100
Q gi|255764515|r   77 ISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG---TWPFATIVVDESTKL  129 (458)
Q Consensus        77 ~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~---~~~~~~iIiDEaH~l  129 (458)
                      ++.+.-....+           .+..+.++.+.+....   .-.|..+|||+||.+
T Consensus        74 ~~~i~pe~~~~-----------~I~IdqIR~l~~~~~~~~~~g~~KV~iI~~Ae~m  118 (328)
T PRK05707         74 NFVLEPEEADK-----------PIKVDQVRELVSFVVQTAQLGGRKVVLIEPAEAM  118 (328)
T ss_pred             EEEEECCCCCC-----------CCCHHHHHHHHHHHHHCCCCCCCEEEEEEHHHHH
T ss_conf             79984266677-----------6979999999999831766789579995028773


No 170
>KOG0924 consensus
Probab=97.59  E-value=0.00049  Score=42.70  Aligned_cols=143  Identities=20%  Similarity=0.172  Sum_probs=62.8

Q ss_pred             HHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCC-CCEEEEE--CCHHHHH----HHHHHHHHHCCCCCCEEEEEECCH
Q ss_conf             99996798099958899868999999999997599-9499991--6046569----999999985588881599985897
Q gi|255764515|r   12 DWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIA--PLRVAQS----VWTSEVQRWSNFSHMNISVITGTV   84 (458)
Q Consensus        12 ~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~-~~~LIv~--P~~l~~~----~W~~Ei~kf~~~~~~~~~~~~g~~   84 (458)
                      ..+.+|.-.++..|+|+|||-|   +..+|...|- ..-+|.|  |..+..-    --.+|..- .-...+.+.+-..+-
T Consensus       366 ~~ir~n~vvvivgETGSGKTTQ---l~QyL~edGY~~~GmIGcTQPRRvAAiSVAkrVa~EM~~-~lG~~VGYsIRFEdv  441 (1042)
T KOG0924         366 SVIRENQVVVIVGETGSGKTTQ---LAQYLYEDGYADNGMIGCTQPRRVAAISVAKRVAEEMGV-TLGDTVGYSIRFEDV  441 (1042)
T ss_pred             HHHHHCCEEEEEECCCCCCHHH---HHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHHHHCC-CCCCCCCEEEEEEEC
T ss_conf             9986385799993588985016---679998622455871543572278999999999998587-645311248885204


Q ss_pred             HHHHHHHCCCCCEEEECCCCHHHHHHHCC---CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH--HCCCEEEEECC
Q ss_conf             89888730779869980642023344200---01132204404531002465431156777766543--05980799658
Q gi|255764515|r   85 KQRTKVLKTPAVLYVINFENLGWLVQELK---GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA--WESERFIELTG  159 (458)
Q Consensus        85 ~~r~~~~~~~~~i~i~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~--~~~~~~l~LTg  159 (458)
                               ...-.++-|=+-.-+.++.+   ...+|..||+||||.=    +-...-.+..+..+-  ...-+.+..||
T Consensus       442 ---------T~~~T~IkymTDGiLLrEsL~d~~L~kYSviImDEAHER----slNtDilfGllk~~larRrdlKliVtSA  508 (1042)
T KOG0924         442 ---------TSEDTKIKYMTDGILLRESLKDRDLDKYSVIIMDEAHER----SLNTDILFGLLKKVLARRRDLKLIVTSA  508 (1042)
T ss_pred             ---------CCCCEEEEEECCCHHHHHHHHHHHHHHEEEEEECHHHHC----CCCHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             ---------787605787423057797763300444017885114330----3005899999999987422635997622


Q ss_pred             CCHHHHCCCHHH
Q ss_conf             402310010134
Q gi|255764515|r  160 TPSPNGLIDLWG  171 (458)
Q Consensus       160 TPi~n~~~el~~  171 (458)
                      |.-.....++|+
T Consensus       509 Tm~a~kf~nfFg  520 (1042)
T KOG0924         509 TMDAQKFSNFFG  520 (1042)
T ss_pred             CCCHHHHHHHHC
T ss_conf             024899988727


No 171
>KOG0989 consensus
Probab=97.58  E-value=0.00023  Score=44.67  Aligned_cols=38  Identities=18%  Similarity=0.280  Sum_probs=28.0

Q ss_pred             HHHHHHHHHHH------CCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             89999999996------798099958899868999999999997
Q gi|255764515|r    6 HQTKIVDWILD------HKRCAIWASMGSGKTVSVLTALSYIHL   43 (458)
Q Consensus         6 ~Q~~~v~~~~~------~~~~ll~~~~G~GKT~~al~~~~~l~~   43 (458)
                      .|...|..+.+      .+..|+..++|+|||-+|++++..|.-
T Consensus        40 gQe~vV~~L~~a~~~~~lp~~LFyGPpGTGKTStalafar~L~~   83 (346)
T KOG0989          40 GQEHVVQVLKNALLRRILPHYLFYGPPGTGKTSTALAFARALNC   83 (346)
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             15999999999986068860786689998676899999998557


No 172
>pfam05876 Terminase_GpA Phage terminase large subunit (GpA). This family consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities.
Probab=97.57  E-value=0.0011  Score=40.52  Aligned_cols=158  Identities=18%  Similarity=0.185  Sum_probs=86.7

Q ss_pred             CCCHHHHHHHHHHHHC--CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHH-HHH-HCCCCCCEE
Q ss_conf             8747899999999967--980999588998689999999999975999499991604656999999-998-558888159
Q gi|255764515|r    2 NLAPHQTKIVDWILDH--KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSE-VQR-WSNFSHMNI   77 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~--~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~E-i~k-f~~~~~~~~   77 (458)
                      +..|||.+..+.+-+.  ....+.-..-+|||-..+.++.+.......++|+|.|+.-....|.++ |.. +...|.+.-
T Consensus        16 ~~~Py~~eimd~l~~~~v~~V~~~k~aQ~GkT~~~~n~igy~i~~~P~p~l~v~Pt~~~a~~~s~~rl~Pmi~~sP~L~~   95 (552)
T pfam05876        16 DRTPYLREIMDALSPPSVERVVFMKSAQVGKTELLLNWIGYFIDHDPAPMLVVQPTDDDAKRFSKDRLDPMIRASPALRE   95 (552)
T ss_pred             CCCCHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHCCHHHHH
T ss_conf             88807699998548878449999957870388999999988663089887999418999999999989999861989997


Q ss_pred             EEEECCHH-----HHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-C
Q ss_conf             99858978-----98887307798699806420233442000113220440453100246543115677776654305-9
Q gi|255764515|r   78 SVITGTVK-----QRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-S  151 (458)
Q Consensus        78 ~~~~g~~~-----~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~  151 (458)
                      .+.....+     ...+.+.+ ..+.++.-.+...+     ...+...+++||.-.+-..-+..++-...+..+.... .
T Consensus        96 ~~~~~~~r~~~nt~~~K~f~g-g~l~~~ga~S~~~L-----~s~~~r~l~~DEvD~~~~~~~~eGdP~~La~~R~~tf~~  169 (552)
T pfam05876        96 RLAPARSRDSDNTLLSKRFPG-GSLLLIGANSPANL-----RSRPVRYVILDEVDAYPEDVDGEGDPISLAEKRTETFGS  169 (552)
T ss_pred             HHCCCCCCCCCCCEEEEEECC-CEEEEEECCCCHHH-----HCCCCCEEEECCHHHCCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             507555656677412476078-37999557996143-----048635588513443654567787989999999875302


Q ss_pred             CEEEEECCCCHHHH
Q ss_conf             80799658402310
Q gi|255764515|r  152 ERFIELTGTPSPNG  165 (458)
Q Consensus       152 ~~~l~LTgTPi~n~  165 (458)
                      .++++++.||..-.
T Consensus       170 ~~K~~~~STPt~~g  183 (552)
T pfam05876       170 RRKILAGSTPTIKG  183 (552)
T ss_pred             CCEEEEECCCCCCC
T ss_conf             85799983899999


No 173
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=97.53  E-value=0.0027  Score=38.16  Aligned_cols=25  Identities=20%  Similarity=0.198  Sum_probs=20.4

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9809995889986899999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIH   42 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~   42 (458)
                      +..++..++|+|||-.|.+++..+.
T Consensus        38 phlLf~GppG~GKTt~a~~la~~l~   62 (318)
T PRK00440         38 PHLLFAGPPGTGKTTAALALARELY   62 (318)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             6698889599889999999999976


No 174
>PRK05563 DNA polymerase III subunits gamma and tau; Validated
Probab=97.50  E-value=0.0012  Score=40.36  Aligned_cols=113  Identities=13%  Similarity=0.141  Sum_probs=58.4

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      .|+..+.|+|||-+|-.++..++-....   -.-|.+...+  ..+|   .....+++.-+.+.+....+.         
T Consensus        41 yLf~GprG~GKTs~Ari~akalnc~~~~---~~~pC~~C~~--C~~i---~~g~~~Dv~Eidaas~~gvd~---------  103 (541)
T PRK05563         41 YLFCGTRGTGKTSTAKIFAKAVNCLNPQ---DGEPCNECEI--CKKI---NEGLLMDVIEIDAASNNGVDD---------  103 (541)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCC---CCCCCCCCHH--HHHH---HCCCCCCEEEECCCCCCCHHH---------
T ss_conf             5303879958999999999995799988---8985751488--9998---568988736624444478899---------


Q ss_pred             ECCCCHHHHHHHC---CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEEECCCC
Q ss_conf             8064202334420---00113220440453100246543115677776654305-98079965840
Q gi|255764515|r  100 INFENLGWLVQEL---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFIELTGTP  161 (458)
Q Consensus       100 ~s~e~~~~~~~~~---~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l~LTgTP  161 (458)
                           ++.+.+..   -...+|...|+||+|.+.       ..++.++.+.-.. +.++++.-||.
T Consensus       104 -----iR~~~~~~~~~p~~~~~Kv~IiDEvhmls-------~~a~nallKtlEePp~~~~Filatt  157 (541)
T PRK05563        104 -----IREIIENVKYPPQEGKYKVYIMDEVHMLS-------QGAVNAFLKTLEEPPSNVIFILATT  157 (541)
T ss_pred             -----HHHHHHHCEECCCCCCEEEEEEECCCCCC-------HHHHHHHHHHHHCCCCCCEEEEECC
T ss_conf             -----99999761048767870599997723389-------9999999999854877756999769


No 175
>pfam07517 SecA_DEAD SecA DEAD-like domain. SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane. SecA protein achieves this translocation, in association with SecY protein, in an ATP dependent manner. This domain represents the N-terminal ATP-dependent helicase domain, which is related to the pfam00270.
Probab=97.48  E-value=0.0014  Score=39.92  Aligned_cols=122  Identities=19%  Similarity=0.254  Sum_probs=68.7

Q ss_pred             CCCCHH--HHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH---HHHHHHHHHHCCCCCC
Q ss_conf             987478--99999999967980999588998689999999999975999499991604656---9999999985588881
Q gi|255764515|r    1 MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ---SVWTSEVQRWSNFSHM   75 (458)
Q Consensus         1 ~~L~p~--Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~---~~W~~Ei~kf~~~~~~   75 (458)
                      +.|+||  |..+.--+  +.+.+.-+.+|=|||++|... .++..-..+++=||+...-+.   ..|...+-+|.   ++
T Consensus        74 lg~r~ydvQl~ggi~L--~~G~IaEM~TGEGKTL~atl~-a~l~AL~Gk~VhvvTvNdYLA~RDae~m~~vy~~L---GL  147 (381)
T pfam07517        74 LGMRHYDVQLIGGLVL--HEGKIAEMKTGEGKTLTATLP-AYLNALSGKGVHVVTVNDYLAKRDAEWMGPLYEFL---GL  147 (381)
T ss_pred             HCCCCCCHHHHHHHHH--CCCCEEEEECCCCCHHHHHHH-HHHHHCCCCCCEEEECCHHHHHHHHHHHHHHHHHH---CC
T ss_conf             4882452699989997--048725887699811999999-99997379974899758888688999979999984---86


Q ss_pred             EEEEEEC--CHHHHHHHHCCCCCEEEECCCC-HHHHHHHC------CCCCCCCEEECCCCCCC
Q ss_conf             5999858--9789888730779869980642-02334420------00113220440453100
Q gi|255764515|r   76 NISVITG--TVKQRTKVLKTPAVLYVINFEN-LGWLVQEL------KGTWPFATIVVDESTKL  129 (458)
Q Consensus        76 ~~~~~~g--~~~~r~~~~~~~~~i~i~s~e~-~~~~~~~~------~~~~~~~~iIiDEaH~l  129 (458)
                      .|.++..  ++..|...+..+ .++.++.+. +..+.+.+      .-..+++..||||+-.+
T Consensus       148 svg~i~~~~~~~err~aY~~D-ItYgTn~e~gFDYLRDnm~~~~~~~vqR~~~~aIVDEvDSi  209 (381)
T pfam07517       148 SVGVITSDMSPEERREAYNCD-ITYGTNSELGFDYLRDNMALSKEDKVQRGLNFAIVDEVDSI  209 (381)
T ss_pred             EEEECCCCCCHHHHHHHHHCC-CEECCHHHHHHHHHHHHHHCCHHHHCCCCCCEEEEECCCHH
T ss_conf             054227889848889875166-05503223214453234415825434577776999745112


No 176
>PRK05896 DNA polymerase III subunits gamma and tau; Validated
Probab=97.43  E-value=0.0026  Score=38.29  Aligned_cols=107  Identities=14%  Similarity=0.143  Sum_probs=51.9

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEE
Q ss_conf             099958899868999999999997-5999499991604656999999998558888159998589789888730779869
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHL-WGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLY   98 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~-~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~   98 (458)
                      .|+..+.|+|||-+|.+++..+.- .+...-    |.+.     ...+.......+.++..+........          
T Consensus        41 YLFsGPrGvGKTTlArifAkaLnC~~~~~~d----pCg~-----C~sC~~I~~g~h~DviEIdaasn~gI----------  101 (613)
T PRK05896         41 YIFSGPRGIGKTSIAKIFAKAINCLNPKDGD----CCNS-----CSVCESINTNQSVDIVELDAASNNGV----------  101 (613)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCC----CCCC-----CHHHHHHHCCCCCCEEEEECCCCCCH----------
T ss_conf             7755899848899999999996699999999----8888-----87899985699998688406555788----------


Q ss_pred             EECCCCHHHHHHHC---CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEE
Q ss_conf             98064202334420---00113220440453100246543115677776654305-980799
Q gi|255764515|r   99 VINFENLGWLVQEL---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFIE  156 (458)
Q Consensus        99 i~s~e~~~~~~~~~---~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l~  156 (458)
                          +.++.+.+..   -...+|..+|+||||.+.       ..++.++.+.-.. +++.++
T Consensus       102 ----DeIReLie~~~~~P~~gkyKV~IIDEah~Ln-------~~AaNALLKtLEEPP~~viF  152 (613)
T PRK05896        102 ----DEIRNIIDNINYLPTTFKYKVYIIDEAHMLS-------TSAWNALLKTLEEPPKHVVF  152 (613)
T ss_pred             ----HHHHHHHHHHCCCCCCCCCEEEEECCHHHCC-------HHHHHHHHHHCCCCCCCCEE
T ss_conf             ----9999999970858757994599981622179-------99999999853489878379


No 177
>PRK08769 DNA polymerase III subunit delta'; Validated
Probab=97.38  E-value=0.0014  Score=39.98  Aligned_cols=136  Identities=19%  Similarity=0.217  Sum_probs=65.0

Q ss_pred             CCCHHHHHHHHHHH---HCC---C-EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             87478999999999---679---8-0999588998689999999999975999499991604656999999998558888
Q gi|255764515|r    2 NLAPHQTKIVDWIL---DHK---R-CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSH   74 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~---~~~---~-~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~   74 (458)
                      -+.|||..+.+.+.   +.+   . .|+..+.|+||+-.|.+++..+.-.+..+.  .|..+  . ++   +   ....+
T Consensus         4 ~~~PWq~~~~~~L~~~i~~~rl~HA~Lf~Gp~G~GK~~~A~~~A~~llc~~~~~~--~~~~~--~-~~---i---~~g~H   72 (319)
T PRK08769          4 AFSPWQQRAFDQTVAALDAGRLGHGLLICGPEGLGKRAVALALAEHVLASGPDPA--LAQRT--R-QL---I---AAGTH   72 (319)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCC--CCCHH--H-HH---H---HCCCC
T ss_conf             5587768999999999976994206875899987899999999999837997976--54338--8-99---9---66899


Q ss_pred             CEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCC---CCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-
Q ss_conf             1599985897898887307798699806420233442000---113220440453100246543115677776654305-
Q gi|255764515|r   75 MNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG---TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-  150 (458)
Q Consensus        75 ~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~---~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-  150 (458)
                      .++.++.-......+...     .-++.+.++.+.+....   .-+|..+||||||.+ |      .....++.|.-.. 
T Consensus        73 PD~~~i~~~~~~~~~k~k-----~~I~IdqiR~l~~~~~~~p~~g~~KV~IId~Ad~m-n------~~AaNalLK~LEEP  140 (319)
T PRK08769         73 PDLQLVSFIPNRTGDKLR-----TEIVIEQVREISQKLALTPQYGIAQVVIVDPADAI-N------RSACNALLKTLEEP  140 (319)
T ss_pred             CCEEEEECCCCCCCCCCC-----CCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHC-C------HHHHHHHHHHHCCC
T ss_conf             896877534444543112-----34869999999999613720279569998066752-8------99999999982279


Q ss_pred             CC-EEEEECCC
Q ss_conf             98-07996584
Q gi|255764515|r  151 SE-RFIELTGT  160 (458)
Q Consensus       151 ~~-~~l~LTgT  160 (458)
                      +. .+++|..+
T Consensus       141 p~~~~~iL~~~  151 (319)
T PRK08769        141 SPGRYLWLISA  151 (319)
T ss_pred             CCCEEEEEEEC
T ss_conf             98848999869


No 178
>PRK08451 DNA polymerase III subunits gamma and tau; Validated
Probab=97.27  E-value=0.0038  Score=37.30  Aligned_cols=120  Identities=19%  Similarity=0.165  Sum_probs=56.6

Q ss_pred             HHHHHHHH---HHCC---C-EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             99999999---9679---8-099958899868999999999997599949999160465699999999855888815999
Q gi|255764515|r    7 QTKIVDWI---LDHK---R-CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         7 Q~~~v~~~---~~~~---~-~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      |..++..+   +..+   . .|+..+-|+|||-+|.+++..|.-......   -|.....+     +.......+.++.-
T Consensus        19 Qe~iv~~L~nAi~~~Rl~HAYLFsGPrGvGKTt~ArifAkaLnC~~~~~~---~PCg~C~s-----C~~i~~g~hpDViE   90 (523)
T PRK08451         19 QESVSKTLSLALDNNRLAHAYLFSGLRGSGKTSSARIFSRALVCEQGPSS---TPCGTCAQ-----CQAALEGRHIDIIE   90 (523)
T ss_pred             CHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCC---CCCCCCHH-----HHHHHCCCCCCEEE
T ss_conf             49999999999985996715875789986889999999999759999998---98887888-----99986489998551


Q ss_pred             EECCHHHHHHHHCCCCCEEEECCCCHHHHHHHC---CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEE
Q ss_conf             858978988873077986998064202334420---00113220440453100246543115677776654305-98079
Q gi|255764515|r   80 ITGTVKQRTKVLKTPAVLYVINFENLGWLVQEL---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFI  155 (458)
Q Consensus        80 ~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~---~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l  155 (458)
                      +.+.+....+              .++.+.+..   -..-+|..+|+||||.+.       ..++.++.+.-.. ..+++
T Consensus        91 iDaasn~gID--------------~IReLie~~~~~P~~gryKV~IIDEah~Lt-------~~A~NALLKTLEEPP~~vv  149 (523)
T PRK08451         91 MDAASNRGID--------------DIRNLIEQTKYKPSMARFKIFIIDEVHMLT-------KEAFNALLKTLEEPPSYVK  149 (523)
T ss_pred             ECCCCCCCHH--------------HHHHHHHHHCCCCCCCCEEEEEEECCCCCC-------HHHHHHHHHHCCCCCCCCE
T ss_conf             0553336899--------------999999972358867972799982603048-------9999999997038987837


No 179
>PRK07940 DNA polymerase III subunit delta'; Validated
Probab=97.27  E-value=0.0038  Score=37.31  Aligned_cols=112  Identities=16%  Similarity=0.141  Sum_probs=56.0

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      +|+..+-|+|||..|.+++..|.=.+...    .|....     ..+.+.....+.++..+.-....             
T Consensus        42 yLF~Gp~G~Gk~~~A~~~A~~l~C~~~~~----~~cg~C-----~~C~~i~~g~hpDv~~i~p~~~~-------------   99 (395)
T PRK07940         42 WLFTGPPGSGRSNAARAFAAALQCTDPGV----PGCGEC-----RACRTVLAGTHPDVRVVVPEGLS-------------   99 (395)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCC----CCCCCC-----HHHHHHHCCCCCCEEEEECCCCC-------------
T ss_conf             76368998788999999999966999999----999878-----78999876899871898268776-------------


Q ss_pred             ECCCCHHHHHHHCC---CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEE-EEECCC
Q ss_conf             80642023344200---0113220440453100246543115677776654305-9807-996584
Q gi|255764515|r  100 INFENLGWLVQELK---GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERF-IELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~-l~LTgT  160 (458)
                      +..+.++.+.+...   ..-+|..+||||||++ |      ....+++.|.-.- .++. ++|.+|
T Consensus       100 i~id~iR~l~~~~~~~p~~~~~kv~ii~~a~~m-~------~~a~NalLKtLEEPp~~~~fiL~t~  158 (395)
T PRK07940        100 IGVDEVREIVQIAARRPTTGRWRIVVIEDADRL-T------ERAANALLKAVEEPPPRTVWLLCAP  158 (395)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCEEEEEECHHHH-C------HHHHHHHHHHHCCCCCCEEEEEEEC
T ss_conf             889999999999852730379559998077874-8------9999999985217888869998739


No 180
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=97.26  E-value=0.0045  Score=36.87  Aligned_cols=111  Identities=14%  Similarity=0.234  Sum_probs=54.0

Q ss_pred             HHHHHHHHH---HCCC----EEEEECCCCCHHHHHHHHHHHHHHCCC---CCE--EEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             999999999---6798----099958899868999999999997599---949--9991604656999999998558888
Q gi|255764515|r    7 QTKIVDWIL---DHKR----CAIWASMGSGKTVSVLTALSYIHLWGE---KSV--LVIAPLRVAQSVWTSEVQRWSNFSH   74 (458)
Q Consensus         7 Q~~~v~~~~---~~~~----~ll~~~~G~GKT~~al~~~~~l~~~~~---~~~--LIv~P~~l~~~~W~~Ei~kf~~~~~   74 (458)
                      |..++..+.   ..++    .|+..+.|+|||-.|..++..+...+.   .+.  .-.+|.+.   .|. .+.   ...+
T Consensus        28 q~~~~~~L~~a~~~gRl~HA~Lf~GP~GiGKaTlA~~~A~~Ll~~~~~~~~~~~~~~pd~~~~---~~r-~i~---~g~h  100 (352)
T PRK09112         28 HEEARAFLAQAYREGRLHHALLFEGPEGIGKATLAFHLANHILSHPDPNEAPETLADPDPASP---LWR-QIA---QGAH  100 (352)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCH---HHH-HHH---CCCC
T ss_conf             699999999999849965246535899808999999999998669986668655678887877---899-997---4899


Q ss_pred             CEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCC---CCCCCCEEECCCCCCC
Q ss_conf             159998589789888730779869980642023344200---0113220440453100
Q gi|255764515|r   75 MNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK---GTWPFATIVVDESTKL  129 (458)
Q Consensus        75 ~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~l  129 (458)
                      .++..+.-....+.....     -.++.+.++.+.+.+.   ..-.|..+||||||.+
T Consensus       101 pdl~~i~r~~d~k~~~~~-----~~I~vd~iR~l~~~~~~~~~~~~~kv~Iid~ad~m  153 (352)
T PRK09112        101 PNLLHLTRPFDEKTGKFK-----TAITVDEIRRVTHFLSQTSGDGNWRIVIIDPADDM  153 (352)
T ss_pred             CCEEEEECCCCHHHHHHH-----CCCCHHHHHHHHHHHCCCCCCCCEEEEEECCHHHH
T ss_conf             995655343220214543-----35777999999998454886688069998187874


No 181
>PRK06674 DNA polymerase III subunits gamma and tau; Validated
Probab=97.25  E-value=0.0045  Score=36.86  Aligned_cols=112  Identities=17%  Similarity=0.127  Sum_probs=51.8

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      .|+..+-|+|||-+|..++..+.-... +.  --|.+...+     +.......+.++.-+...+....           
T Consensus        41 yLF~GprGtGKts~Ari~AkaLnC~~~-~~--~~pC~~C~~-----C~~i~~g~~~DviEiDaasn~gV-----------  101 (563)
T PRK06674         41 YLFSGPRGTGKTSIAKVFAKAVNCEHA-PV--AEPCNECPS-----CLGITNGSISDVLEIDAASNNGV-----------  101 (563)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCC-CC--CCCCCCCHH-----HHHHHCCCCCCEEEECCCCCCCH-----------
T ss_conf             431289986899999999998579999-99--887766878-----99985589987798525555787-----------


Q ss_pred             ECCCCHHHHHHHC---CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEEECCC
Q ss_conf             8064202334420---00113220440453100246543115677776654305-9807996584
Q gi|255764515|r  100 INFENLGWLVQEL---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFIELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~~---~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l~LTgT  160 (458)
                         +.++.+.+..   -...+|..+|+||+|.+.+       .++.++.+.-.. ..++++.=+|
T Consensus       102 ---d~IR~i~~~v~~~P~~~~yKV~IIDeah~Lt~-------~A~NALLKtLEEPP~~viFILaT  156 (563)
T PRK06674        102 ---DEIRDIRDKVKFAPSAVEYKVYIIDEVHMLSI-------GAFNALLKTLEEPPGHVIFILAT  156 (563)
T ss_pred             ---HHHHHHHHHHCCCCCCCCEEEEEEECHHHCCH-------HHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             ---99999999826488678737999854563799-------99999999863887564999965


No 182
>PRK13889 conjugal transfer relaxase TraA; Provisional
Probab=97.25  E-value=0.0096  Score=34.86  Aligned_cols=131  Identities=17%  Similarity=0.110  Sum_probs=75.9

Q ss_pred             CCCHHHHHHHHHHHHCCC-EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             874789999999996798-0999588998689999999999975999499991604656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKR-CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~-~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      .|-+-|.+|+.++...++ +++..--|+|||.+. .++...+.....+|+=.+|++...    +++++=   .++....+
T Consensus       346 ~Ls~EQ~~A~~hiT~~~~iavVvG~AGtGKStmL-~aAReawEa~GyrV~GaALsGkAA----egLe~~---sGI~SrTl  417 (992)
T PRK13889        346 VLSGEQADALAHVTDGRDLGVVVGYAGTGKSAML-GVAREAWEAAGYEVRGAALSGIAA----ENLEGG---SGIASRTI  417 (992)
T ss_pred             CCCHHHHHHHHHHCCCCCEEEEEECCCCCHHHHH-HHHHHHHHHCCCEEEEECCCHHHH----HHHHHC---CCCCCHHH
T ss_conf             8799999999986478975899833888788999-999999997798898115006899----976534---79431679


Q ss_pred             ECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             58978988873077986998064202334420001132204404531002465431156777766543059807996584
Q gi|255764515|r   81 TGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        81 ~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      .+    -...|.                 .........+.+|||||-.+-      +.+..+.+ +...++.-++.|.|-
T Consensus       418 As----~e~~w~-----------------~g~~~L~~~dVlVVDEAGMVg------SRqMarll-~~Ae~AGAKVVLVGD  469 (992)
T PRK13889        418 AS----LEHGWG-----------------QGRDLLTARDVLVIDEAGMVG------TRQLERVL-SHAADAGAKVVLVGD  469 (992)
T ss_pred             HH----HHHHHH-----------------CCCCCCCCCCEEEEECCCCCC------HHHHHHHH-HHHHHCCCEEEEECC
T ss_conf             99----999874-----------------673347898589996765577------49999999-999984998999488


Q ss_pred             CHHHHCCC
Q ss_conf             02310010
Q gi|255764515|r  161 PSPNGLID  168 (458)
Q Consensus       161 Pi~n~~~e  168 (458)
                      |.|-.+.+
T Consensus       470 ~~QLq~Ie  477 (992)
T PRK13889        470 PQQLQAIE  477 (992)
T ss_pred             HHHCCCCC
T ss_conf             77718864


No 183
>PRK06305 DNA polymerase III subunits gamma and tau; Validated
Probab=97.25  E-value=0.0049  Score=36.64  Aligned_cols=113  Identities=14%  Similarity=0.150  Sum_probs=55.4

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      .|+..+-|+|||-+|..++..+.-......  ..|.....+  ..+|   ......++.-+.+......+          
T Consensus        42 yLF~GprGtGKTT~ArilAkaLnC~~~~~~--~~pCg~C~~--C~~I---~~g~~~DViEiDaAs~~gVd----------  104 (462)
T PRK06305         42 YLFSGIRGTGKTTLARIFAKALNCQNPTED--QEPCNQCAI--CKEI---SSGTSLDVIEIDGASHRGIE----------  104 (462)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCC--CCCCCCCHH--HHHH---HCCCCCCEEEECCCCCCCHH----------
T ss_conf             430389985999999999999679999888--898876688--8998---63899986864355344668----------


Q ss_pred             ECCCCHHHHHHHC---CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEEECCC
Q ss_conf             8064202334420---00113220440453100246543115677776654305-9807996584
Q gi|255764515|r  100 INFENLGWLVQEL---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFIELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~~---~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l~LTgT  160 (458)
                          .++.+.+..   -...+|...|+||+|.+.       ..++.++.+.-.. ..+++++=+|
T Consensus       105 ----dIRel~e~v~~~P~~~~yKVyIIDEvhmLs-------~~AfNALLKtLEEPP~~v~FILaT  158 (462)
T PRK06305        105 ----DIRQINETVLFTPSKSQYKIYIIDEVHMLT-------KEAFNSLLKTLEEPPQHVKFFLAT  158 (462)
T ss_pred             ----HHHHHHHHHCCCCCCCCEEEEEEECHHHCC-------HHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             ----999999771008867750599981521179-------999999999861898774999981


No 184
>PRK04195 replication factor C large subunit; Provisional
Probab=97.24  E-value=0.00097  Score=40.90  Aligned_cols=41  Identities=20%  Similarity=0.115  Sum_probs=24.0

Q ss_pred             CCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             32204404531002465431156777766543059807996584
Q gi|255764515|r  117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus       117 ~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      +..+||+||+|.+-+...   ....+++.++..+++.-+.|+++
T Consensus        99 ~~KlIIlDEvD~l~~~~d---~gg~~al~~~ik~s~~PiIli~N  139 (403)
T PRK04195         99 KRKLILLDEVDGIHGNAD---RGGVRAILEIIKKAKNPIILTAN  139 (403)
T ss_pred             CCEEEEEECCCCCCCHHH---HHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             734999634344572444---79999999998548870899826


No 185
>KOG0923 consensus
Probab=97.23  E-value=0.00087  Score=41.18  Aligned_cols=163  Identities=18%  Similarity=0.199  Sum_probs=74.4

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCC--CCCEEEEE--CCHHHHH----HHHHHHHHHCCCCC
Q ss_conf             7478999999999679809995889986899999999999759--99499991--6046569----99999998558888
Q gi|255764515|r    3 LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG--EKSVLVIA--PLRVAQS----VWTSEVQRWSNFSH   74 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~--~~~~LIv~--P~~l~~~----~W~~Ei~kf~~~~~   74 (458)
                      .+||-.+-+..+.++.-.++..++|+|||-|.   =.+|...|  ++.-.|=|  |..+...    --.+|..--+ ...
T Consensus       266 Vy~ykdell~av~e~QVLiI~GeTGSGKTTQi---PQyL~EaGytk~gk~IgcTQPRRVAAmSVAaRVA~EMgvkL-G~e  341 (902)
T KOG0923         266 VYPYKDELLKAVKEHQVLIIVGETGSGKTTQI---PQYLYEAGYTKGGKKIGCTQPRRVAAMSVAARVAEEMGVKL-GHE  341 (902)
T ss_pred             CHHHHHHHHHHHHHCCEEEEECCCCCCCCCCC---CHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHCCCC-CCC
T ss_conf             60639999999986708999757889864456---28988542135894674068506887779999999857401-431


Q ss_pred             CEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCC---CCCCEEECCCCCCCCCCCCCCHHHHH---HHHHHHH
Q ss_conf             15999858978988873077986998064202334420001---13220440453100246543115677---7766543
Q gi|255764515|r   75 MNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT---WPFATIVVDESTKLKSFRLRQGSKTA---RALAKPA  148 (458)
Q Consensus        75 ~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~---~~~~~iIiDEaH~lkn~~~~~~s~~~---~~l~~~~  148 (458)
                      +.+.+-..+         ..+.-.++-|=+=.-+.++++..   -.|..|||||||.=    +-...-.+   +.+++..
T Consensus       342 VGYsIRFEd---------cTSekTvlKYMTDGmLlREfL~epdLasYSViiiDEAHER----TL~TDILfgLvKDIar~R  408 (902)
T KOG0923         342 VGYSIRFED---------CTSEKTVLKYMTDGMLLREFLSEPDLASYSVIIVDEAHER----TLHTDILFGLVKDIARFR  408 (902)
T ss_pred             CCEEEEECC---------CCCCCEEEEEECCHHHHHHHHCCCCCCCEEEEEEEHHHHH----HHHHHHHHHHHHHHHHHC
T ss_conf             444888503---------5674122432243067998714634223359996024320----034567999878887508


Q ss_pred             HCCCEEEEECCCCHHHHCCCHHHHHH-HCCCCCCCC
Q ss_conf             05980799658402310010134677-517888775
Q gi|255764515|r  149 WESERFIELTGTPSPNGLIDLWGQIW-FLDKGKRLG  183 (458)
Q Consensus       149 ~~~~~~l~LTgTPi~n~~~el~~ll~-~l~~~~~l~  183 (458)
                      . .-..++.|||.-....+++|.-.- |.-||..++
T Consensus       409 p-dLKllIsSAT~DAekFS~fFDdapIF~iPGRRyP  443 (902)
T KOG0923         409 P-DLKLLISSATMDAEKFSAFFDDAPIFRIPGRRYP  443 (902)
T ss_pred             C-CCEEEEECCCCCHHHHHHHCCCCCEEECCCCCCC
T ss_conf             7-6047732222678999876168857723686565


No 186
>KOG1132 consensus
Probab=97.23  E-value=0.0078  Score=35.42  Aligned_cols=34  Identities=24%  Similarity=0.402  Sum_probs=24.7

Q ss_pred             CCCHHHHHHHHHHHH----CCCEEEEECCCCCHHHHHH
Q ss_conf             874789999999996----7980999588998689999
Q gi|255764515|r    2 NLAPHQTKIVDWILD----HKRCAIWASMGSGKTVSVL   35 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~----~~~~ll~~~~G~GKT~~al   35 (458)
                      +.||-|..-...++.    .-++++-+++|+|||+.-|
T Consensus        21 qpY~~Q~a~M~rvl~~L~~~q~~llESPTGTGKSLsLL   58 (945)
T KOG1132          21 QPYPTQLAFMTRVLSCLDRKQNGLLESPTGTGKSLSLL   58 (945)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHH
T ss_conf             86458999999999998876312020889898149999


No 187
>PRK12377 putative replication protein; Provisional
Probab=97.22  E-value=0.0057  Score=36.26  Aligned_cols=54  Identities=17%  Similarity=0.125  Sum_probs=36.6

Q ss_pred             HHHHHHHHH--------HHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             789999999--------9967980999588998689999999999975999499991604656
Q gi|255764515|r    5 PHQTKIVDW--------ILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ   59 (458)
Q Consensus         5 p~Q~~~v~~--------~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~   59 (458)
                      |=|..|+..        +-+..+.++..++|+|||-.|+++...+...| .+++.+.-+.++.
T Consensus        81 ~~~~~a~~~a~~~~~~F~~~~~NlIf~G~pGtGKTHLA~AIg~~a~~~G-~sVlF~t~~dLv~  142 (248)
T PRK12377         81 DGQRYALSQAKSIADELMTGCTNFVFSGKPGTGKNHLAAAIGNRLLAKG-RSVIVVTVPDVMS  142 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEEHHHHHH
T ss_conf             7899999999999998731886089989999878899999999999879-9699988999999


No 188
>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=97.21  E-value=0.0013  Score=40.22  Aligned_cols=52  Identities=21%  Similarity=0.185  Sum_probs=38.2

Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             99999999967980999588998689999999999975999499991604656
Q gi|255764515|r    7 QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ   59 (458)
Q Consensus         7 Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~   59 (458)
                      |....+|+....+.++..++|+|||..|.+++..+...| .+++.+.-..++.
T Consensus        37 ~L~~~~~i~~~~Nlll~G~~GtGKThLA~Ai~~~~~~~g-~~v~f~~~~~L~~   88 (178)
T pfam01695        37 ELAGLDWIEQAENLLLLGPPGVGKTHLACALGHQACRAG-YSVLFTRTPDLVE   88 (178)
T ss_pred             HHHCCCCHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEECHHHHH
T ss_conf             885597421587689989999878999999999999869-8599996167999


No 189
>PRK07270 DNA polymerase III subunits gamma and tau; Validated
Probab=97.17  E-value=0.0051  Score=36.51  Aligned_cols=126  Identities=14%  Similarity=0.128  Sum_probs=56.5

Q ss_pred             HHHHHHHH---HHCC---CE-EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             99999999---9679---80-99958899868999999999997599949999160465699999999855888815999
Q gi|255764515|r    7 QTKIVDWI---LDHK---RC-AIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         7 Q~~~v~~~---~~~~---~~-ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      |..++..+   +..+   .+ |+..+.|+|||-+|.+++..+.-.....   --|.+...  ....+   ......++..
T Consensus        20 Qe~i~~~L~nal~~~ri~HAyLF~GP~GtGKts~ArifAkaLnC~~~~~---~~pC~~C~--~C~~i---~~g~~~DviE   91 (557)
T PRK07270         20 QEVVATTLKQAVESGKISHAYLFSGPRGTGKTSAAKIFAKAMNCPNQVD---GEPCNNCD--ICRDI---TNGSLEDVIE   91 (557)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCC---CCCCCCCH--HHHHH---HCCCCCCEEE
T ss_conf             1999999999998599540442108998689999999999957999899---99888777--99998---7589997487


Q ss_pred             EECCHHHHHHHHCCCCCEEEECCCCHHHHHHH---CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEE
Q ss_conf             85897898887307798699806420233442---000113220440453100246543115677776654305-98079
Q gi|255764515|r   80 ITGTVKQRTKVLKTPAVLYVINFENLGWLVQE---LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFI  155 (458)
Q Consensus        80 ~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~---~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l  155 (458)
                      +.+.+....+              .++.+.+.   .-..-+|..+|+||||.+..       .++.++.+.-.. .++.+
T Consensus        92 idaas~~gVd--------------~IRei~~~~~~~P~~~~yKV~IIDEah~Ls~-------~A~NALLKtLEEPP~~~v  150 (557)
T PRK07270         92 IDAASNNGVD--------------EIRDIRDKSTYAPSRATYKVYIIDEVHMLST-------GAFNALLKTLEEPTENVV  150 (557)
T ss_pred             ECCCCCCCHH--------------HHHHHHHHHCCCCCCCCEEEEEECCHHHCCH-------HHHHHHHHHHHCCCCCEE
T ss_conf             3477767889--------------9999999842387778838999714453499-------999989998528998769


Q ss_pred             --EECCCC
Q ss_conf             --965840
Q gi|255764515|r  156 --ELTGTP  161 (458)
Q Consensus       156 --~LTgTP  161 (458)
                        +.|-.|
T Consensus       151 FIL~Ttep  158 (557)
T PRK07270        151 FILATTEL  158 (557)
T ss_pred             EEEEECCH
T ss_conf             99984994


No 190
>pfam11496 HDA2-3 Class II histone deacetylase complex subunits 2 and 3. This family of class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi, The member from S. pombe is referred to as Ccq1. These proteins associate with HDA1 to generate the activity of the HDA1 histone deacetylase complex. HDA1 interacts with itself and with the HDA2-HDA3 subcomplex to form a probable tetramer and these interactions are necessary for catalytic activity. The HDA1 histone deacetylase complex is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. HDA2 and HDA3 have a conserved coiled-coil domain towards their C-terminus.
Probab=97.15  E-value=0.012  Score=34.18  Aligned_cols=180  Identities=13%  Similarity=0.154  Sum_probs=94.4

Q ss_pred             EEEEECCHHHHHHHHHHHHHHHHHC----CCCCCHH---------HHHH-HHHHHHHHCCCCCCCC-----------CCC
Q ss_conf             0345245368998889999998510----3345202---------2347-8888754203541000-----------223
Q gi|255764515|r  244 TKKVPLPQPVMKQYHKFQRELYCDL----QGENIEA---------FNSA-SKTVKCLQLANGAVYY-----------DEE  298 (458)
Q Consensus       244 ~~~v~l~~~~~~~y~~~~~~~~~~~----~~~~~~~---------~~~~-~~~~~l~q~~~~~~~~-----------~~~  298 (458)
                      ....+|+.-|+..|+.+...-...+    .+.....         .... .-..++..+|+||-+.           .+.
T Consensus         7 ~lP~pM~~~qKdl~e~ivslh~~~il~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~Va~HP~LlidH~~p~~l~~~~~   86 (278)
T pfam11496         7 YLPTPMTSLQKDLTEQIVSLHYSDILKFCETSSSKEDIIKLLEDLAESIKLLFENLSNVATHPYLLIDHYMPKSLLLKEE   86 (278)
T ss_pred             EEECCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCH
T ss_conf             75056136788899999999889999998147752111112100899999999975554279326434557876644244


Q ss_pred             CCCHHCCCCCCCCHHHHHHC----CCCCEEEEHHHHHHHHHHHHHCCCC---------CCCH-HHHHHHHHHHC-CCCCC
Q ss_conf             43000134333325665412----4884034222367888664100026---------5334-45899876424-58855
Q gi|255764515|r  299 KHWKEVHDEKIKALEVIIEK----ANAAPIIVAYHFNSDLARLQKAFPQ---------GRTL-DKDPCTIQEWN-EGKIP  363 (458)
Q Consensus       299 ~~~~~~~~~k~~~l~~il~~----~~~~kviif~~~~~~~~~i~~~~~~---------g~~~-~~r~~~i~~f~-~~~~~  363 (458)
                      ..+....|+|+..|.++++.    ..+-.++|+++-..+++.+..-+.+         |.+. ++... ...++ .....
T Consensus        87 ~~~~~~tSgKF~~L~~Li~~~~~~~~~~~ilIv~~~~k~ldLlE~~llgk~~~y~r~~g~~~~~~~~~-~~~~k~~~s~~  165 (278)
T pfam11496        87 AEHLAETSGKFLVLNDLINLLIPSERDLHVLIISRSGKTLDLVEALLLGKGLKYKRLSGESLYEENHK-VSDKKGSLSFW  165 (278)
T ss_pred             HHHHHHHCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCC-CCCCCCCCEEE
T ss_conf             78999823339999999999873457837999978953799999997258646760788767665545-65557884069


Q ss_pred             EEEEEHHHCCCCCCC-------CCCCCEEEEECCCCCHHHH-HHHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHH
Q ss_conf             899844221116220-------0178599990899898686-44566662022020378775289999858996899999
Q gi|255764515|r  364 LLFAHPASCGHGLNL-------QYGGNILVFFSLWWDLEEH-QQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQ  435 (458)
Q Consensus       364 vli~s~~~~~~GlnL-------~~a~~~iI~~~~~wn~~~~-~Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~  435 (458)
                      |.++++    .|+.-       ....+++|-+|+.+++..- .|.....     +|.|  +++-+++|+..+|+|.-.+.
T Consensus       166 I~l~~~----~~~~~~~~~~~~~~~~d~Iia~D~s~d~~~p~ie~lR~~-----~~~~--~~~PvirLv~~nSiEHi~l~  234 (278)
T pfam11496       166 IHLTTS----DGLTNTDSSLLSNYKFDLIISFDPSLDTSLPSIESLRTT-----NRRG--RLTPIIRLVVVNSIEHIELC  234 (278)
T ss_pred             EEEECC----CCCCCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHH-----CCCC--CCCCEEEEEECCCHHHHHHH
T ss_conf             997068----775457888443565277999568879897489999863-----4489--98877999526999999987


No 191
>KOG0952 consensus
Probab=97.11  E-value=0.00075  Score=41.57  Aligned_cols=26  Identities=19%  Similarity=0.226  Sum_probs=10.6

Q ss_pred             CCCHHHHHHHHHHHHCCCCHHCCCCC
Q ss_conf             98986864456666202202037877
Q gi|255764515|r  391 WWDLEEHQQMIERIGVTRQRQAGFKR  416 (458)
Q Consensus       391 ~wn~~~~~Q~~gRi~~~r~hR~Gq~~  416 (458)
                      +|-....-|...=+.-++.|=.|..+
T Consensus      1037 sw~~r~~v~~v~~iv~de~hllg~~r 1062 (1230)
T KOG0952        1037 SWQTRKYVQSVSLIVLDEIHLLGEDR 1062 (1230)
T ss_pred             CCCCHHHHCCCCCEEECCCCCCCCCC
T ss_conf             42331121125610201221346777


No 192
>PRK09183 transposase/IS protein; Provisional
Probab=97.11  E-value=0.0074  Score=35.54  Aligned_cols=49  Identities=14%  Similarity=0.074  Sum_probs=37.5

Q ss_pred             HHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             99999967980999588998689999999999975999499991604656
Q gi|255764515|r   10 IVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ   59 (458)
Q Consensus        10 ~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~   59 (458)
                      ..+|+..+.+.++..++|+|||..|+++.......| .+++.+.-..++.
T Consensus        94 ~~~fi~~~~Nvil~G~~GtGKThLA~Alg~~A~~~G-~~v~f~~~~~L~~  142 (258)
T PRK09183         94 SLSFIERNENIVLLGPSGVGKTHLAIALGYEAVRAG-IKVRFTTAADLLL  142 (258)
T ss_pred             CCCHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEEHHHHHH
T ss_conf             581665588679989999868999999999999879-9399978999999


No 193
>PRK06526 transposase; Provisional
Probab=97.11  E-value=0.0066  Score=35.87  Aligned_cols=49  Identities=16%  Similarity=0.180  Sum_probs=36.3

Q ss_pred             HHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             99999967980999588998689999999999975999499991604656
Q gi|255764515|r   10 IVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ   59 (458)
Q Consensus        10 ~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~   59 (458)
                      ..+|+.++.+.++..++|+|||..|+++.......| .+++.+.-..++.
T Consensus        91 ~~~fi~~~~Nvil~G~~GtGKThLA~Alg~~A~~~G-~~v~f~~~~~L~~  139 (254)
T PRK06526         91 TLDFVTGKENVVFLGPPGTGKTHLAIGLGIRACQAG-HRVLFATAAQWVA  139 (254)
T ss_pred             CCCHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCC-CCEEEEEHHHHHH
T ss_conf             371776588789989999868999999999999869-9679987799999


No 194
>PRK06647 DNA polymerase III subunits gamma and tau; Validated
Probab=97.10  E-value=0.0083  Score=35.23  Aligned_cols=125  Identities=18%  Similarity=0.218  Sum_probs=59.2

Q ss_pred             HHHHHHHHH---HCC---C-EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             999999999---679---8-099958899868999999999997599949999160465699999999855888815999
Q gi|255764515|r    7 QTKIVDWIL---DHK---R-CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         7 Q~~~v~~~~---~~~---~-~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      |...+..+.   ..+   . .|+..+.|+|||-+|.+++..|.-.. .+.  ..|.....+  ..++   ....+.++..
T Consensus        21 Qe~vv~~L~nai~~~rl~HAyLFsGprG~GKTt~ArilAk~LnC~~-~~~--~~PCg~C~s--C~~i---~~g~~~DviE   92 (560)
T PRK06647         21 QDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARCLNCVN-GPT--IMPCGECFS--CKSI---DNDSSLDVIE   92 (560)
T ss_pred             CHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCC-CCC--CCCCCCCHH--HHHH---HCCCCCCEEE
T ss_conf             4999999999997499774366328998789999999999965999-999--888878878--8887---4599987576


Q ss_pred             EECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCC---CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEE
Q ss_conf             8589789888730779869980642023344200---0113220440453100246543115677776654305-98079
Q gi|255764515|r   80 ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK---GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFI  155 (458)
Q Consensus        80 ~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l  155 (458)
                      +.+.....              .+.++.+.+...   ..-+|..+|+||||.+.       ..++.++.+.... +.+.+
T Consensus        93 idaasn~~--------------VddIR~l~e~v~~~P~~~~yKV~IIDEahmLt-------~~A~NALLKtLEEPP~~~~  151 (560)
T PRK06647         93 IDGASNTS--------------VQDVRQIKEEIMFPPASSRYRVYIIDEVHMLS-------NSAFNALLKTIEEPPPYIV  151 (560)
T ss_pred             ECCCCCCC--------------HHHHHHHHHHHCCCCCCCCEEEEEECCHHHCC-------HHHHHHHHHHHHCCCCCEE
T ss_conf             43645488--------------89999999986328766870699964656559-------9999999998634887559


Q ss_pred             EECCC
Q ss_conf             96584
Q gi|255764515|r  156 ELTGT  160 (458)
Q Consensus       156 ~LTgT  160 (458)
                      ++=+|
T Consensus       152 FILaT  156 (560)
T PRK06647        152 FIFAT  156 (560)
T ss_pred             EEEEC
T ss_conf             99977


No 195
>KOG0926 consensus
Probab=97.09  E-value=0.00096  Score=40.93  Aligned_cols=142  Identities=20%  Similarity=0.147  Sum_probs=61.6

Q ss_pred             HHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCC---CCC-EEEEE-CCHHHH---HH-HHHHHHHHCCCCCCEEEEE
Q ss_conf             999999679809995889986899999999999759---994-99991-604656---99-9999998558888159998
Q gi|255764515|r   10 IVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG---EKS-VLVIA-PLRVAQ---SV-WTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus        10 ~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~---~~~-~LIv~-P~~l~~---~~-W~~Ei~kf~~~~~~~~~~~   80 (458)
                      .++.+-.|+-.+++.++|+|||-|.=-++-..-...   ..+ ++=|+ |..+..   .+ -..|+..|.  ..+.+.+-
T Consensus       264 IMEaIn~n~vvIIcGeTGsGKTTQvPQFLYEAGf~s~~~~~~gmIGITqPRRVAaiamAkRVa~EL~~~~--~eVsYqIR  341 (1172)
T KOG0926         264 IMEAINENPVVIICGETGSGKTTQVPQFLYEAGFASEQSSSPGMIGITQPRRVAAIAMAKRVAFELGVLG--SEVSYQIR  341 (1172)
T ss_pred             HHHHHHCCCEEEEECCCCCCCCCCCHHHHHHCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHHHHHCCCC--CCEEEEEE
T ss_conf             9998622874999548888864434189987134776679987054057227899999999999852576--41148998


Q ss_pred             -ECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCC----CCHHHHHHHHHHHHH-----C
Q ss_conf             -589789888730779869980642023344200011322044045310024654----311567777665430-----5
Q gi|255764515|r   81 -TGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRL----RQGSKTARALAKPAW-----E  150 (458)
Q Consensus        81 -~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~----~~~s~~~~~l~~~~~-----~  150 (458)
                       .|+.       ..+..|-.+|-.-+-+....-....+|..||+||||.= |..+    ..-|+..+.-.+...     +
T Consensus       342 fd~ti-------~e~T~IkFMTDGVLLrEi~~DflL~kYSvIIlDEAHER-SvnTDILiGmLSRiV~LR~k~~ke~~~~k  413 (1172)
T KOG0926         342 FDGTI-------GEDTSIKFMTDGVLLREIENDFLLTKYSVIILDEAHER-SVNTDILIGMLSRIVPLRQKYYKEQCQIK  413 (1172)
T ss_pred             ECCCC-------CCCCEEEEECCHHHHHHHHHHHHHHHCEEEEECHHHHC-CCHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             53656-------88740477402388999887675542015785125430-31278999999887788899766413567


Q ss_pred             CCEEEEECCCC
Q ss_conf             98079965840
Q gi|255764515|r  151 SERFIELTGTP  161 (458)
Q Consensus       151 ~~~~l~LTgTP  161 (458)
                      .-+.++||||-
T Consensus       414 pLKLIIMSATL  424 (1172)
T KOG0926         414 PLKLIIMSATL  424 (1172)
T ss_pred             CEEEEEEEEEE
T ss_conf             61699974147


No 196
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=97.09  E-value=0.0023  Score=38.59  Aligned_cols=48  Identities=13%  Similarity=0.083  Sum_probs=29.2

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHH
Q ss_conf             79809995889986899999999999759994999916046569999999
Q gi|255764515|r   17 HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEV   66 (458)
Q Consensus        17 ~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei   66 (458)
                      .+..+|..++|+|||..|-+++..+... ..+++.+-...+.. .|..+.
T Consensus        19 ~~~ill~GppGtGKT~la~~ia~~~~~~-~~~~~~~~~~~~~~-~~~~~~   66 (151)
T cd00009          19 PKNLLLYGPPGTGKTTLARAIANELFRP-GAPFLYLNASDLLE-GLVVAE   66 (151)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCC-CCCEEEEEHHHCCH-HHHHHH
T ss_conf             9808998999988659999999971213-79827854777046-777757


No 197
>pfam03796 DnaB_C DnaB-like helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=97.08  E-value=0.0078  Score=35.41  Aligned_cols=112  Identities=21%  Similarity=0.159  Sum_probs=53.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEEC--CHHHHH---HHH--C
Q ss_conf             099958899868999999999997599949999160465699999999855888815999858--978988---873--0
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG--TVKQRT---KVL--K   92 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g--~~~~r~---~~~--~   92 (458)
                      .+++..+|.|||..++.++.........+++++++---......+-+...+..+..+.  ..|  +.....   +..  .
T Consensus        22 ~vi~g~pg~GKS~~~~~~a~~~a~~~g~~Vl~~slEm~~~~~~~R~~a~~~~v~~~~i--~~~~~~~~~~~~~~~~~~~~   99 (186)
T pfam03796        22 IIIAARPSMGKTAFALNIARNAALKQDKPVLFFSLEMSAEQLAERLLSSESRISSSKL--RSGQLSDEDWERLAEAAGEL   99 (186)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCHHHH--HCCCHHHHHHHHHHHHHHHH
T ss_conf             9999679998799999999999997099668754755299999999998626765554--12512167999999999998


Q ss_pred             CCCCEEEECC-----CCHHHHHHHCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             7798699806-----4202334420001132204404531002465
Q gi|255764515|r   93 TPAVLYVINF-----ENLGWLVQELKGTWPFATIVVDESTKLKSFR  133 (458)
Q Consensus        93 ~~~~i~i~s~-----e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~  133 (458)
                      ....+++...     +.+....+.+....+.++||+|=.+.++.+.
T Consensus       100 ~~~~l~i~~~~~~t~~~i~~~i~~~~~~~~~~~vvvDyl~l~~~~~  145 (186)
T pfam03796       100 SEAPLYIDDTPGLSLSELRAQARRLKREHGLGLIVIDYLQLMQGSK  145 (186)
T ss_pred             HCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEHHHHCCCCC
T ss_conf             5398688479999899999999999985599889974898636778


No 198
>PRK08058 DNA polymerase III subunit delta'; Validated
Probab=97.07  E-value=0.0089  Score=35.07  Aligned_cols=128  Identities=16%  Similarity=0.216  Sum_probs=62.5

Q ss_pred             HHHHHHHHHH---HHCCC----EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             7899999999---96798----0999588998689999999999975999499991604656999999998558888159
Q gi|255764515|r    5 PHQTKIVDWI---LDHKR----CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         5 p~Q~~~v~~~---~~~~~----~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~   77 (458)
                      -+|..+++.+   +..++    .|+..+-|+||+..|.+++..+.=......   -|....     ..+.++....+.++
T Consensus         9 ~~Q~~i~~~L~~~i~~~rl~HA~Lf~Gp~G~GK~~~A~~~A~~LlC~~~~~~---~~Cg~C-----~~C~~~~~~~HPD~   80 (329)
T PRK08058          9 ALQPIVVKMLQNSIAKNRLAHAYLFEGAKGTGKKATALWLAKSLFCLERNGV---EPCGTC-----TNCKRIESGNHPDV   80 (329)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCC---CCCCCC-----HHHHHHHCCCCCCE
T ss_conf             3189999999999985996615655789998899999999999739999999---988788-----89999876999976


Q ss_pred             EEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCC---CCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCC-CE
Q ss_conf             9985897898887307798699806420233442000---1132204404531002465431156777766543059-80
Q gi|255764515|r   78 SVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG---TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWES-ER  153 (458)
Q Consensus        78 ~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~---~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~-~~  153 (458)
                      ..+....+.             +..+.++.+.+....   .-.|..+||||||++ |      ..+++++.|.-... .+
T Consensus        81 ~~i~p~~~~-------------i~idqiR~L~~~~~~~p~~g~~KV~II~~Ae~m-~------~~AaNALLKtLEEPp~~  140 (329)
T PRK08058         81 HLVAPDGQS-------------IKKDQIRYLKEEFSKSGVESNKKVYIIEHADKM-T------ASAANSLLKFLEEPSGD  140 (329)
T ss_pred             EEECCCCCC-------------CCHHHHHHHHHHHCCCCCCCCCEEEEEECHHHH-C------HHHHHHHHHHHHCCCCC
T ss_conf             774566140-------------779999999999643875788679997347762-9------99999999986468978


Q ss_pred             -EEEECCC
Q ss_conf             -7996584
Q gi|255764515|r  154 -FIELTGT  160 (458)
Q Consensus       154 -~l~LTgT  160 (458)
                       +++|.+|
T Consensus       141 t~fIL~t~  148 (329)
T PRK08058        141 TTAILLTE  148 (329)
T ss_pred             CEEEEEEC
T ss_conf             67998729


No 199
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=97.04  E-value=0.0068  Score=35.76  Aligned_cols=112  Identities=18%  Similarity=0.179  Sum_probs=55.8

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCC---CCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHH----HHC
Q ss_conf             09995889986899999999999759---99499991604656999999998558888159998589789888----730
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWG---EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTK----VLK   92 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~---~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~----~~~   92 (458)
                      .++..+-|+|||-+|-.++..+.-..   ..+.  .-|.....+  ..++   ....+.++.-+...+....+    +..
T Consensus        46 ylf~G~rG~GKTt~Ari~ak~lnc~~~~~~~~~--~~~c~~c~~--c~~i---~~~~~~dv~EiDaas~~gv~~ir~l~~  118 (507)
T PRK06645         46 YLLTGIRGVGKTTSARIIAKAVNCSALITENTT--IKTCEKCTN--CISF---NNHNHPDIIEIDAASKTSVDDIRRIIE  118 (507)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCC--CCCCCCCHH--HHHH---HCCCCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             774587997889999999999679998888998--888888767--8998---658999859963788888899999986


Q ss_pred             CCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH-HCCCEEEEECCC
Q ss_conf             77986998064202334420001132204404531002465431156777766543-059807996584
Q gi|255764515|r   93 TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA-WESERFIELTGT  160 (458)
Q Consensus        93 ~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~-~~~~~~l~LTgT  160 (458)
                      .      +.|-.         ...+|...|+||+|.+.       ..++.++.+.- ..++++.+.=||
T Consensus       119 ~------~~~~p---------~~~~~kv~iidE~hmls-------~~a~nallktlEepp~~~~Fi~at  165 (507)
T PRK06645        119 S------AEYKP---------LQGKHKIFIIDEVHMLS-------KGAFNALLKTLEEPPPHIIFIFAT  165 (507)
T ss_pred             H------CCCCC---------CCCCEEEEEECCHHHCC-------HHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             3------55178---------76743589952142248-------999999999742786443899974


No 200
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=96.98  E-value=0.013  Score=34.07  Aligned_cols=50  Identities=16%  Similarity=0.102  Sum_probs=33.7

Q ss_pred             HHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHH
Q ss_conf             9996798099958899868999999999997599949999160465699999
Q gi|255764515|r   13 WILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTS   64 (458)
Q Consensus        13 ~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~   64 (458)
                      |.-...+.++..++|+|||..|.|++-.+... ..+++++.-+.++. ....
T Consensus       101 ~~~~~~nl~l~G~~G~GKthLa~Ai~~~l~~~-g~sv~f~~~~el~~-~Lk~  150 (254)
T COG1484         101 FFERGENLVLLGPPGVGKTHLAIAIGNELLKA-GISVLFITAPDLLS-KLKA  150 (254)
T ss_pred             HHCCCCCEEEECCCCCCHHHHHHHHHHHHHHC-CCEEEEEEHHHHHH-HHHH
T ss_conf             73258828998999987999999999999983-98499988599999-9999


No 201
>PRK07764 DNA polymerase III subunits gamma and tau; Validated
Probab=96.93  E-value=0.013  Score=34.05  Aligned_cols=114  Identities=17%  Similarity=0.133  Sum_probs=53.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      +|+...-|+|||-+|-+++..|+-.. .+.  --|.....+  ..+|..- ....++|.-+.+.+....           
T Consensus        40 YLFsGprG~GKTt~ARilAkaLNC~~-~~~--~~PCg~C~s--C~~i~~g-~~~~~DviEiDAAS~~gV-----------  102 (775)
T PRK07764         40 YLFSGPRGCGKTSSARILARSLNCAQ-GPT--STPCGVCDS--CVALAPG-GPGSLDVVEIDAASHGGV-----------  102 (775)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCC-CCC--CCCCCCCHH--HHHHHCC-CCCCCCEEEECCCCCCCH-----------
T ss_conf             76237888788899999999966899-999--898888763--7888638-988886687315655688-----------


Q ss_pred             ECCCCHHHHHHHCC---CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEEECCC
Q ss_conf             80642023344200---0113220440453100246543115677776654305-9807996584
Q gi|255764515|r  100 INFENLGWLVQELK---GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFIELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l~LTgT  160 (458)
                         +.++.+.+...   ..-+|...||||+|.+.       ...++++.|.-.. ..+++++=+|
T Consensus       103 ---ddiReL~e~~~y~P~~~ryKVyIIDEaHmls-------~~afNALLKtLEEPP~hvvFIlaT  157 (775)
T PRK07764        103 ---DDARELRERAFFAPAQSRYRIFIIDEAHMVT-------TAGFNALLKIVEEPPEHLIFIFAT  157 (775)
T ss_pred             ---HHHHHHHHHCCCCCCCCCEEEEEEECHHHHC-------HHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             ---9999999854768767863599985354407-------999999988622786462799954


No 202
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=96.91  E-value=0.027  Score=32.13  Aligned_cols=16  Identities=6%  Similarity=0.023  Sum_probs=5.9

Q ss_pred             HHHHHHHCCCCCCEEE
Q ss_conf             9987642458855899
Q gi|255764515|r  351 PCTIQEWNEGKIPLLF  366 (458)
Q Consensus       351 ~~~i~~f~~~~~~vli  366 (458)
                      .++++.|..-...-+|
T Consensus       302 ~~i~~~f~~~~~~~~I  317 (404)
T PRK06995        302 NEVVQAYRGPGLAGCI  317 (404)
T ss_pred             HHHHHHHCCCCCCEEE
T ss_conf             9999984469998399


No 203
>PRK13826 Dtr system oriT relaxase; Provisional
Probab=96.91  E-value=0.02  Score=32.91  Aligned_cols=131  Identities=15%  Similarity=0.113  Sum_probs=73.9

Q ss_pred             CCCHHHHHHHHHHHHCCC-EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             874789999999996798-0999588998689999999999975999499991604656999999998558888159998
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKR-CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~-~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      +|-+-|.+|+.++...++ +++..--|+|||.+ |.++...+.....+++=.+|++...    +.+++   ..++....+
T Consensus       381 ~Ls~EQ~~Av~hiT~~~~Ia~VvG~AGaGKStm-L~aAReawEa~GyrV~GaALsGkAA----egLe~---~sGI~SrTl  452 (1102)
T PRK13826        381 RLSDEQKTAIEHVAGAERIAAVIGRAGAGKTTM-MKAAREAWEAAGYRVVGGALAGKAA----EGLEK---EAGIASRTL  452 (1102)
T ss_pred             CCCHHHHHHHHHHCCCCCEEEEEECCCCCHHHH-HHHHHHHHHHCCCEEEEECCCHHHH----HHHHH---CCCCCCHHH
T ss_conf             389999999998537886689984288878899-9999999997797798015007899----97753---469530338


Q ss_pred             ECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             58978988873077986998064202334420001132204404531002465431156777766543059807996584
Q gi|255764515|r   81 TGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        81 ~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      .+    -.-.|...                 -.....-+.+|||||-.+      .+.+..+.+. ...++.-++.|-|-
T Consensus       453 As----~e~~w~~g-----------------r~~L~~~dVlVIDEAGMV------gsrqmarvl~-~ae~aGAKvVLVGD  504 (1102)
T PRK13826        453 SS----WELRWNQG-----------------RDQLDNKTVFVLDEAGMV------SSRQMALFVE-AVTRAGAKLVLVGD  504 (1102)
T ss_pred             HH----HHHHHCCC-----------------CCCCCCCCEEEEECCCCC------CHHHHHHHHH-HHHHCCCEEEEECC
T ss_conf             99----99874358-----------------655678738998455565------5799999999-99975998999688


Q ss_pred             CHHHHCCC
Q ss_conf             02310010
Q gi|255764515|r  161 PSPNGLID  168 (458)
Q Consensus       161 Pi~n~~~e  168 (458)
                      |-|-.|.+
T Consensus       505 ~~QLQpIe  512 (1102)
T PRK13826        505 PEQLQPIE  512 (1102)
T ss_pred             HHHHCCCC
T ss_conf             78827610


No 204
>PRK08181 transposase; Validated
Probab=96.88  E-value=0.012  Score=34.20  Aligned_cols=47  Identities=17%  Similarity=0.202  Sum_probs=35.2

Q ss_pred             HHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             999967980999588998689999999999975999499991604656
Q gi|255764515|r   12 DWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ   59 (458)
Q Consensus        12 ~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~   59 (458)
                      .|+.+..+.++..++|+|||..|+++.......| .+++.+.-..++.
T Consensus       101 ~fi~~~~Nvil~Gp~GtGKThLA~Alg~~A~~~G-~~V~f~~~~~L~~  147 (269)
T PRK08181        101 SWLAKGANLLLFGPPGGGKSHLAAAIGLALIENG-WRVLFTRTTDLVQ  147 (269)
T ss_pred             HHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEEHHHHHH
T ss_conf             5886487089989999878899999999999879-9399978999999


No 205
>pfam00580 UvrD-helicase UvrD/REP helicase. The Rep family helicases are composed of four structural domains. The Rep family function as dimers. REP helicases catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. Bacillus subtilis addA and Escherichia coli exodeoxyribonuclease V beta have large insertions near to the carboxy-terminus relative to other members of the family.
Probab=96.81  E-value=0.0089  Score=35.06  Aligned_cols=54  Identities=28%  Similarity=0.340  Sum_probs=40.5

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHC-CC--CCEEEEECCHHH
Q ss_conf             747899999999967980999588998689999999999975-99--949999160465
Q gi|255764515|r    3 LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLW-GE--KSVLVIAPLRVA   58 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~-~~--~~~LIv~P~~l~   58 (458)
                      |.|-|.+||..  ..+..++....|+|||.+...-+..+... +.  ..+|+|+-+.-.
T Consensus         1 Ln~~Q~~av~~--~~~~llV~AgAGSGKT~~L~~Ri~~li~~~~~~p~~IL~lTFT~kA   57 (494)
T pfam00580         1 LNPEQRKAVTH--LGGPLLVLAGAGTGKTRVLTERIAYLILEGGIDPEEILAVTFTNKA   57 (494)
T ss_pred             CCHHHHHHHCC--CCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCHHHEEEEECHHHH
T ss_conf             99889999809--9999799971870689999999999998189997478767028999


No 206
>PRK08116 hypothetical protein; Validated
Probab=96.79  E-value=0.019  Score=33.05  Aligned_cols=45  Identities=20%  Similarity=0.223  Sum_probs=29.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHH
Q ss_conf             80999588998689999999999975999499991604656999999
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSE   65 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~E   65 (458)
                      +.++..++|+|||..|.+++..+...| .+++++.-..++ +.....
T Consensus       110 GLll~G~~GtGKThLa~aIa~~l~~~g-~~V~~~~~~~ll-~~lk~~  154 (262)
T PRK08116        110 GLLLWGSPGNGKTYLAAAIANELIEKG-VPVVFVNVPELL-NRIKST  154 (262)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEEHHHHH-HHHHHH
T ss_conf             189989899989999999999999879-939998899999-999999


No 207
>PRK07993 DNA polymerase III subunit delta'; Validated
Probab=96.78  E-value=0.013  Score=34.03  Aligned_cols=135  Identities=16%  Similarity=0.107  Sum_probs=68.4

Q ss_pred             CCCCHHHHHHHHHHHH---CCC----EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             9874789999999996---798----099958899868999999999997599949999160465699999999855888
Q gi|255764515|r    1 MNLAPHQTKIVDWILD---HKR----CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFS   73 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~---~~~----~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~   73 (458)
                      |++||||...-+.+..   .+|    .++..+.|+||...|..++..+.=..... .  -|.+.     ...+..+....
T Consensus         1 m~~YPWl~~~~~~l~~~~~~~rl~HA~L~~G~~G~Gk~~la~~~a~~llC~~~~~-~--~~Cg~-----C~~C~l~~~~~   72 (334)
T PRK07993          1 MKWYPWLRPDYEKLVGSYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQG-H--KSCGH-----CRGCQLMQAGT   72 (334)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCC-C--CCCCC-----CHHHHHHHCCC
T ss_conf             9888887899999999998598104675479999889999999999981899999-9--99999-----97899986689


Q ss_pred             CCEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCC---CCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             81599985897898887307798699806420233442000---113220440453100246543115677776654305
Q gi|255764515|r   74 HMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG---TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE  150 (458)
Q Consensus        74 ~~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~---~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~  150 (458)
                      +.+++++.......           -+..+.++.+.+....   .-.+..+|||+|+.+ |      ..+.+++.|.-..
T Consensus        73 HPD~~~i~pe~~~~-----------~I~IdqIR~l~~~~~~~~~~g~~kV~iI~~Ae~m-n------~~AaNaLLKtLEE  134 (334)
T PRK07993         73 HPDYYTLTPEKGKS-----------SLGVDAVREVTEKLYEHARLGGAKVVWLPDAALL-T------DAAANALLKTLEE  134 (334)
T ss_pred             CCCEEEECCCCCCC-----------CCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHH-C------HHHHHHHHHHHCC
T ss_conf             99847753422345-----------5999999999999843665699479997667775-9------9999999986127


Q ss_pred             -CC--EEEEECCCC
Q ss_conf             -98--079965840
Q gi|255764515|r  151 -SE--RFIELTGTP  161 (458)
Q Consensus       151 -~~--~~l~LTgTP  161 (458)
                       +.  ..+++|-.|
T Consensus       135 Pp~~t~~iL~t~~~  148 (334)
T PRK07993        135 PPEKTWFFLACREP  148 (334)
T ss_pred             CCCCEEEEEECCCH
T ss_conf             99884999866985


No 208
>PRK06871 DNA polymerase III subunit delta'; Validated
Probab=96.77  E-value=0.014  Score=33.81  Aligned_cols=108  Identities=11%  Similarity=0.099  Sum_probs=57.8

Q ss_pred             CCCHHHHHHHHHHH---HCCC----EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             87478999999999---6798----0999588998689999999999975999499991604656999999998558888
Q gi|255764515|r    2 NLAPHQTKIVDWIL---DHKR----CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSH   74 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~---~~~~----~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~   74 (458)
                      -|||||...-+.+.   ..+|    .++..+.|+||+..|..++..+.=......   .|-..     ...+..+....+
T Consensus         1 ~lYPWl~~~~~~l~~~~~~~r~~HA~L~~G~~G~Gk~~la~~~a~~llC~~~~~~---~~Cg~-----C~sC~l~~~g~H   72 (324)
T PRK06871          1 ALYPWLQPIYQQITQTFLQGRGHHALLFKADSGLGTEQLIRALAQWLMCQAPGDE---QPCGQ-----CHSCHLFQAGNH   72 (324)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCC---CCCCC-----CHHHHHHHCCCC
T ss_conf             9888657999999999986995437876899997899999999999828999999---98888-----989999973899


Q ss_pred             CEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCC---CCCCCCEEECCCCCCC
Q ss_conf             159998589789888730779869980642023344200---0113220440453100
Q gi|255764515|r   75 MNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK---GTWPFATIVVDESTKL  129 (458)
Q Consensus        75 ~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~l  129 (458)
                      .++..+......            -+..+.++.+.+...   ..-.+..+|||+||.+
T Consensus        73 PD~~~i~~~~~k------------~I~vd~IR~l~~~~~~~~~~g~~KV~iI~~ae~m  118 (324)
T PRK06871         73 PDFHILEPIDGK------------DIGVDQVREINEKVSQFAQQGGNKVVYIQGAERL  118 (324)
T ss_pred             CCEEEEECCCCC------------CCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHH
T ss_conf             987998467888------------7889999999999864622059669997588885


No 209
>PRK07133 DNA polymerase III subunits gamma and tau; Validated
Probab=96.76  E-value=0.012  Score=34.17  Aligned_cols=123  Identities=15%  Similarity=0.178  Sum_probs=56.2

Q ss_pred             HHHHHHHHH---HCCC----EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             999999999---6798----099958899868999999999997599949999160465699999999855888815999
Q gi|255764515|r    7 QTKIVDWIL---DHKR----CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         7 Q~~~v~~~~---~~~~----~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      |..++..+.   ..++    .|+..+-|+|||-+|.+++..+.-.+.....  -|.....     +    .....+++.-
T Consensus        23 Qe~Vv~tL~nAI~~gRIaHAYLF~GPRGvGKTT~ARIfAKaLNC~~~~d~~--~pC~~C~-----~----~~~~s~DViE   91 (718)
T PRK07133         23 QDHIIETLKNIIKSGKISHAYLFSGPHGTGKTSVAKIFANALNCSHKTDLI--EPCQNCI-----E----NFNNNLDIIE   91 (718)
T ss_pred             CHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCC--CCCCCHH-----H----CCCCCCCEEE
T ss_conf             599999999999749975058623899868899999999996799999999--9770214-----3----0478987377


Q ss_pred             EECCHHHHHHHHCCCCCEEEECCCCHHHHHHHC---CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH-CCCEEE
Q ss_conf             858978988873077986998064202334420---0011322044045310024654311567777665430-598079
Q gi|255764515|r   80 ITGTVKQRTKVLKTPAVLYVINFENLGWLVQEL---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFI  155 (458)
Q Consensus        80 ~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~---~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~-~~~~~l  155 (458)
                      +.+.+...              .+.++.+.+..   -...+|...|+||||.+.       ..++.++.+.-. -+++++
T Consensus        92 IDAASn~g--------------VDdIReLie~v~y~P~~gkYKVyIIDEvHMLS-------~~AfNALLKtLEEPP~hvv  150 (718)
T PRK07133         92 MDAASNNG--------------VDEIRELRENVKNLPQISKYKIYIIDEVHMLS-------KSAFNALLKTLEEPPKHVI  150 (718)
T ss_pred             ECCCCCCC--------------HHHHHHHHHHHCCCCCCCCEEEEEEECCCCCC-------HHHHHHHHHHHCCCCCCCE
T ss_conf             54556688--------------89999999982558877872499996620079-------9999999985027987827


Q ss_pred             EECCCC
Q ss_conf             965840
Q gi|255764515|r  156 ELTGTP  161 (458)
Q Consensus       156 ~LTgTP  161 (458)
                      .+=||.
T Consensus       151 FILaTT  156 (718)
T PRK07133        151 FILATT  156 (718)
T ss_pred             EEEEEC
T ss_conf             999708


No 210
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=96.74  E-value=0.0032  Score=37.78  Aligned_cols=37  Identities=19%  Similarity=0.175  Sum_probs=28.6

Q ss_pred             EECCCCCHHHHHHHHHHHHHHCCCCCEEEEEC-CHHHH
Q ss_conf             95889986899999999999759994999916-04656
Q gi|255764515|r   23 WASMGSGKTVSVLTALSYIHLWGEKSVLVIAP-LRVAQ   59 (458)
Q Consensus        23 ~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P-~~l~~   59 (458)
                      -+.+|+|||+++-+++.+...+|-+..|..|- +++++
T Consensus         3 ~matgsgkt~~ma~lil~~y~kgyr~flffvnq~nile   40 (812)
T COG3421           3 EMATGSGKTLVMAGLILECYKKGYRNFLFFVNQANILE   40 (812)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHCHHHEEEEECCHHHHH
T ss_conf             43358870059999999999734041899852116888


No 211
>PRK07471 DNA polymerase III subunit delta'; Validated
Probab=96.72  E-value=0.012  Score=34.21  Aligned_cols=111  Identities=13%  Similarity=0.154  Sum_probs=51.6

Q ss_pred             HHHHHHHH---HHCCC----EEEEECCCCCHHHHHHHHHHHHHHCCCCC---------EEEEECCHHHHHHHHHHHHHHC
Q ss_conf             99999999---96798----09995889986899999999999759994---------9999160465699999999855
Q gi|255764515|r    7 QTKIVDWI---LDHKR----CAIWASMGSGKTVSVLTALSYIHLWGEKS---------VLVIAPLRVAQSVWTSEVQRWS   70 (458)
Q Consensus         7 Q~~~v~~~---~~~~~----~ll~~~~G~GKT~~al~~~~~l~~~~~~~---------~LIv~P~~l~~~~W~~Ei~kf~   70 (458)
                      |..+++.+   +..++    .|+..+.|.|||-.|..++..+.-.+...         .+-+.|..-    -.+.+.   
T Consensus        22 qe~~~~~L~~a~~~grl~HA~Lf~Gp~GiGK~tlA~~~A~~ll~~~~~~~~~~~~~~~~l~~~~~~p----~~r~i~---   94 (363)
T PRK07471         22 HAAAEAALLDAYRSGRLHHAWLIGGPQGIGKATLAYRMARFLLATPPPGGDAVFPPPASLAVDPDHP----VARRIA---   94 (363)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCC----HHHHHH---
T ss_conf             1999999999998599764587679998188999999999985799977777678705312587772----899995---


Q ss_pred             CCCCCEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCC---CCCCCCEEECCCCCCC
Q ss_conf             8888159998589789888730779869980642023344200---0113220440453100
Q gi|255764515|r   71 NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK---GTWPFATIVVDESTKL  129 (458)
Q Consensus        71 ~~~~~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~l  129 (458)
                      ...+.++..+.-..........     -.|+.+.++.+.+.+.   ..-.|..+||||+|.+
T Consensus        95 ~~~hpdl~~i~r~~d~k~~~~~-----~~I~Vd~iR~l~~~~~~~p~~g~~kV~IId~ad~m  151 (363)
T PRK07471         95 AGAHGGLLTLERSWNEKGKRLR-----TVITVDEVRETIGFFGLTAAEGGWRVVIVDTADEM  151 (363)
T ss_pred             CCCCCCEEEEECCCCCCCCCCC-----CCCCHHHHHHHHHHHCCCCCCCCCEEEEEECHHHH
T ss_conf             2699984667620011333212-----44539999999999724852489669998687873


No 212
>KOG0738 consensus
Probab=96.70  E-value=0.0092  Score=34.96  Aligned_cols=10  Identities=0%  Similarity=0.056  Sum_probs=5.2

Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999985
Q gi|255764515|r   60 SVWTSEVQRW   69 (458)
Q Consensus        60 ~~W~~Ei~kf   69 (458)
                      ++|..+...|
T Consensus        67 k~i~~~~~~~   76 (491)
T KOG0738          67 KQIVRDLRDL   76 (491)
T ss_pred             HHHHHHHHHH
T ss_conf             9998778861


No 213
>PRK06090 DNA polymerase III subunit delta'; Validated
Probab=96.68  E-value=0.022  Score=32.63  Aligned_cols=109  Identities=12%  Similarity=0.039  Sum_probs=58.5

Q ss_pred             CCCCHHHHHHHHHHHH---CCC----EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             9874789999999996---798----099958899868999999999997599949999160465699999999855888
Q gi|255764515|r    1 MNLAPHQTKIVDWILD---HKR----CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFS   73 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~---~~~----~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~   73 (458)
                      +.||||+...-+.+..   .+|    .++..+.|+||+-.|..++..+.=.....    -|-..     ...+..+....
T Consensus         2 ~~~YPWl~~~~~~l~~~~~~~rl~HA~L~~g~~G~Gk~~la~~la~~LlC~~~~~----~~Cg~-----C~sC~l~~~g~   72 (319)
T PRK06090          2 NNDYPWLVPVWQNWKSGLDAERIPGALLLQSDEGLGVESLVELFSHALLCQNYQS----EACGF-----CHSCELMKSGN   72 (319)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCC----CCCCC-----CHHHHHHHCCC
T ss_conf             9889883799999999998699630676679998579999999999980899999----98877-----87799987589


Q ss_pred             CCEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCC---CCCCCCEEECCCCCCC
Q ss_conf             8159998589789888730779869980642023344200---0113220440453100
Q gi|255764515|r   74 HMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK---GTWPFATIVVDESTKL  129 (458)
Q Consensus        74 ~~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~l  129 (458)
                      +.+++.+.-.....           .++.+.++.+.+...   ..-.+..+|||+||.+
T Consensus        73 HPD~~~i~pe~~~k-----------~I~vd~IR~l~~~~~~~~~~g~~KV~iI~~ae~m  120 (319)
T PRK06090         73 HPDLHVIKPEKEGK-----------SITVEQIRQCNRLAQESSQLGGYRLFVIEPADAM  120 (319)
T ss_pred             CCCCEEEECCCCCC-----------CCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHC
T ss_conf             99823661233567-----------6879999999999754521069369998144434


No 214
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277   This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. The proteins in this entry are found exclusively in the archaea. Several members may be found in a genome and interact with each other..
Probab=96.59  E-value=0.037  Score=31.30  Aligned_cols=126  Identities=21%  Similarity=0.084  Sum_probs=66.3

Q ss_pred             CHHHHHHHHHH----HH-C---CCEEEEECCCCCHHHHHHHHHHHHHHCCCC--CE-EEEEC-----CHHHHHHHHHHHH
Q ss_conf             47899999999----96-7---980999588998689999999999975999--49-99916-----0465699999999
Q gi|255764515|r    4 APHQTKIVDWI----LD-H---KRCAIWASMGSGKTVSVLTALSYIHLWGEK--SV-LVIAP-----LRVAQSVWTSEVQ   67 (458)
Q Consensus         4 ~p~Q~~~v~~~----~~-~---~~~ll~~~~G~GKT~~al~~~~~l~~~~~~--~~-LIv~P-----~~l~~~~W~~Ei~   67 (458)
                      |+-|.+.+...    +. +   .+.+|...+|+|||.++-.++..|......  -. +.++-     -+... +=..++.
T Consensus        22 RdeqI~~l~~~L~~~l~PG~~P~Ni~iYGkTGtGKT~vt~~v~~~l~~~~~~~d~~D~~~~~~NC~~~~T~y-~~~~~L~  100 (383)
T TIGR02928        22 RDEQIEELAKALRPILRPGSRPSNIFIYGKTGTGKTAVTKYVMKELEEAAEDRDVRDVSTVYINCQILDTSY-QVLVELA  100 (383)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHH-HHHHHHH
T ss_conf             678999999998875067489872588788898788999999999999862269971589997785468469-9999999


Q ss_pred             HHCCCCCCEE-EEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCC-CCCCCCEEECCCCCCC--CCCCCCCHHHHHHH
Q ss_conf             8558888159-998589789888730779869980642023344200-0113220440453100--24654311567777
Q gi|255764515|r   68 RWSNFSHMNI-SVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK-GTWPFATIVVDESTKL--KSFRLRQGSKTARA  143 (458)
Q Consensus        68 kf~~~~~~~~-~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~-~~~~~~~iIiDEaH~l--kn~~~~~~s~~~~~  143 (458)
                      ......+... ...+|-+..+                .+..+.+.+. .....-+||+||-=+|  ++......|+..=.
T Consensus       101 ~~ln~~~~~~~vP~tG~s~~~----------------~~~~l~~~l~~~~~~~~~ivLDEiD~Lv~~~~d~PAyS~~LY~  164 (383)
T TIGR02928       101 NQLNRRGSGEEVPTTGLSTSE----------------VFRELYKELNRERGDSLIIVLDEIDKLVRKDDDDPAYSKLLYQ  164 (383)
T ss_pred             HHHCCCCCCCCCCCCCCCHHH----------------HHHHHHHHHHHHCCCEEEEEECCCCHHHCCCCCCHHHHHHHHH
T ss_conf             985157788889887787899----------------9999999983201887999862310221588888078788534


Q ss_pred             HHH
Q ss_conf             665
Q gi|255764515|r  144 LAK  146 (458)
Q Consensus       144 l~~  146 (458)
                      |.+
T Consensus       165 L~R  167 (383)
T TIGR02928       165 LSR  167 (383)
T ss_pred             HHH
T ss_conf             331


No 215
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=96.58  E-value=0.0069  Score=35.72  Aligned_cols=40  Identities=23%  Similarity=0.127  Sum_probs=27.5

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             98099958899868999999999997599949999160465
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA   58 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~   58 (458)
                      ...++..++|+|||..+..++..+.... ..++.+.+....
T Consensus         3 ~~ill~G~~GsGKTtl~~~la~~~~~~~-~~v~~~~~~~~~   42 (148)
T smart00382        3 EVILIVGPPGSGKTTLARALARELGPPG-GGVIYIDGEDIL   42 (148)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHCCCC-CCEEEEEHHHHH
T ss_conf             7899999997029999999998726689-968998759989


No 216
>PRK07003 DNA polymerase III subunits gamma and tau; Validated
Probab=96.55  E-value=0.037  Score=31.34  Aligned_cols=112  Identities=13%  Similarity=0.092  Sum_probs=56.0

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      +|+...-|+|||-+|=.++..|+-....   --.|.+...+  ..||..   ...+++.-+.+.+....+-.        
T Consensus        41 ylf~G~rGvGKTt~aRi~Ak~lnC~~~~---~~~pcg~C~~--C~~i~~---g~~~d~iEiDaAS~~~vd~~--------  104 (816)
T PRK07003         41 YLFTGTRGVGKTTLSRIFAKALNCETGV---TSQPCGVCRA--CREIDE---GRFVDYVEMDAASNRGVDEM--------  104 (816)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCC---CCCCCCCCHH--HHHHHC---CCCCCEEEEECCCCCCHHHH--------
T ss_conf             7511789888889999999986789999---9897877555--787755---88775478635543576899--------


Q ss_pred             ECCCCHHHHHHH---CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH-HCCCEEEEECCC
Q ss_conf             806420233442---0001132204404531002465431156777766543-059807996584
Q gi|255764515|r  100 INFENLGWLVQE---LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA-WESERFIELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~---~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~-~~~~~~l~LTgT  160 (458)
                            +-+.+.   .-...+|+..||||+|.+.+       ..++++.|.- .-..++.++=||
T Consensus       105 ------r~l~~~~~y~p~~~r~KvyiiDEvHmls~-------~afnalLKtlEepP~hv~FilaT  156 (816)
T PRK07003        105 ------AALLERAVYAPVDARFKVYMIDEVHMLTN-------HAFNAMLKTLEEPPPHVKFILAT  156 (816)
T ss_pred             ------HHHHHHCCCCCCCCCEEEEEEECHHHCCH-------HHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             ------99998622478667447999841543399-------99999998403798664899955


No 217
>TIGR00604 rad3 DNA repair helicase (rad3); InterPro: IPR013020   All proteins in this family for which functions are known are DNA-DNA helicases that function in the initiation of transcription and nucleotide excision repair as part of the TFIIH complex. .
Probab=96.54  E-value=0.013  Score=33.98  Aligned_cols=134  Identities=10%  Similarity=0.204  Sum_probs=75.6

Q ss_pred             CHHHHHHCCC--CCEEEEHHHHHHHHHHH-----------------------HHCCCCCCCH-HHHHHHHHHHC----CC
Q ss_conf             2566541248--84034222367888664-----------------------1000265334-45899876424----58
Q gi|255764515|r  311 ALEVIIEKAN--AAPIIVAYHFNSDLARL-----------------------QKAFPQGRTL-DKDPCTIQEWN----EG  360 (458)
Q Consensus       311 ~l~~il~~~~--~~kviif~~~~~~~~~i-----------------------~~~~~~g~~~-~~r~~~i~~f~----~~  360 (458)
                      .|.++++-.+  +.-|++|+.|.-+-..+                       +..|.+..-. .+...+++.|+    +|
T Consensus       598 ~l~~~~~~~Pkk~Giv~FfpSY~yl~~~v~~W~~~gi~~~snesfWek~~~~K~if~E~~D~~~e~~~~~~~Y~~a~~~G  677 (813)
T TIGR00604       598 LLVELSKIIPKKDGIVVFFPSYSYLEQIVSTWKEMGILENSNESFWEKIEKKKLIFVETKDAPQETSDALERYKQAVSEG  677 (813)
T ss_pred             HHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHCC
T ss_conf             99999971588788789976389999999998753720100046899987487558608888788699999989998618


Q ss_pred             CCCEEEEEH-HHCCCCCCCCC-CCCEEEEECCCC-CH---------------------------------------HHHH
Q ss_conf             855899844-22111622001-785999908998-98---------------------------------------6864
Q gi|255764515|r  361 KIPLLFAHP-ASCGHGLNLQY-GGNILVFFSLWW-DL---------------------------------------EEHQ  398 (458)
Q Consensus       361 ~~~vli~s~-~~~~~GlnL~~-a~~~iI~~~~~w-n~---------------------------------------~~~~  398 (458)
                      +.-|||+=. .-.+||||+++ -++.||++.+|| |-                                       ....
T Consensus       678 rGA~LlsV~gGK~SEGIdF~d~~gRAVi~~GiPYPni~d~~~~~~~~~~a~~~~~~~~~~~~~~~qt~~fy~~~aMR~vn  757 (813)
T TIGR00604       678 RGAVLLSVAGGKVSEGIDFSDDLGRAVIMVGIPYPNIFDEEYTESRVLKARLEFLRDQYQIRENSQTKDFYEFDAMRAVN  757 (813)
T ss_pred             CCEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEECHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             87076332044220574454764676899821688875750550187898897753256214567777765558999998


Q ss_pred             HHHHHHHCCCCHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             45666620220203787752899998589968999999999999999998554137455
Q gi|255764515|r  399 QMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIH  457 (458)
Q Consensus       399 Q~~gRi~~~r~hR~Gq~~~v~v~~li~~~tide~i~~~~~~K~~~~~~~~~~~~~~~~~  457 (458)
                      ||+||+.|.+      ...-.||.+      |.| |.+...+.++-+.+.+.+.....+
T Consensus       758 Q~~GRviRh~------~Dyg~~~L~------D~R-Y~r~~~r~kLP~Wi~~~i~~~~~~  803 (813)
T TIGR00604       758 QAIGRVIRHK------DDYGSIVLL------DKR-YARSDKRKKLPKWIQDTIQSSDLN  803 (813)
T ss_pred             HHHHHHHCCC------CCCEEEEEE------ECC-CCCHHHHHHHHHHHHHHCCCCCCC
T ss_conf             8651342278------741268996------122-163323250138888405366776


No 218
>pfam12340 DUF3638 Protein of unknown function (DUF3638). This domain family is found in eukaryotes, and is approximately 230 amino acids in length. There are two conserved sequence motifs: LLE and NMG.
Probab=96.54  E-value=0.012  Score=34.37  Aligned_cols=78  Identities=18%  Similarity=0.241  Sum_probs=49.4

Q ss_pred             CCCCHHHHHHHHHHHH---CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             9874789999999996---7980999588998689999999999975999499991604656999999998558888159
Q gi|255764515|r    1 MNLAPHQTKIVDWILD---HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~---~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~   77 (458)
                      +-+||-|.+.+..+.+   +.+.+.-.-||-|||-..+=+++.....|..=+-+++|++++...-.-=-.++...-...+
T Consensus        22 iliR~~Q~~va~~~i~~~~~~n~v~QlnMGeGKTsVI~Pmla~~LAdg~~Lvr~vvp~~Ll~q~~~~L~~~lggll~r~v  101 (229)
T pfam12340        22 ILIRPVQVDVARAMISPSSGSNSVLQLNMGEGKTSVIVPMVAAVLADGSRLVRVIVPKPLLRQMAQMLQSRLGGLLGREI  101 (229)
T ss_pred             CEECHHHHHHHHHHHCCCCCCCEEEHHHCCCCCCEEEHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             65428999999998575578872201120699622437889999748884589982688999999999998642137705


Q ss_pred             E
Q ss_conf             9
Q gi|255764515|r   78 S   78 (458)
Q Consensus        78 ~   78 (458)
                      .
T Consensus       102 ~  102 (229)
T pfam12340       102 Y  102 (229)
T ss_pred             E
T ss_conf             9


No 219
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IPR010225   This entry represents HrpB, one of two related predicted DEAH-box ATP-dependent helicases of unknown function found in many proteobacteria, but also in a few species of other lineages. The member from Rhizobium meliloti, designated HelO, has been studied but is not essential for growth and mutants have no obvious phenotype . HrpB is typically about 800 residues in length, while its paralog HrpA (IPR010222 from INTERPRO), also uncharacterised, is about 1300 amino acids long. Related characterised eukaryotic proteins are RNA helicases associated with pre-mRNA processing ..
Probab=96.50  E-value=0.011  Score=34.53  Aligned_cols=147  Identities=16%  Similarity=0.129  Sum_probs=68.1

Q ss_pred             HHHHCCCEEEEECCCCCHHHHH-HHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHH-----CCCCC--CEEEEEECCH
Q ss_conf             9996798099958899868999-99999999759994999916046569999999985-----58888--1599985897
Q gi|255764515|r   13 WILDHKRCAIWASMGSGKTVSV-LTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRW-----SNFSH--MNISVITGTV   84 (458)
Q Consensus        13 ~~~~~~~~ll~~~~G~GKT~~a-l~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf-----~~~~~--~~~~~~~g~~   84 (458)
                      -+..++..+|-.++|.|||=.. |+++..=+.. .++|+++=|..+--    +-+..|     ....+  +.|.+=..++
T Consensus        13 al~~~~~vvL~APpGAGKsT~~PLaLL~~pW~~-~~kIimLEPRRlAA----R~~A~rlA~~LgE~VG~tVGyRvR~enk   87 (858)
T TIGR01970        13 ALAAHPQVVLEAPPGAGKSTAVPLALLDAPWLI-GGKIIMLEPRRLAA----RSAAQRLASQLGEEVGDTVGYRVRLENK   87 (858)
T ss_pred             HHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHC-CCEEEEECCHHHHH----HHHHHHHHHHHCCCCCCCCCEEEECCCC
T ss_conf             861176506416722471105889976626434-88078747447899----9999999997088988620405771132


Q ss_pred             HHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCC--CCCCCCCCHHHHHHHHHHHHHC-CCEEEEECCCC
Q ss_conf             89888730779869980642023344200011322044045310--0246543115677776654305-98079965840
Q gi|255764515|r   85 KQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTK--LKSFRLRQGSKTARALAKPAWE-SERFIELTGTP  161 (458)
Q Consensus        85 ~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~--lkn~~~~~~s~~~~~l~~~~~~-~~~~l~LTgTP  161 (458)
                            .-..-.+=|+|=--+.+....-=....-++|||||-|.  +...-  .-+-....-..+... .=++++||||-
T Consensus        88 ------Vs~~TRlEvVTEGiLTRMlQ~DP~L~GVg~liFDEFHERsL~aDL--aLALaLdVQs~LRdDPPLkil~MSATL  159 (858)
T TIGR01970        88 ------VSARTRLEVVTEGILTRMLQDDPELEGVGLLIFDEFHERSLDADL--ALALALDVQSALRDDPPLKILIMSATL  159 (858)
T ss_pred             ------CCCCCCEEEEECCHHHHHCCCCCCCCCCCEEEECHHHHHHHHHHH--HHHHHHHHHHHHCCCCCCEEHHCCCCC
T ss_conf             ------587754578723268774016888453523231102243467889--999988533431068640000000263


Q ss_pred             HHHHCCCHHHH
Q ss_conf             23100101346
Q gi|255764515|r  162 SPNGLIDLWGQ  172 (458)
Q Consensus       162 i~n~~~el~~l  172 (458)
                      =..++.+|.+.
T Consensus       160 dg~rLs~LL~~  170 (858)
T TIGR01970       160 DGERLSSLLPD  170 (858)
T ss_pred             HHHHHHHHCCC
T ss_conf             27999974330


No 220
>KOG0740 consensus
Probab=96.49  E-value=0.007  Score=35.71  Aligned_cols=47  Identities=15%  Similarity=0.246  Sum_probs=33.0

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             9809995889986899999999999759994999916046569999999985
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRW   69 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf   69 (458)
                      +..||+.++|+|||+.+.+++.+.    .-...=|.|.++. +.|.-|.+|.
T Consensus       187 rglLLfGPpgtGKtmL~~aiAsE~----~atff~iSassLt-sK~~Ge~eK~  233 (428)
T KOG0740         187 RGLLLFGPPGTGKTMLAKAIATES----GATFFNISASSLT-SKYVGESEKL  233 (428)
T ss_pred             CHHHEECCCCCCHHHHHHHHHHHH----CCEEEECCHHHHH-HHCCCHHHHH
T ss_conf             111200589884479999998620----6657630688865-3246707789


No 221
>PRK08691 DNA polymerase III subunits gamma and tau; Validated
Probab=96.44  E-value=0.047  Score=30.67  Aligned_cols=112  Identities=14%  Similarity=0.119  Sum_probs=55.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      +|+...-|+|||-+|-.++..|+-.....   -.|.....+  ..+|..   ....++.-+...+....+-         
T Consensus        41 ylf~G~rGvGKTt~Ari~Ak~lNC~~~~~---~~pCg~C~~--C~~i~~---g~~~D~~EiDaAs~~~vdd---------  103 (704)
T PRK08691         41 YLLTGTRGVGKTTIARILAKSLNCENAQH---GEPCGVCQS--CTQIDA---GRYVDLLEIDAASNTGIDN---------  103 (704)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCC---CCCCCCCHH--HHHHHC---CCCCCEEEEECCCCCCHHH---------
T ss_conf             75027898788899999999967999999---997877776--787855---8998747742454458899---------


Q ss_pred             ECCCCHHHHHHHC---CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH-HCCCEEEEECCC
Q ss_conf             8064202334420---001132204404531002465431156777766543-059807996584
Q gi|255764515|r  100 INFENLGWLVQEL---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA-WESERFIELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~~---~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~-~~~~~~l~LTgT  160 (458)
                           ++.+.+..   -...+|+..||||+|.+.+       ..+.++.|.- .-..+++++=+|
T Consensus       104 -----~R~l~~~~~y~P~~~~yKVyiiDEvhmLs~-------~afNAlLKtLEEPP~~v~FilaT  156 (704)
T PRK08691        104 -----IREVLENAQYAPTAGKYKVYIIDEVHMLSK-------SAFNAMLKTLEEPPEHVKFILAT  156 (704)
T ss_pred             -----HHHHHHHCCCCCCCCCEEEEEEECHHHCCH-------HHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             -----999998534688678535999831544389-------99999998614797560899854


No 222
>PRK08853 DNA polymerase III subunits gamma and tau; Validated
Probab=96.42  E-value=0.032  Score=31.66  Aligned_cols=113  Identities=16%  Similarity=0.089  Sum_probs=54.9

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      +|+...-|+|||-+|=.++..|+-.....   -.|.....+  ..+|..   ...+++.-+.+.+....+-         
T Consensus        41 ylf~G~rGvGKTt~ARi~Ak~lNC~~~~~---~~pcg~C~~--C~~i~~---g~~~d~~EiDaAs~~~vdd---------  103 (717)
T PRK08853         41 YLFSGTRGVGKTTIGRLFAKGLNCETGIT---STPCGQCAT--CKEIDE---GRFVDLLEIDAASRTKVED---------  103 (717)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCC---CCCCCCCCC--HHHHHC---CCCCCEEEECCCCCCCHHH---------
T ss_conf             76108898889899999999867899999---997888702--676744---7877524540565678899---------


Q ss_pred             ECCCCHHHHHHH---CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH-CCCEEEEECCCC
Q ss_conf             806420233442---00011322044045310024654311567777665430-598079965840
Q gi|255764515|r  100 INFENLGWLVQE---LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTP  161 (458)
Q Consensus       100 ~s~e~~~~~~~~---~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~-~~~~~l~LTgTP  161 (458)
                           ++-+.+.   .-...+|+..||||+|.+.+       ..++++.|.-. -..++.++=||-
T Consensus       104 -----~rel~~~~~y~p~~~~yKvyiiDEvHmls~-------~afnAlLKtlEEPP~hv~FilaTT  157 (717)
T PRK08853        104 -----TRELLDNVQYKPARGRFKVYLIDEVHMLSR-------HSFNALLKTLEEPPEYVKFLLATT  157 (717)
T ss_pred             -----HHHHHHHCCCCCCCCCEEEEEEECHHHCCH-------HHHHHHHHHHCCCCCCEEEEEECC
T ss_conf             -----999998555488778547999830544389-------999999876037875648998438


No 223
>TIGR01074 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752    RepA hexameric DNA helicase contain ATP-binding domains similar to those seen in monomeric helicases but which are arranged in a ring. There is compelling evidence to suggest that a single ssDNA molecule passes through the centre of the hexameric ring. Activity of the enzyme is based upon two separate but coupled activities, ssDNA translocation and duplex destabilisation, and is driven by energy derived from the continuous ATP-binding and hydrolysis events that take place in the active-site cleft. The resulting conformational changes that accompany these events underpin the coupling process and allow the helicase to translocate along the DNA, destabilizing the duplex and separating the two strands in an active process  ; GO: 0004003 ATP-dependent DNA helicase activity, 0006268 DNA unwinding during replication, 0005737 cytoplasm.
Probab=96.40  E-value=0.0084  Score=35.21  Aligned_cols=41  Identities=27%  Similarity=0.468  Sum_probs=32.7

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             9874789999999996798099958899868999999999997
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL   43 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~   43 (458)
                      ++|.|-|.+||+++  .|=||+.+.=|+|||-.-+.=|.+|..
T Consensus         2 ~~LNp~Q~~AV~Y~--~GPlLVLAGAGSGKT~VI~~KIayLi~   42 (677)
T TIGR01074         2 SKLNPQQQEAVEYV--GGPLLVLAGAGSGKTRVITNKIAYLIQ   42 (677)
T ss_pred             CCCCHHHHHHHHHH--CCCCEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             88874379999861--587146517777863578889999875


No 224
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763    This entry represents the well-conserved first N-terminal domain of DnaX, approx. 365 aa. The full-length product of the dnaX gene in Escherichia coli encodes the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the extreme thermophile Thermus thermophilis.; GO: 0003887 DNA-directed DNA polymerase activity, 0005524 ATP binding, 0006260 DNA replication, 0009360 DNA polymerase III complex.
Probab=96.40  E-value=0.037  Score=31.34  Aligned_cols=125  Identities=19%  Similarity=0.260  Sum_probs=67.5

Q ss_pred             HHHHHHHH---HHCC---CEEEE-ECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             99999999---9679---80999-58899868999999999997599949999160465699999999855888815999
Q gi|255764515|r    7 QTKIVDWI---LDHK---RCAIW-ASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV   79 (458)
Q Consensus         7 Q~~~v~~~---~~~~---~~ll~-~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~   79 (458)
                      |.-.|.-|   +.++   .+.|+ .+=|+|||=+|=.+|..|+=.+...    -|-+.-.+  ..||.   ....+++.-
T Consensus        19 Q~~iv~tL~NAi~~~ri~HAYLF~GpRGtGKTS~ARIfAKaLNC~~~~~----~PCn~C~~--C~~i~---~g~~~DviE   89 (363)
T TIGR02397        19 QEHIVKTLKNAIKNGRIAHAYLFSGPRGTGKTSIARIFAKALNCQGPDG----EPCNECES--CKEIN---SGSSLDVIE   89 (363)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCC----CCCCCCCH--HHHHH---CCCCCCEEE
T ss_conf             1799999999997189662345028599763558999999865887877----87777502--27765---289866688


Q ss_pred             EECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCC---CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEE
Q ss_conf             8589789888730779869980642023344200---0113220440453100246543115677776654305-98079
Q gi|255764515|r   80 ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK---GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFI  155 (458)
Q Consensus        80 ~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l  155 (458)
                      +.|.+..-.+              -++.+.+...   ...+|..=||||+|.+       ++.+++++.|.-.. +++++
T Consensus        90 iDAASN~gVD--------------~IR~l~e~v~y~P~~~kYKvYIIDEVHML-------S~~AFNALLKTLEEPP~hV~  148 (363)
T TIGR02397        90 IDAASNNGVD--------------DIRELRENVKYAPSKGKYKVYIIDEVHML-------SKSAFNALLKTLEEPPEHVV  148 (363)
T ss_pred             ECCCCCCCHH--------------HHHHHHHHHCCCCCCCCCCEEEEECCCCC-------CHHHHHHHHHHHCCCCCCEE
T ss_conf             6486568788--------------99999873036875544335887323028-------65689998765227987628


Q ss_pred             EECCCC
Q ss_conf             965840
Q gi|255764515|r  156 ELTGTP  161 (458)
Q Consensus       156 ~LTgTP  161 (458)
                      +.=||.
T Consensus       149 FIlATT  154 (363)
T TIGR02397       149 FILATT  154 (363)
T ss_pred             EEEECC
T ss_conf             887348


No 225
>PRK05564 DNA polymerase III subunit delta'; Validated
Probab=96.33  E-value=0.039  Score=31.16  Aligned_cols=36  Identities=19%  Similarity=0.185  Sum_probs=23.6

Q ss_pred             HHHHHHHH---HHCC---C-EEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             99999999---9679---8-09995889986899999999999
Q gi|255764515|r    7 QTKIVDWI---LDHK---R-CAIWASMGSGKTVSVLTALSYIH   42 (458)
Q Consensus         7 Q~~~v~~~---~~~~---~-~ll~~~~G~GKT~~al~~~~~l~   42 (458)
                      |..++..+   +..+   . .|+..+-|+|||..|.+++..+.
T Consensus         9 q~~i~~~L~~~i~~~rl~HAyLF~Gp~G~GK~~~A~~~A~~ll   51 (313)
T PRK05564          9 HENIKNRIDNSIIKGKFSHASLIVGEDGIGKSILAKEIANKIL   51 (313)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             2999999999998799875043279998509999999999982


No 226
>pfam05707 Zot Zonular occludens toxin (Zot). This family consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot). Zot is elaborated by bacteriophages present in toxigenic strains of Vibrio cholerae. Zot is a single polypeptide chain of 44.8 kDa, with the ability to reversibly alter intestinal epithelial tight junctions, allowing the passage of macromolecules through mucosal barriers
Probab=96.19  E-value=0.027  Score=32.16  Aligned_cols=43  Identities=21%  Similarity=0.179  Sum_probs=24.4

Q ss_pred             CEEECCCCCCCCCCCCCCHH--HHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             20440453100246543115--67777665430598079965840
Q gi|255764515|r  119 ATIVVDESTKLKSFRLRQGS--KTARALAKPAWESERFIELTGTP  161 (458)
Q Consensus       119 ~~iIiDEaH~lkn~~~~~~s--~~~~~l~~~~~~~~~~l~LTgTP  161 (458)
                      .+||+||||++=+.+.....  .....+...+...--++++|=-|
T Consensus        72 ~liViDE~~~~~~~r~~~~~~~~~i~~l~~HRH~G~DiiliTQ~~  116 (183)
T pfam05707        72 ALLVIDEAQTWFPSRRGGDKVPPVLDAFSTHRHLGWDIILITQNP  116 (183)
T ss_pred             CEEEEECCHHHCCCCCCCCCCCHHHHHHHHCCCCCCEEEEEECCH
T ss_conf             799998976554887778888389999998077882089991897


No 227
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=96.18  E-value=0.082  Score=29.21  Aligned_cols=25  Identities=16%  Similarity=0.143  Sum_probs=13.5

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             968999999999999999998554137
Q gi|255764515|r  428 TIDELVLQRLRTKSTIQDLLLNALKKE  454 (458)
Q Consensus       428 tide~i~~~~~~K~~~~~~~~~~~~~~  454 (458)
                      .|=+.|..  .....+.+.++++..+.
T Consensus       383 ~VPeDi~~--a~~~~l~~~~l~g~~~~  407 (412)
T PRK05703        383 RVPDDIKV--ATPEELVRLALGGFLKC  407 (412)
T ss_pred             CCHHHHHC--CCHHHHHHHHHCCCCCC
T ss_conf             97243422--89999999985875556


No 228
>PRK07994 DNA polymerase III subunits gamma and tau; Validated
Probab=96.17  E-value=0.076  Score=29.42  Aligned_cols=109  Identities=19%  Similarity=0.211  Sum_probs=56.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCH-----HHHHHHHCC
Q ss_conf             099958899868999999999997-59994999916046569999999985588881599985897-----898887307
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHL-WGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV-----KQRTKVLKT   93 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~-~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~-----~~r~~~~~~   93 (458)
                      +|+...-|+|||-+|-.++..|+- .|..    -.|.....+  ..+|..   ...+++.-+.+.+     .-|. ++..
T Consensus        41 ylf~G~rG~GKtt~ari~ak~lnc~~~~~----~~pcg~c~~--c~~i~~---g~~~d~~eidaas~~~vd~~re-l~~~  110 (643)
T PRK07994         41 YLFSGTRGVGKTSIARLLAKGLNCETGIT----ATPCGVCDN--CREIEQ---GRFVDLIEIDAASRTKVEDTRD-LLDN  110 (643)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCC----CCCCCCCHH--HHHHHC---CCCCCEEEEECCCCCCHHHHHH-HHHH
T ss_conf             87458998888899999999967999999----997876776--898865---8988758863677788899999-9984


Q ss_pred             CCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEEECCC
Q ss_conf             798699806420233442000113220440453100246543115677776654305-9807996584
Q gi|255764515|r   94 PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFIELTGT  160 (458)
Q Consensus        94 ~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l~LTgT  160 (458)
                            +.|         .-..-+|...||||+|.+.+       ..++++.|.-.. ..++.++=||
T Consensus       111 ------~~y---------~p~~~r~kvyiidEvhmls~-------~afnalLKtlEePp~hv~filaT  156 (643)
T PRK07994        111 ------VQY---------APARGRFKVYLIDEVHMLSR-------HSFNALLKTLEEPPAHVKFLLAT  156 (643)
T ss_pred             ------CCC---------CCCCCCEEEEEEECHHHCCH-------HHHHHHHHHHCCCCHHCEEEEEC
T ss_conf             ------466---------88778536999722101589-------99999998623786100899860


No 229
>KOG0925 consensus
Probab=96.11  E-value=0.01  Score=34.72  Aligned_cols=51  Identities=10%  Similarity=0.143  Sum_probs=25.8

Q ss_pred             CCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH-C-CCEEEEECCCCHHHHCCCHH
Q ss_conf             1322044045310024654311567777665430-5-98079965840231001013
Q gi|255764515|r  116 WPFATIVVDESTKLKSFRLRQGSKTARALAKPAW-E-SERFIELTGTPSPNGLIDLW  170 (458)
Q Consensus       116 ~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~-~-~~~~l~LTgTPi~n~~~el~  170 (458)
                      -.|..||+||||.=    +-.+.-....+..... + --+++.+|||--......+|
T Consensus       158 ~~y~viiLDeahER----tlATDiLmGllk~v~~~rpdLk~vvmSatl~a~Kfq~yf  210 (699)
T KOG0925         158 GRYGVIILDEAHER----TLATDILMGLLKEVVRNRPDLKLVVMSATLDAEKFQRYF  210 (699)
T ss_pred             CCCCEEEECHHHHH----HHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHC
T ss_conf             53007995316666----678999999999998619881699940601259999870


No 230
>pfam05970 DUF889 PIF1 helicase. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated.
Probab=96.11  E-value=0.031  Score=31.76  Aligned_cols=46  Identities=22%  Similarity=0.076  Sum_probs=27.6

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHH--HHHHHHHHCC
Q ss_conf             8899868999999999997599949999160465699--9999998558
Q gi|255764515|r   25 SMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSV--WTSEVQRWSN   71 (458)
Q Consensus        25 ~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~--W~~Ei~kf~~   71 (458)
                      +=|+|||..--+++..+... ...+++.||+.+....  .-..+..|+.
T Consensus         2 ~AGTGKS~ll~~i~~~l~~~-~~~v~vtA~TGiAA~~i~gG~TiHs~~g   49 (418)
T pfam05970         2 YGGTGKTFLWNALSARIRSR-GKIVLNVASSGIAALLLPGGRTAHSRFG   49 (418)
T ss_pred             CCCCCHHHHHHHHHHHHHHC-CCEEEEECCHHHHHHCCCCCEEHHHCCC
T ss_conf             79887999999999999768-9889998968999851699873985269


No 231
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=96.10  E-value=0.053  Score=30.39  Aligned_cols=42  Identities=19%  Similarity=0.222  Sum_probs=28.2

Q ss_pred             CHHHHHHHHHHH----HC---CCEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             478999999999----67---9809995889986899999999999759
Q gi|255764515|r    4 APHQTKIVDWIL----DH---KRCAIWASMGSGKTVSVLTALSYIHLWG   45 (458)
Q Consensus         4 ~p~Q~~~v~~~~----~~---~~~ll~~~~G~GKT~~al~~~~~l~~~~   45 (458)
                      |.-|.+.+...+    .+   ++.++..++|+|||.++-.++..+....
T Consensus        35 Re~Ei~~l~~~l~~~l~g~~~~n~~I~G~pGTGKT~~vk~v~~~l~~~~   83 (394)
T PRK00411         35 REEQIEELAFALRPALRGSRPSNVLILGPPGTGKTTTVKKVFEELEEAA   83 (394)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHC
T ss_conf             5999999999999997599998479988999989999999999999746


No 232
>PRK06835 DNA replication protein DnaC; Validated
Probab=96.08  E-value=0.014  Score=33.95  Aligned_cols=18  Identities=11%  Similarity=0.158  Sum_probs=7.4

Q ss_pred             CCEEEEHHHHHHHHHHHHH
Q ss_conf             8403422236788866410
Q gi|255764515|r  321 AAPIIVAYHFNSDLARLQK  339 (458)
Q Consensus       321 ~~kviif~~~~~~~~~i~~  339 (458)
                      |..|+ |......++.+..
T Consensus       211 g~sVi-y~ta~~L~~~l~~  228 (330)
T PRK06835        211 GKTVI-YRTSDELIENLRE  228 (330)
T ss_pred             CCEEE-EEEHHHHHHHHHH
T ss_conf             99499-9629999999999


No 233
>pfam04466 Terminase_3 Phage terminase large subunit. Initiation of packaging of double-stranded viral DNA involves the specific interaction of the prohead with viral DNA in a process mediated by a phage-encoded terminase protein. The terminase enzymes are usually hetero-oligomers composed of a small and a large subunit. This region is found on the large subunit and possess an endonuclease and ATPase activity that require Mg2+ and a neutral or slightly basic reaction. This region is also found in bacterial sequences.
Probab=96.07  E-value=0.093  Score=28.89  Aligned_cols=131  Identities=12%  Similarity=0.141  Sum_probs=56.5

Q ss_pred             CCEEEEECCCCCHHHH-HHHHHHHHHHCCCCCEEEEECC--HHHHHHH---HHHHHHHCCCCCCEEEEEECCHHHHHHHH
Q ss_conf             9809995889986899-9999999997599949999160--4656999---99999855888815999858978988873
Q gi|255764515|r   18 KRCAIWASMGSGKTVS-VLTALSYIHLWGEKSVLVIAPL--RVAQSVW---TSEVQRWSNFSHMNISVITGTVKQRTKVL   91 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~-al~~~~~l~~~~~~~~LIv~P~--~l~~~~W---~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~   91 (458)
                      +.-++...-|+|||.. |+.++...... ..++|++-+.  ++-.+.|   ...+..+    ++......+.+.-.....
T Consensus         3 r~~v~~GGrgsgKS~~~a~~~i~~~~~~-~~~~l~~r~~~~slr~sv~~~~~~~i~~~----~~~~~~~~~~s~~~i~~~   77 (387)
T pfam04466         3 RYKVAKGGRGSGKSYHIALKLVLKLLMH-PRTNLVIREVKNTIEDSVFTQLQEALSML----GLDHEFKISKSPIEITVK   77 (387)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHHHHHHC----CCCCEEEECCCCEEEEEC
T ss_conf             6899990888679999999999999878-98699997556889999999999999976----997348973761489987


Q ss_pred             CCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH-HCCCEEEEECCCCHH
Q ss_conf             077986998064202334420001132204404531002465431156777766543-059807996584023
Q gi|255764515|r   92 KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA-WESERFIELTGTPSP  163 (458)
Q Consensus        92 ~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~-~~~~~~l~LTgTPi~  163 (458)
                      .....|.+..-+..    ..+.....++.+.+|||..+..   ....+.   +..+. ......+.+|.+|..
T Consensus        78 ~~gs~i~f~G~d~~----~~iks~~~i~~~~~eEa~~~~~---~~~~~l---~~~~r~~~~~~~i~~~~NP~~  140 (387)
T pfam04466        78 INGSKFLFYGMDDP----AKIKSIKDVSDAWIEEAAEFKT---EDFDQL---IPTIRRPKPGSEIFMSFNPVN  140 (387)
T ss_pred             CCCCEEEEEECCCH----HHHHCCCCCEEEEEECHHHCCH---HHHHHH---HHHHCCCCCCEEEEEECCCCC
T ss_conf             89969999857896----8841636614999941244799---899999---988531788719999828999


No 234
>KOG0742 consensus
Probab=96.04  E-value=0.091  Score=28.95  Aligned_cols=23  Identities=9%  Similarity=0.108  Sum_probs=9.7

Q ss_pred             HHHCCCCCCCHHHHHHHHHH--HCCC
Q ss_conf             41000265334458998764--2458
Q gi|255764515|r  337 LQKAFPQGRTLDKDPCTIQE--WNEG  360 (458)
Q Consensus       337 i~~~~~~g~~~~~r~~~i~~--f~~~  360 (458)
                      ++++-..+++.+.|. .++.  |..|
T Consensus       456 LceRnktymSEaqRs-aLNAlLfRTG  480 (630)
T KOG0742         456 LCERNKTYMSEAQRS-ALNALLFRTG  480 (630)
T ss_pred             HHHHCCCCCCHHHHH-HHHHHHHHCC
T ss_conf             987520102588999-9988987625


No 235
>PRK07276 DNA polymerase III subunit delta'; Validated
Probab=95.99  E-value=0.082  Score=29.24  Aligned_cols=132  Identities=16%  Similarity=0.175  Sum_probs=64.1

Q ss_pred             CCCCHHHHHHHHHH---HHCC---CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             98747899999999---9679---80999588998689999999999975999499991604656999999998558888
Q gi|255764515|r    1 MNLAPHQTKIVDWI---LDHK---RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSH   74 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~---~~~~---~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~   74 (458)
                      |+|...|-..++.+   ++++   .+.|+.. |.||+-.|..++..+.-......   .|....     ..+.++....+
T Consensus         1 m~~~~~Qp~i~~~l~~~i~~~rl~HAyLf~G-~~Gk~~~A~~~A~~l~C~~~~~~---~pCg~C-----~~C~~i~~~~h   71 (290)
T PRK07276          1 MDLAQKQPKLFQRFQTILEQDRLNHAYLFSG-DFASFEMALFLAQSLFCEQKEDV---LPCGHC-----RSCRLIEQGDF   71 (290)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCEEEECCC-CCCHHHHHHHHHHHHHCCCCCCC---CCCCCC-----HHHHHHHCCCC
T ss_conf             9877878999999999998499650542169-86879999999999818999998---989889-----99999876999


Q ss_pred             CEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCC---CCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             1599985897898887307798699806420233442000---1132204404531002465431156777766543059
Q gi|255764515|r   75 MNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG---TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWES  151 (458)
Q Consensus        75 ~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~---~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~  151 (458)
                      .++..+....+             .+..+.++.+.+.+..   .-++..+|||+||.+ |      ..+..++.|.-...
T Consensus        72 pDv~~i~~~~~-------------~I~vd~IR~l~~~~~~~~~~g~~KV~II~~Ad~m-t------~~AaNaLLK~LEEP  131 (290)
T PRK07276         72 SDVTVIEPQGQ-------------VIKTDTIRELTANFSQSGYEGKRQVFIIKDADKM-H------VNAANSLLKVIEEP  131 (290)
T ss_pred             CCCEEECCCCC-------------CCCHHHHHHHHHHHHHCCCCCCEEEEEECCHHHC-C------HHHHHHHHHHHCCC
T ss_conf             87137716777-------------5768899999999844561378279997765652-9------99999999970389


Q ss_pred             -C--EEEEECCCC
Q ss_conf             -8--079965840
Q gi|255764515|r  152 -E--RFIELTGTP  161 (458)
Q Consensus       152 -~--~~l~LTgTP  161 (458)
                       .  +.+++|-.|
T Consensus       132 p~~t~~iLlt~~~  144 (290)
T PRK07276        132 QSEIYIFLLTNDE  144 (290)
T ss_pred             CCCCEEEEEECCH
T ss_conf             8883799887992


No 236
>CHL00181 cbbX CbbX; Provisional
Probab=95.98  E-value=0.1  Score=28.65  Aligned_cols=104  Identities=16%  Similarity=0.172  Sum_probs=52.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCC---CCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCC
Q ss_conf             8099958899868999999999997599---9499991604656999999998558888159998589789888730779
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPA   95 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~---~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~   95 (458)
                      +.++...||+|||-.|-.++..+..-|.   ..++-+.+..++. .+..                 .+...-...+..  
T Consensus        61 h~vF~GnPGTGKTTVARl~a~il~~lG~L~~g~vve~~r~dLvg-~yvG-----------------~Ta~kt~~~i~~--  120 (287)
T CHL00181         61 HMSFTGSPGTGKTTVALKMADILYRLGYIKKGHLITVTRDDLVG-QYIG-----------------HTAPKTKEVLKK--  120 (287)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHCC-CCCC-----------------CCHHHHHHHHHH--
T ss_conf             38887899867999999999999986995589589953588416-3535-----------------216999999996--


Q ss_pred             CEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCC--HHHHHHHHHHHHH--CCCEEEEECCCCH
Q ss_conf             86998064202334420001132204404531002465431--1567777665430--5980799658402
Q gi|255764515|r   96 VLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQ--GSKTARALAKPAW--ESERFIELTGTPS  162 (458)
Q Consensus        96 ~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~--~s~~~~~l~~~~~--~~~~~l~LTgTPi  162 (458)
                                          -.-..++|||||.+-+..+..  +......+.+...  ..+.++.+.|-|-
T Consensus       121 --------------------a~GGVLfIDEAY~L~~~~~~~dfg~eaidtLl~~me~~~~~lvvI~AGY~~  171 (287)
T CHL00181        121 --------------------AMGGVLFIDEAYYLYKPDNERDYGAEAIEILLQVMENQRDDLVVIFAGYKD  171 (287)
T ss_pred             --------------------CCCCEEEEECHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHH
T ss_conf             --------------------459879982446535788999837999999999987079988999846789


No 237
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms]
Probab=95.98  E-value=0.0077  Score=35.46  Aligned_cols=13  Identities=0%  Similarity=0.153  Sum_probs=5.6

Q ss_pred             EEECCCCCHHHHH
Q ss_conf             9958899868999
Q gi|255764515|r   22 IWASMGSGKTVSV   34 (458)
Q Consensus        22 l~~~~G~GKT~~a   34 (458)
                      |+.+.|.||++..
T Consensus        29 l~G~~~~~l~l~e   41 (348)
T COG1702          29 LFGPTDTNLSLLE   41 (348)
T ss_pred             HCCCCCCCHHHHH
T ss_conf             0188985378999


No 238
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]
Probab=95.98  E-value=0.039  Score=31.15  Aligned_cols=111  Identities=19%  Similarity=0.152  Sum_probs=52.6

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEEE
Q ss_conf             99958899868999999999997599949999160465699999999855888815999858978988873077986998
Q gi|255764515|r   21 AIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVI  100 (458)
Q Consensus        21 ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i~  100 (458)
                      ++..+|.+|||-..|-.+..... ...+++|..|+.--... ..++...... ......+.+....              
T Consensus         8 ~i~gpM~SGKT~eLl~r~~~~~~-~g~~v~vfkp~iD~R~~-~~~V~Sr~G~-~~~A~~i~~~~~i--------------   70 (201)
T COG1435           8 FIYGPMFSGKTEELLRRARRYKE-AGMKVLVFKPAIDTRYG-VGKVSSRIGL-SSEAVVIPSDTDI--------------   70 (201)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHH-CCCEEEEEECCCCCCCC-CCEEEECCCC-CCCCEECCCHHHH--------------
T ss_conf             99715768635999999999997-59808998525335356-4336531587-6653563875789--------------


Q ss_pred             CCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             064202334420001132204404531002465431156777766543059807996584
Q gi|255764515|r  101 NFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus       101 s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                          +. .........+.+.|.+||||.+..       ...-.+..+...-...+++.|.
T Consensus        71 ----~~-~i~~~~~~~~~~~v~IDEaQF~~~-------~~v~~l~~lad~lgi~Vi~~GL  118 (201)
T COG1435          71 ----FD-EIAALHEKPPVDCVLIDEAQFFDE-------ELVYVLNELADRLGIPVICYGL  118 (201)
T ss_pred             ----HH-HHHHCCCCCCCCEEEEEHHHHCCH-------HHHHHHHHHHHHCCCEEEEECC
T ss_conf             ----99-998513478757899961671897-------8999999998614988999544


No 239
>PRK10865 protein disaggregation chaperone; Provisional
Probab=95.97  E-value=0.045  Score=30.80  Aligned_cols=26  Identities=23%  Similarity=0.103  Sum_probs=19.4

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             98099958899868999999999997
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHL   43 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~   43 (458)
                      ++-+|..|+|.|||..+=+++..+..
T Consensus       200 NNpiLvGepGVGKTAIvEGLA~rI~~  225 (857)
T PRK10865        200 NNPVLIGEPGVGKTAIVEGLAQRIIN  225 (857)
T ss_pred             CCCEEECCCCCCHHHHHHHHHHHHHC
T ss_conf             99758789998899999999999983


No 240
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461    Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=95.95  E-value=0.11  Score=28.55  Aligned_cols=83  Identities=23%  Similarity=0.301  Sum_probs=42.8

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEE-EEECCH-----HHHHHHH
Q ss_conf             9809995889986899999999999759994999916046569999999985588881599-985897-----8988873
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS-VITGTV-----KQRTKVL   91 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~-~~~g~~-----~~r~~~~   91 (458)
                      +|=|+..|+|.|||-++=.+|...-. + .++    |..|. +         ...+.++-. .+.|++     .+|.+  
T Consensus       230 NNPl~VGEPGVGKTAI~EGLA~~I~~-~-~kv----Pe~Lk-n---------~~IY~LDmG~LLAGTKYRGDFE~RLK--  291 (774)
T TIGR02639       230 NNPLLVGEPGVGKTAIVEGLAQRIAE-G-QKV----PEVLK-N---------AKIYSLDMGTLLAGTKYRGDFEERLK--  291 (774)
T ss_pred             CCCCEECCCCCCHHHHHHHHHHHHHC-C-CCC----CHHHC-C---------CCEEEECHHHHHHHCCCCCHHHHHHH--
T ss_conf             88720448886448999999998641-5-646----70024-7---------83454043456410245424789999--


Q ss_pred             CCCCCEEEECCCCHHHHHHHCCCCCCCC-EEECCCCCCCCCCCC
Q ss_conf             0779869980642023344200011322-044045310024654
Q gi|255764515|r   92 KTPAVLYVINFENLGWLVQELKGTWPFA-TIVVDESTKLKSFRL  134 (458)
Q Consensus        92 ~~~~~i~i~s~e~~~~~~~~~~~~~~~~-~iIiDEaH~lkn~~~  134 (458)
                                     ....++.. .+-. .|-|||-|.|=+.++
T Consensus       292 ---------------~V~~Ei~~-~~~anILFIDEIHTIVGAGA  319 (774)
T TIGR02639       292 ---------------AVVSEIEK-EPNANILFIDEIHTIVGAGA  319 (774)
T ss_pred             ---------------HHHHHHHC-CCCCCEEEEECCCCEEECCC
T ss_conf             ---------------99999852-89995466411010331787


No 241
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.87  E-value=0.11  Score=28.50  Aligned_cols=115  Identities=13%  Similarity=0.126  Sum_probs=56.8

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCC--CCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCE
Q ss_conf             099958899868999999999997599--949999160465699999999855888815999858978988873077986
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVL   97 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~--~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i   97 (458)
                      +|+...=|.|||-+|=.++..|+-.+.  ..-.--.|.+...+  ..||..   ...+++.-+.+.+....+.       
T Consensus        41 ylf~G~rGvGKTt~ari~Ak~lnc~~~~~~~g~~~~pcg~C~~--C~~i~~---g~~~d~~EiDaas~~~v~~-------  108 (721)
T PRK12323         41 YLFTGTRGVGKTTLSRILAKSLNCTGPDGEGGITAQPCGQCRA--CTEIDA---GRFVDYIEMDAASNRGVDE-------  108 (721)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHH--HHHHHC---CCCCCEEEEECCCCCCHHH-------
T ss_conf             7502799888989999999997689986678987887877654--687756---8987647743676788899-------


Q ss_pred             EEECCCCHHHHHHH---CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH-HCCCEEEEECCC
Q ss_conf             99806420233442---0001132204404531002465431156777766543-059807996584
Q gi|255764515|r   98 YVINFENLGWLVQE---LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA-WESERFIELTGT  160 (458)
Q Consensus        98 ~i~s~e~~~~~~~~---~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~-~~~~~~l~LTgT  160 (458)
                             ++.+.+.   .-..-+|+.-||||+|.+.+       ..++++.|.- .-..++.++=||
T Consensus       109 -------~r~l~~~~~y~P~~~~~KvyiiDevhmls~-------~afnalLKtlEePP~hv~FilaT  161 (721)
T PRK12323        109 -------MAQLLDQAVYAPTAGRFKVYMIDEVHMLTN-------HAFNAMLKTLEEPPPHVKFILAT  161 (721)
T ss_pred             -------HHHHHHHCCCCCCCCCEEEEEEECCCCCCH-------HHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             -------999998545588766446999854000589-------99999998401797553899943


No 242
>PRK06964 DNA polymerase III subunit delta'; Validated
Probab=95.85  E-value=0.12  Score=28.30  Aligned_cols=40  Identities=15%  Similarity=0.078  Sum_probs=29.6

Q ss_pred             CCHHHHHHHHHHHHC----CC-EEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             747899999999967----98-09995889986899999999999
Q gi|255764515|r    3 LAPHQTKIVDWILDH----KR-CAIWASMGSGKTVSVLTALSYIH   42 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~----~~-~ll~~~~G~GKT~~al~~~~~l~   42 (458)
                      +||||...-+.+...    +. .|+..+-|+||.-.|..++..+.
T Consensus         2 ~yPW~~~~w~~l~~~~~rl~HA~Lf~Gp~G~Gk~~lA~~~A~~ll   46 (342)
T PRK06964          2 IYPWQTDDWNRLQALRARWPHALLLHGQAGIGKLAFAQHLAQGLL   46 (342)
T ss_pred             CCCCCHHHHHHHHHCCCCHHEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             988556999999980687130576579998679999999999983


No 243
>KOG0737 consensus
Probab=95.84  E-value=0.046  Score=30.77  Aligned_cols=47  Identities=23%  Similarity=0.283  Sum_probs=27.0

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             9809995889986899999999999759994999916046569999999985
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRW   69 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf   69 (458)
                      .+.||..++|+|||..|-+.+..   .|...+=|-+  +.+.+-|..|-+|.
T Consensus       128 kGiLL~GPpG~GKTmlAKA~Ake---aga~fInv~~--s~lt~KWfgE~eKl  174 (386)
T KOG0737         128 KGILLYGPPGTGKTMLAKAIAKE---AGANFINVSV--SNLTSKWFGEAQKL  174 (386)
T ss_pred             CCCEECCCCCCHHHHHHHHHHHH---CCCCCCEEEC--CCCCHHHHHHHHHH
T ss_conf             43051189982188999999987---2797100013--65532667778889


No 244
>PRK04296 thymidine kinase; Provisional
Probab=95.84  E-value=0.056  Score=30.23  Aligned_cols=34  Identities=29%  Similarity=0.379  Sum_probs=26.2

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             99958899868999999999997599949999160
Q gi|255764515|r   21 AIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL   55 (458)
Q Consensus        21 ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~   55 (458)
                      ++..+|.+|||-..|..+..+... .++++++.|.
T Consensus         6 ~i~GpMfSGKTteLi~~~~~~~~~-gkkvl~~kp~   39 (197)
T PRK04296          6 FIYGAMNSGKSTELLQRAYNYEER-GMKVLVFTPA   39 (197)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHC-CCEEEEEEEC
T ss_conf             999342788899999999999987-9959999853


No 245
>KOG0739 consensus
Probab=95.81  E-value=0.068  Score=29.71  Aligned_cols=103  Identities=15%  Similarity=0.208  Sum_probs=53.5

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEE
Q ss_conf             80999588998689999999999975999499991604656999999998558888159998589789888730779869
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLY   98 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~   98 (458)
                      +.||+.++|+||++.|=+.+..    ......-|. .|-+.+.|.-|-+|..                 .+++       
T Consensus       168 giLLyGPPGTGKSYLAKAVATE----AnSTFFSvS-SSDLvSKWmGESEkLV-----------------knLF-------  218 (439)
T KOG0739         168 GILLYGPPGTGKSYLAKAVATE----ANSTFFSVS-SSDLVSKWMGESEKLV-----------------KNLF-------  218 (439)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH----CCCCEEEEE-HHHHHHHHHCCHHHHH-----------------HHHH-------
T ss_conf             5788679997577999998741----477068730-1788998732179999-----------------9999-------


Q ss_pred             EECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHH--------HHHHCCCEEEEECCCCH
Q ss_conf             98064202334420001132204404531002465431156777766--------54305980799658402
Q gi|255764515|r   99 VINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA--------KPAWESERFIELTGTPS  162 (458)
Q Consensus        99 i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~--------~~~~~~~~~l~LTgTPi  162 (458)
                                 +.-. ..+...|.|||...+.+.++...|..+|.+.        ........++.|-||-+
T Consensus       219 -----------emAR-e~kPSIIFiDEiDslcg~r~enEseasRRIKTEfLVQMqGVG~d~~gvLVLgATNi  278 (439)
T KOG0739         219 -----------EMAR-ENKPSIIFIDEIDSLCGSRSENESEASRRIKTEFLVQMQGVGNDNDGVLVLGATNI  278 (439)
T ss_pred             -----------HHHH-HCCCCEEEEEHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC
T ss_conf             -----------9987-34994798634444326887771177777777888764066658886489723788


No 246
>PRK08699 DNA polymerase III subunit delta'; Validated
Probab=95.78  E-value=0.1  Score=28.68  Aligned_cols=112  Identities=14%  Similarity=0.103  Sum_probs=56.8

Q ss_pred             CCHHHHHHHHHHHHC----CCE-EEEECCCCCHHHHHHHHHHHHHHCC----CCCEEEEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             747899999999967----980-9995889986899999999999759----9949999160465699999999855888
Q gi|255764515|r    3 LAPHQTKIVDWILDH----KRC-AIWASMGSGKTVSVLTALSYIHLWG----EKSVLVIAPLRVAQSVWTSEVQRWSNFS   73 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~----~~~-ll~~~~G~GKT~~al~~~~~l~~~~----~~~~LIv~P~~l~~~~W~~Ei~kf~~~~   73 (458)
                      +||||...-..+...    +.+ |+..+.|.||+-.|..++..+.=..    ..+. =-|+          .+..|....
T Consensus         2 iypW~~~~w~~l~~~~~rl~HA~L~~Gp~G~Gk~~~A~~~A~~llC~~~~~~~~~C-g~C~----------sC~~~~~g~   70 (325)
T PRK08699          2 IYPWHQEQWRQIAEHWERRPNAWLFVGKKGTGKTAFARFAAKALLCETPAPGCKPC-GECM----------SCHLFGQGS   70 (325)
T ss_pred             CCCCCHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCC-CCCH----------HHHHHHCCC
T ss_conf             88745799999998344501179757999978999999999998289998889989-8888----------899986599


Q ss_pred             CCEEEEEECCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCC---CCCCCEEECCCCCCC
Q ss_conf             81599985897898887307798699806420233442000---113220440453100
Q gi|255764515|r   74 HMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG---TWPFATIVVDESTKL  129 (458)
Q Consensus        74 ~~~~~~~~g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~---~~~~~~iIiDEaH~l  129 (458)
                      +.++..+.-......+    ......|..+.++.+.+....   .-.+..+|||+||.+
T Consensus        71 HPD~~~i~p~~~~~~~----g~~~~~I~idqiR~l~~~~~~~~~~~~~kV~ii~~ae~m  125 (325)
T PRK08699         71 HPDFYEITPLADEPEN----GRKLLQIKIDAVREIIDNVYLTSVRGGLRVILIHPAESM  125 (325)
T ss_pred             CCCEEEEECCCCCCCC----CCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEECCHHHH
T ss_conf             9996885134453001----665566769999999999710865689469998577775


No 247
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=95.69  E-value=0.036  Score=31.38  Aligned_cols=40  Identities=10%  Similarity=0.198  Sum_probs=18.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHH
Q ss_conf             809995889986899999999999759994999916046569999
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWT   63 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~   63 (458)
                      +.||..++|+|||+.|=+++...    ..+.+-|.+..++ +.|.
T Consensus       168 GvLLyGPPGtGKTllAkAvA~e~----~~~fi~v~~s~l~-sk~v  207 (390)
T PRK03992        168 GVLLYGPPGTGKTLLAKAVAHET----NATFIRVVGSELV-QKFI  207 (390)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH----CCCEEEEEHHHHH-HCCC
T ss_conf             27868989997899999999874----8887996679975-2454


No 248
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=95.68  E-value=0.058  Score=30.14  Aligned_cols=25  Identities=24%  Similarity=0.150  Sum_probs=18.8

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9809995889986899999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIH   42 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~   42 (458)
                      ++.+|..|+|.|||..+=+++..+.
T Consensus       195 NNpiLVGepGVGKTAIvEGLA~rI~  219 (852)
T TIGR03346       195 NNPVLIGEPGVGKTAIVEGLAQRIV  219 (852)
T ss_pred             CCCCEECCCCCCHHHHHHHHHHHHH
T ss_conf             8972127999879999999999986


No 249
>PRK07952 DNA replication protein DnaC; Validated
Probab=95.65  E-value=0.062  Score=29.94  Aligned_cols=40  Identities=23%  Similarity=0.264  Sum_probs=28.5

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             80999588998689999999999975999499991604656
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ   59 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~   59 (458)
                      +.++..++|+|||..|.+++..+...|. +++.++-..++.
T Consensus        98 gLlF~G~~GTGKThLA~aIan~Li~~G~-sVlf~t~~dLl~  137 (242)
T PRK07952         98 SFIFSGKPGTGKNHLAAAICNELLLRGK-SVLIITVADIMS  137 (242)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCC-EEEEEEHHHHHH
T ss_conf             1799789999789999999999998799-499977999999


No 250
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=95.64  E-value=0.079  Score=29.31  Aligned_cols=42  Identities=21%  Similarity=0.275  Sum_probs=27.3

Q ss_pred             CCCHHHHHHH---HHHHHC---CC-EEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             8747899999---999967---98-099958899868999999999997
Q gi|255764515|r    2 NLAPHQTKIV---DWILDH---KR-CAIWASMGSGKTVSVLTALSYIHL   43 (458)
Q Consensus         2 ~L~p~Q~~~v---~~~~~~---~~-~ll~~~~G~GKT~~al~~~~~l~~   43 (458)
                      ++.|+|...-   .|....   +. .|+..++|+|||-.|.+++..+.-
T Consensus         2 ~~~~~~~~~~~l~~~~~~~~~~~halL~~Gp~G~Gktt~a~~lA~~l~~   50 (325)
T COG0470           2 ELVPWQEAVKRLLVQALESGRLPHALLFYGPPGVGKTTAALALAKELLC   50 (325)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             6433235899999999865888761003799999789999999999658


No 251
>pfam00004 AAA ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.
Probab=95.63  E-value=0.042  Score=30.95  Aligned_cols=35  Identities=14%  Similarity=0.217  Sum_probs=22.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             099958899868999999999997599949999160465
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA   58 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~   58 (458)
                      .||..++|+|||..|-+++..+    ..+++.|.+..+.
T Consensus         1 iLl~GppGtGKT~~a~~la~~~----~~~~~~v~~~~~~   35 (131)
T pfam00004         1 LLLYGPPGTGKTTLAKAVAKEL----GAPFIEISGSELV   35 (131)
T ss_pred             CEEECCCCCCHHHHHHHHHHHH----CCCCEECCCCCCC
T ss_conf             9878999999999999999997----8985332420122


No 252
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed
Probab=95.61  E-value=0.14  Score=27.84  Aligned_cols=112  Identities=14%  Similarity=0.109  Sum_probs=55.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      +|+...=|.|||-+|=.++..|+-...   .--.|.+...+  ..||.   ....+++.-+.+.+....+-         
T Consensus        41 ~l~~g~rg~gkt~~ar~~ak~lnc~~~---~~~~pc~~c~~--c~~i~---~~~~~d~~e~d~as~~~v~~---------  103 (705)
T PRK05648         41 YLFTGTRGVGKTTIARIIAKCLNCETG---VSSTPCGECSV--CREID---EGRFVDLIEVDAASRTKVED---------  103 (705)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCC---CCCCCCCCCHH--HHHHH---CCCCCCEEEECCCCCCCHHH---------
T ss_conf             650078988898999999998677899---98897877600--46662---48977634451554478899---------


Q ss_pred             ECCCCHHHHHHH--C-CCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH-CCCEEEEECCC
Q ss_conf             806420233442--0-0011322044045310024654311567777665430-59807996584
Q gi|255764515|r  100 INFENLGWLVQE--L-KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~--~-~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~-~~~~~l~LTgT  160 (458)
                           ++-+.+.  + -..-+|+..||||+|.+.+       ..++++.|.-. -..++.++=||
T Consensus       104 -----~r~~~~~~~~~p~~~~~kv~~idevhmls~-------~~fnallktleepp~~v~f~~at  156 (705)
T PRK05648        104 -----TRELLDNVQYAPTRGRYKVYLIDEVHMLSS-------HSFNALLKTLEEPPPHVKFLLAT  156 (705)
T ss_pred             -----HHHHHHHCCCCCCCCCEEEEEEEHHHHCCH-------HHHHHHHHHCCCCCCCEEEEEEC
T ss_conf             -----999998555177677457999842654179-------99999987404797545999842


No 253
>PRK11773 uvrD DNA-dependent helicase II; Provisional
Probab=95.58  E-value=0.022  Score=32.73  Aligned_cols=50  Identities=22%  Similarity=0.282  Sum_probs=36.0

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHH-CCCC--CEEEEE
Q ss_conf             874789999999996798099958899868999999999997-5999--499991
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL-WGEK--SVLVIA   53 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~-~~~~--~~LIv~   53 (458)
                      .|.|-|.+||...  .+..++.+..|+|||-+...-+.+|.. .+..  .+|+|+
T Consensus         9 ~LN~~Q~~AV~~~--~g~~lV~AGaGSGKT~vL~~Ria~Li~~~gv~p~~ILalT   61 (722)
T PRK11773          9 SLNDKQREAVAAP--LGNMLVLAGAGSGKTRVLVHRIAWLMQVENASPYSILAVT   61 (722)
T ss_pred             HCCHHHHHHHCCC--CCCEEEEECCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             2699999998099--9987999738715999999999999982999878828984


No 254
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional
Probab=95.58  E-value=0.15  Score=27.64  Aligned_cols=111  Identities=16%  Similarity=0.123  Sum_probs=54.9

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEE
Q ss_conf             099958899868999999999997-5999499991604656999999998558888159998589789888730779869
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHL-WGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLY   98 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~-~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~   98 (458)
                      +|+...=|.|||-+|=.++..|+- .|..    -.|.+...+  ..||..   ...+++.-+.+.+....+-.       
T Consensus        41 ylf~g~rg~gktt~ari~ak~lnc~~~~~----~~pcg~c~~--c~~i~~---g~~~d~~eidaas~~~v~~~-------  104 (696)
T PRK06872         41 YLFSGTRGVGKTSIARLFAKGLNCVHGVT----ATPCGECEN--CKAIEE---GNFIDLIEIDAASRTKVEDT-------  104 (696)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCC----CCCCCCCHH--HHHHHC---CCCCCEEEEECCCCCCHHHH-------
T ss_conf             75117898888899999999867899999----997888622--576744---78775467505655788999-------


Q ss_pred             EECCCCHHHHHHH---CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH-HCCCEEEEECCC
Q ss_conf             9806420233442---0001132204404531002465431156777766543-059807996584
Q gi|255764515|r   99 VINFENLGWLVQE---LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA-WESERFIELTGT  160 (458)
Q Consensus        99 i~s~e~~~~~~~~---~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~-~~~~~~l~LTgT  160 (458)
                             +-+.+.   .-..-+|+.-||||+|.+.+       ..++++.|.- .-..++.++=||
T Consensus       105 -------r~l~~~~~~~p~~~~~kvy~idevhmls~-------~~fnallktleepp~~v~f~lat  156 (696)
T PRK06872        105 -------RELLDNVQYKPVVGRFKVYLIDEVHMLSR-------HSFNALLKTLEEPPEYVKFLLAT  156 (696)
T ss_pred             -------HHHHHHCCCCCCCCCEEEEEEEHHHHCCH-------HHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             -------99998454577677547999700544389-------99999987502797544899843


No 255
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=95.54  E-value=0.06  Score=30.04  Aligned_cols=45  Identities=16%  Similarity=0.198  Sum_probs=29.4

Q ss_pred             CHHHHHHHHHHH----HC---CCEEEEECCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             478999999999----67---9809995889986899999999999759994
Q gi|255764515|r    4 APHQTKIVDWIL----DH---KRCAIWASMGSGKTVSVLTALSYIHLWGEKS   48 (458)
Q Consensus         4 ~p~Q~~~v~~~~----~~---~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~   48 (458)
                      |.-|.+.+...+    .+   .+.++...+|+|||.++-..+..+...-...
T Consensus        22 Re~ei~~l~~~l~~~~~~~~p~n~~iyG~~GTGKT~~~~~v~~~l~~~~~~~   73 (366)
T COG1474          22 REEEINQLASFLAPALRGERPSNIIIYGPTGTGKTATVKFVMEELEESSANV   73 (366)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             4889999999999985589986079988999873289999999997331567


No 256
>PRK07399 DNA polymerase III subunit delta'; Validated
Probab=95.50  E-value=0.16  Score=27.47  Aligned_cols=38  Identities=11%  Similarity=0.212  Sum_probs=25.7

Q ss_pred             HHHHHHHH---HHCC----CEEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             99999999---9679----80999588998689999999999975
Q gi|255764515|r    7 QTKIVDWI---LDHK----RCAIWASMGSGKTVSVLTALSYIHLW   44 (458)
Q Consensus         7 Q~~~v~~~---~~~~----~~ll~~~~G~GKT~~al~~~~~l~~~   44 (458)
                      |..+++.+   +..+    ..++..+-|+||+..|..++..+.-.
T Consensus         9 q~~~~~~L~~ai~~~rl~hAyLF~Gp~G~GK~~~A~~fa~~Ll~~   53 (314)
T PRK07399          9 QPLAIELLTAAIEQNRIAPAYLFAGPEGVGRKLAALRFIEGLLSQ   53 (314)
T ss_pred             CHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             499999999999859967448778999832999999999998578


No 257
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=95.48  E-value=0.16  Score=27.43  Aligned_cols=39  Identities=23%  Similarity=0.222  Sum_probs=27.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE----CCHHHH
Q ss_conf             0999588998689999999999975999499991----604656
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIA----PLRVAQ   59 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~----P~~l~~   59 (458)
                      .|+..++|+|||..|+-++......| .++|.++    |..++.
T Consensus         2 tLi~G~pGsGKT~~a~qfl~~~a~~g-e~~lyis~eE~~~~l~~   44 (187)
T cd01124           2 TLLSGGPGTGKTTFALQFLYAGLARG-EPGLYVTLEESPEELIE   44 (187)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCC-CCEEEEEECCCHHHHHH
T ss_conf             15876899999999999999998769-97899995079999999


No 258
>PRK06921 hypothetical protein; Provisional
Probab=95.43  E-value=0.068  Score=29.73  Aligned_cols=25  Identities=28%  Similarity=0.202  Sum_probs=11.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             0999588998689999999999975
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLW   44 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~   44 (458)
                      .++..++|+|||..+.+++..|...
T Consensus       119 l~f~G~~G~GKThLa~aIa~~Ll~~  143 (265)
T PRK06921        119 IALLGQPGSGKTHLLTAAANELMRK  143 (265)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             7997289898899999999999996


No 259
>PRK08939 primosomal protein DnaI; Reviewed
Probab=95.41  E-value=0.026  Score=32.28  Aligned_cols=45  Identities=18%  Similarity=0.263  Sum_probs=27.2

Q ss_pred             EEEEHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCC
Q ss_conf             0342223678886641000265334458998764245885589984422111
Q gi|255764515|r  323 PIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH  374 (458)
Q Consensus       323 kviif~~~~~~~~~i~~~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~  374 (458)
                      .-++|.++...+..+...|.+++..+    .++.+.  ++++|++- +-|+|
T Consensus       186 ~~v~~v~~p~~~~~lK~s~~d~s~~~----~i~~~k--~~~vLiLD-DiGaE  230 (306)
T PRK08939        186 VSSTLVHFPEFIRELKNAISDGSVKE----KIDAVK--EAPVLMLD-DIGAE  230 (306)
T ss_pred             CEEEEEEHHHHHHHHHHHHCCCCHHH----HHHHHH--CCCEEEEE-CCCCC
T ss_conf             92999875999999999864898899----999984--49989984-44654


No 260
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional
Probab=95.37  E-value=0.093  Score=28.89  Aligned_cols=79  Identities=16%  Similarity=0.180  Sum_probs=44.9

Q ss_pred             CHHHHHHCCCCCEEEEHHHHHHH---HHHHHH-----CCCCCCCHHHHHHHHH----HHCCCCCCEEEEEHHHCCCCCCC
Q ss_conf             25665412488403422236788---866410-----0026533445899876----42458855899844221116220
Q gi|255764515|r  311 ALEVIIEKANAAPIIVAYHFNSD---LARLQK-----AFPQGRTLDKDPCTIQ----EWNEGKIPLLFAHPASCGHGLNL  378 (458)
Q Consensus       311 ~l~~il~~~~~~kviif~~~~~~---~~~i~~-----~~~~g~~~~~r~~~i~----~f~~~~~~vli~s~~~~~~GlnL  378 (458)
                      .+.++++...| -.+.|+.+..+   .+.+..     .+.+|.  ..|...++    +|++++..||+++ .+-.||+|+
T Consensus       526 ~i~~~~~~~~g-~LVLFtS~~~l~~v~~~l~~~~~~~ll~Qg~--~~r~~ll~~f~~~~~~~~~svLlGt-~SFwEGVD~  601 (697)
T PRK11747        526 YLPELLEGHKG-SLVLFSSRRQMQKVADLLPGDLRLLLLVQGE--QPRQELLEKHKKRVDEGEGSVLFGL-QSFAEGLDL  601 (697)
T ss_pred             HHHHHHHHCCC-EEEEECHHHHHHHHHHHHHHHCCCCEEEECC--CCHHHHHHHHHHHHHCCCCEEEEEC-CCCCCCEEC
T ss_conf             99999985698-4999501999999999876634883899568--6599999999998616898299967-531266136


Q ss_pred             CC-CCCEEEEECCCCC
Q ss_conf             01-7859999089989
Q gi|255764515|r  379 QY-GGNILVFFSLWWD  393 (458)
Q Consensus       379 ~~-a~~~iI~~~~~wn  393 (458)
                      .. +...||..-+||.
T Consensus       602 pG~~L~~VII~kLPF~  617 (697)
T PRK11747        602 PGDYLTQVIITKIPFA  617 (697)
T ss_pred             CCCCEEEEEEECCCCC
T ss_conf             9878789999748999


No 261
>smart00492 HELICc3 helicase superfamily c-terminal domain.
Probab=95.36  E-value=0.03  Score=31.89  Aligned_cols=54  Identities=15%  Similarity=0.153  Sum_probs=35.9

Q ss_pred             CCCCCCCHHHHHHHHHHHCC-CCCCEEEEEHHHCCCCCCCCC-CCCEEEEECCCCCH
Q ss_conf             00265334458998764245-885589984422111622001-78599990899898
Q gi|255764515|r  340 AFPQGRTLDKDPCTIQEWNE-GKIPLLFAHPASCGHGLNLQY-GGNILVFFSLWWDL  394 (458)
Q Consensus       340 ~~~~g~~~~~r~~~i~~f~~-~~~~vli~s~~~~~~GlnL~~-a~~~iI~~~~~wn~  394 (458)
                      .|.++....+...++++|.+ ++.-||++. ...+||||+.. .++.+|...+|+-+
T Consensus        26 if~E~~~~~~~~~~l~~f~~~~~~avL~~v-g~~sEGIDf~~d~~r~vii~glPfp~   81 (141)
T smart00492       26 LLVQGEDGKETGKLLEKYVEACENAILLAT-ARFSEGVDFPGDYLRAVIIDGLPFPY   81 (141)
T ss_pred             EEECCCCCCHHHHHHHHHHHHCCCEEEEEE-CCCCCCEECCCCCEEEEEEECCCCCC
T ss_conf             998699922499999999983688099970-34334420598455699994478899


No 262
>PRK13342 recombination factor protein RarA; Reviewed
Probab=95.21  E-value=0.2  Score=26.90  Aligned_cols=29  Identities=17%  Similarity=0.355  Sum_probs=19.6

Q ss_pred             HHHHHC---CCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             999967---98099958899868999999999
Q gi|255764515|r   12 DWILDH---KRCAIWASMGSGKTVSVLTALSY   40 (458)
Q Consensus        12 ~~~~~~---~~~ll~~~~G~GKT~~al~~~~~   40 (458)
                      ..+++.   +.+++..++|+|||-.|-.++..
T Consensus        29 ~~~i~~~~~~s~Il~GPPG~GKTTlA~iiA~~   60 (417)
T PRK13342         29 RRMIEAGRLSSMILWGPPGTGKTTLARIIAGA   60 (417)
T ss_pred             HHHHHCCCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             99997699975998896999899999999998


No 263
>pfam03237 Terminase_6 Terminase-like family. This family represents a group of terminase proteins.
Probab=95.20  E-value=0.11  Score=28.35  Aligned_cols=133  Identities=21%  Similarity=0.160  Sum_probs=56.7

Q ss_pred             EECCCCCHHHHHHHHH-HHHHHCCCCCEEEEECCH--HHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             9588998689999999-999975999499991604--6569999999985588881599985897898887307798699
Q gi|255764515|r   23 WASMGSGKTVSVLTAL-SYIHLWGEKSVLVIAPLR--VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        23 ~~~~G~GKT~~al~~~-~~l~~~~~~~~LIv~P~~--l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      ....|+|||..+...+ ......+..+.+|++|+.  +....| ..+....+. ...+... ...+.. -.+.....+.+
T Consensus         3 ~ggr~~GKT~~~~~~~~~~a~~~~~~~~~i~~~t~~~~~~~~~-~~~~~~~~~-~~~~~~~-~~~~~~-i~~~nGs~i~~   78 (380)
T pfam03237         3 LGSRQSGKTFAFAREALRHALGNGPKNQIILSASKAQARLEFK-KGIIEIAGD-LLEITFE-EKNGNP-IILPNGAKLYF   78 (380)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHH-HHHHHHHHH-HCCCCEE-ECCCCE-EEECCCCEEEE
T ss_conf             2645252839999999999985899728999799999999999-999996688-6387167-278873-99159988999


Q ss_pred             ECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHH
Q ss_conf             806420233442000113220440453100246543115677776654305980799658402310
Q gi|255764515|r  100 INFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNG  165 (458)
Q Consensus       100 ~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~  165 (458)
                      .+.+.-... +. .-...++.+++||+-.+.+..   .+......... ......+.+|-||-+++
T Consensus        79 ~~~~~~~~~-~~-~rG~~~~~i~~DE~a~~~~~~---~~~~~~~~~~~-~~~~~~~~~stp~~~~~  138 (380)
T pfam03237        79 LGLESETTA-QG-YRGASIAGIYFDEATWLPKFQ---ESELVRRLRAT-KGKWRKTFFSTPPSPGH  138 (380)
T ss_pred             EECCCCCCH-HH-CCCCCCCEEEEEEHHHCCCHH---HHHHHHHHHCC-CCCCCEEEEECCCCCCC
T ss_conf             625776643-10-348545549983045366278---99998644104-79975799988989985


No 264
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=95.17  E-value=0.071  Score=29.59  Aligned_cols=25  Identities=24%  Similarity=0.134  Sum_probs=18.8

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9809995889986899999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIH   42 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~   42 (458)
                      .+-+|..++|.|||..+=+++..+.
T Consensus       209 NNPiLVGepGVGKTAIvEGLA~rI~  233 (852)
T TIGR03345       209 NNPILTGEAGVGKTAVVEGLALRIA  233 (852)
T ss_pred             CCCEEECCCCCCHHHHHHHHHHHHH
T ss_conf             9974657999879999999999997


No 265
>PRK08770 DNA polymerase III subunits gamma and tau; Validated
Probab=95.17  E-value=0.2  Score=26.83  Aligned_cols=111  Identities=15%  Similarity=0.128  Sum_probs=56.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEE
Q ss_conf             099958899868999999999997-5999499991604656999999998558888159998589789888730779869
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHL-WGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLY   98 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~-~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~   98 (458)
                      +|+...=|+|||-+|=.++..|+- .|..    -.|.....+  ..||..   ...+++.-+.+.+....+-.       
T Consensus        41 ~lf~g~rg~gkt~~ar~~a~~lnc~~~~~----~~pc~~c~~--c~~i~~---~~~~d~~e~daas~~~v~~~-------  104 (663)
T PRK08770         41 FLFTGTRGVGKTTIARIFAKSLNCETGTS----ADPCGQCPA--CLDIDA---GRYIDLLEIDAASNTGVDDV-------  104 (663)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCC----CCCCCCCHH--HHHHHC---CCCCCEEEEECCCCCCHHHH-------
T ss_conf             76227998888899999999867899999----997877877--898854---89886588646765888999-------


Q ss_pred             EECCCCHHHHHHH---CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH-HCCCEEEEECCC
Q ss_conf             9806420233442---0001132204404531002465431156777766543-059807996584
Q gi|255764515|r   99 VINFENLGWLVQE---LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA-WESERFIELTGT  160 (458)
Q Consensus        99 i~s~e~~~~~~~~---~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~-~~~~~~l~LTgT  160 (458)
                             +-+.+.   .-..-+|+.-||||+|.+.+       ..++++.|.- .-..++.++=||
T Consensus       105 -------r~~~~~~~~~p~~~~~kvy~idevhmls~-------~~fna~lktleepp~~v~f~~at  156 (663)
T PRK08770        105 -------REVIENAQYMPSRGKFKVYLIDEVHMLSK-------AAFNALLKTLEEPPEHVKFLLAT  156 (663)
T ss_pred             -------HHHHHHCCCCCCCCCEEEEEEECHHHCCH-------HHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             -------99998443588777436999700433289-------99999987402786442899854


No 266
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=95.13  E-value=0.073  Score=29.52  Aligned_cols=15  Identities=20%  Similarity=0.448  Sum_probs=7.8

Q ss_pred             CCCCCCEEEEEEEEC
Q ss_conf             378775289999858
Q gi|255764515|r  412 AGFKRAVFVYYLIAQ  426 (458)
Q Consensus       412 ~Gq~~~v~v~~li~~  426 (458)
                      -|.+...-||-++.-
T Consensus       433 ~Gy~GR~~I~E~l~~  447 (500)
T COG2804         433 SGYKGRTGIYEVLEI  447 (500)
T ss_pred             CCCCCCCEEEEEEEC
T ss_conf             776786046887507


No 267
>PRK09111 DNA polymerase III subunits gamma and tau; Validated
Probab=95.11  E-value=0.21  Score=26.72  Aligned_cols=113  Identities=13%  Similarity=0.146  Sum_probs=58.6

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCC----CCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCC
Q ss_conf             09995889986899999999999759----99499991604656999999998558888159998589789888730779
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWG----EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPA   95 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~----~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~   95 (458)
                      +++...=|+|||-+|=.++..|+-.+    .+++.  .|.....+  ..+|.   ...+++|.-+.+.+....+-.    
T Consensus        48 ~l~~g~rg~gktt~ari~a~~lnc~~~~~~~~~~~--~~c~~c~~--c~~i~---~~~~~d~~e~daas~~~v~~~----  116 (600)
T PRK09111         48 FMLTGVRGVGKTTTARILARALNYKGPDGVGGPTI--DPCGVGEH--CQAIM---EGRHVDVIEMDAASHTGVDDI----  116 (600)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC--CCCCCCHH--HHHHH---CCCCCCEEEEECCCCCCHHHH----
T ss_conf             76457898789999999999966988766689988--98998865--89886---689987588515545788899----


Q ss_pred             CEEEECCCCHHHHHHH---CCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH-CCCEEEEECCC
Q ss_conf             8699806420233442---00011322044045310024654311567777665430-59807996584
Q gi|255764515|r   96 VLYVINFENLGWLVQE---LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGT  160 (458)
Q Consensus        96 ~i~i~s~e~~~~~~~~---~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~-~~~~~l~LTgT  160 (458)
                                +.+.+.   .-...+|...|+||+|.+.       ...+.++.+.-. -..++.+.=||
T Consensus       117 ----------r~~~~~~~~~p~~~~~kv~iidevhmls-------~~afnallktleepp~~~~fi~at  168 (600)
T PRK09111        117 ----------REIIESVRYRPVSARYKVYIIDEVHMLS-------TAAFNALLKTLEEPPPHVKFIFAT  168 (600)
T ss_pred             ----------HHHHHHHCCCCCCCCEEEEEEECCCCCC-------HHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             ----------9999860538877754699960011057-------999999998762598654999962


No 268
>pfam00265 TK Thymidine kinase.
Probab=95.00  E-value=0.069  Score=29.69  Aligned_cols=35  Identities=23%  Similarity=0.186  Sum_probs=26.8

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCH
Q ss_conf             999588998689999999999975999499991604
Q gi|255764515|r   21 AIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLR   56 (458)
Q Consensus        21 ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~   56 (458)
                      ++..+|-+|||-..|..+..+... .+++|++.|..
T Consensus         5 ~i~GpMfsGKTteLi~~~~~~~~~-gkkvl~i~p~~   39 (175)
T pfam00265         5 LIIGPMFSGKSTELIRRVYRYQLA-QYKCVVIKYAI   39 (175)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHC-CCEEEEEEECC
T ss_conf             999251778999999999999987-99399994611


No 269
>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=95.00  E-value=0.23  Score=26.53  Aligned_cols=127  Identities=17%  Similarity=0.163  Sum_probs=55.0

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      .+++.++|.|||-+..-++..+..++ +++.+|+--+--. -=.+.++.|...-.+.+........- ...         
T Consensus         4 i~lvGptGvGKTTTiaKLAa~~~~~~-~~V~lit~Dt~R~-gA~eQL~~ya~~l~v~~~~~~~~~d~-~~~---------   71 (196)
T pfam00448         4 ILLVGLQGSGKTTTIAKLAAYLKKQG-KKVLLVAADTFRA-AAIEQLKQLAERLGVPVFGSGTGSDP-AAV---------   71 (196)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEECCCCCH-HHHHHHHHHHHHCCCEEEECCCCCCH-HHH---------
T ss_conf             99989999988999999999999779-9289997587768-89999999998639817814877787-899---------


Q ss_pred             ECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHC
Q ss_conf             8064202334420001132204404531002465431156777766543059807996584023100
Q gi|255764515|r  100 INFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGL  166 (458)
Q Consensus       100 ~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~  166 (458)
                           +..-.+. .....+|+|+||=+=+-  +.....-...+.+..........+.|+||--+...
T Consensus        72 -----~~~~l~~-~~~~~~D~IlIDTaGr~--~~d~~~~~el~~~~~~~~~~~~~LVl~a~~~~~~~  130 (196)
T pfam00448        72 -----AFDAVEK-AKAENYDVVLVDTAGRL--QNDKNLMDELKKIKRVIAPDEVLLVLDATTGQNAL  130 (196)
T ss_pred             -----HHHHHHH-HHHCCCCEEEEECCCCC--CCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHH
T ss_conf             -----9999999-88468999999899987--47677899999998522873028998567782137


No 270
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=94.99  E-value=0.23  Score=26.51  Aligned_cols=36  Identities=28%  Similarity=0.115  Sum_probs=26.8

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             099958899868999999999997599949999160
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL   55 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~   55 (458)
                      .+++..+|.|||..++.++..+......++++++.-
T Consensus        16 ~vi~a~~g~GKS~~~~~la~~~a~~~g~~V~~~SlE   51 (242)
T cd00984          16 IIIAARPSMGKTAFALNIAENIAKKQGKPVLFFSLE   51 (242)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             999968999999999999999999779959999333


No 271
>PRK11054 helD DNA helicase IV; Provisional
Probab=94.97  E-value=0.046  Score=30.76  Aligned_cols=52  Identities=27%  Similarity=0.391  Sum_probs=36.4

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCC---CCEEEEECCH
Q ss_conf             74789999999996798099958899868999999999997599---9499991604
Q gi|255764515|r    3 LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLR   56 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~---~~~LIv~P~~   56 (458)
                      |.|-|..||-  .+..+.|+.+..|+|||-+..+=+.+|...|.   ..+|.|+=+.
T Consensus       197 Ln~~Qr~Avi--~~ed~~LVLAGAGSGKT~vLt~RiayLI~~g~~~P~~ILaLTFT~  251 (684)
T PRK11054        197 LNPSQARAVV--NGEDSLLVLAGAGSGKTSVLVARAGWLLARGQAQPEQILLLAFGR  251 (684)
T ss_pred             CCHHHHHHEE--ECCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCHHHEEEEECCH
T ss_conf             9989995727--479964898338997077999999999975999866778686349


No 272
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]
Probab=94.91  E-value=0.078  Score=29.37  Aligned_cols=54  Identities=26%  Similarity=0.302  Sum_probs=40.0

Q ss_pred             CCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCC-C--CCEEEEECCH
Q ss_conf             987478999999999679809995889986899999999999759-9--9499991604
Q gi|255764515|r    1 MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG-E--KSVLVIAPLR   56 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~-~--~~~LIv~P~~   56 (458)
                      ++|.|-|.+||.+.  .+.+++....|+|||-+...-+.++...+ .  ..+|.|+=++
T Consensus         1 ~~Ln~~Q~~av~~~--~gp~lV~AGaGsGKT~vlt~Ria~li~~~~v~p~~Il~vTFTn   57 (655)
T COG0210           1 SKLNPEQREAVLHP--DGPLLVLAGAGSGKTRVLTERIAYLIAAGGVDPEQILAITFTN   57 (655)
T ss_pred             CCCCHHHHHHHHCC--CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCHHHEEEEEEEH
T ss_conf             99998999986188--9986999579986189999999999873895757717789676


No 273
>KOG0991 consensus
Probab=94.88  E-value=0.061  Score=30.00  Aligned_cols=25  Identities=28%  Similarity=0.295  Sum_probs=20.4

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             7980999588998689999999999
Q gi|255764515|r   17 HKRCAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        17 ~~~~ll~~~~G~GKT~~al~~~~~l   41 (458)
                      .++.++..++|+|||-.+.+++..|
T Consensus        48 mP~liisGpPG~GKTTsi~~LAr~L   72 (333)
T KOG0991          48 MPNLIISGPPGTGKTTSILCLAREL   72 (333)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             9866752799986164899999998


No 274
>CHL00095 clpC Clp protease ATP binding subunit
Probab=94.88  E-value=0.2  Score=26.85  Aligned_cols=24  Identities=21%  Similarity=0.126  Sum_probs=18.1

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             980999588998689999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l   41 (458)
                      .+-+|..|+|.|||..+=.++..+
T Consensus       201 NNpiLvGepGVGKTAIvEGLA~rI  224 (823)
T CHL00095        201 NNPILIGEPGVGKTAIAEGLAQRI  224 (823)
T ss_pred             CCCEEECCCCCCHHHHHHHHHHHH
T ss_conf             885023799987999999999976


No 275
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=94.87  E-value=0.16  Score=27.54  Aligned_cols=22  Identities=18%  Similarity=0.211  Sum_probs=16.2

Q ss_pred             CCEEEEECCCCCHHHHHHHHHH
Q ss_conf             9809995889986899999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALS   39 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~   39 (458)
                      +..++..++|+|||-.|-.++.
T Consensus        53 ~S~Il~GPPGtGKTTLA~iIA~   74 (726)
T PRK13341         53 GSLILYGPPGVGKTTLARIIAN   74 (726)
T ss_pred             CEEEEECCCCCCHHHHHHHHHH
T ss_conf             8278889799999999999988


No 276
>pfam02702 KdpD Osmosensitive K+ channel His kinase sensor domain. This is a family of KdpD sensor kinase proteins that regulate the kdpFABC operon responsible for potassium transport. The aligned region corresponds to the N-terminal cytoplasmic part of the protein which may be the sensor domain responsible for sensing turgor pressure.
Probab=94.86  E-value=0.25  Score=26.30  Aligned_cols=104  Identities=13%  Similarity=0.085  Sum_probs=54.2

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE-CCHHHHHHHHHH---HHHHCCCCCCEEEEEECCHHHHHHHHCCC
Q ss_conf             80999588998689999999999975999499991-604656999999---99855888815999858978988873077
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIA-PLRVAQSVWTSE---VQRWSNFSHMNISVITGTVKQRTKVLKTP   94 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~-P~~l~~~~W~~E---i~kf~~~~~~~~~~~~g~~~~r~~~~~~~   94 (458)
                      +..++..+|.|||+.|+..+..+...|..-++=.+ |.+     +.+.   ++.+...|. +...+.|..          
T Consensus         7 kIylG~apGVGKTy~ML~eA~~l~~~G~DVViG~vEthg-----R~eT~~l~~gLe~iP~-~~~~y~g~~----------   70 (211)
T pfam02702         7 KIFLGAAPGVGKTYAMLSEAHELLERGVDVVIGYVETHG-----RAETAALLEGLEVIPR-KEIEYRGVT----------   70 (211)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCC-----CHHHHHHHCCCCCCCC-EEEEECCEE----------
T ss_conf             898535998778999999999999789956999953799-----7899999768766887-125368855----------


Q ss_pred             CCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9869980642023344200011322044045310024654311567777665430
Q gi|255764515|r   95 AVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        95 ~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                             ++-+  +.+..+. .++.++++||--+- |..+....++.+-+..+-.
T Consensus        71 -------~~E~--Dldail~-R~P~vvLVDELAHt-N~pgsr~~KR~qDVeeLL~  114 (211)
T pfam02702        71 -------LEEM--DLDAILA-RKPQLVLVDELAHT-NAPGSRHEKRWQDVEELLD  114 (211)
T ss_pred             -------CCCC--CHHHHHH-CCCCEEEEECCCCC-CCCCCCCCCCHHHHHHHHH
T ss_conf             -------3507--9999985-39998998445567-9998888754774999998


No 277
>TIGR00382 clpX ATP-dependent Clp protease, ATP-binding subunit ClpX; InterPro: IPR004487   ClpX is a member of the HSP (heat-shock protein) 100 family. Gel filtration and electron microscopy showed that ClpX subunits associate to form a six-membered ring that is stabilized by binding of ATP or nonhydrolyzable analogs of ATP . It functions as an ATP-depedent  molecular chaperone and is the regulatory subunit of the ClpXP protease .   ClpXP is involved in DNA damage repair, stationary-phase gene expression, and ssrA-mediated protein quality control. To date more than 50 proteins include transcription factors, metabolic enzymes, and proteins involved in the starvation and oxidative stress responses have been identified as substrates .    The N-terminal domain of ClpX is a C4-type zinc binding domain (ZBD) involved in substrate recognition. ZBD forms a very stable dimer that is essential for promoting the degradation of some typical ClpXP substrates such as lO and MuA .  ; GO: 0005515 protein binding, 0005524 ATP binding, 0016887 ATPase activity, 0015031 protein transport.
Probab=94.84  E-value=0.024  Score=32.44  Aligned_cols=28  Identities=25%  Similarity=0.323  Sum_probs=22.7

Q ss_pred             HHCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9679809995889986899999999999
Q gi|255764515|r   15 LDHKRCAIWASMGSGKTVSVLTALSYIH   42 (458)
Q Consensus        15 ~~~~~~ll~~~~G~GKT~~al~~~~~l~   42 (458)
                      ++.-|.+|..+||+|||+.|=++|..|.
T Consensus       150 L~KSNILLiGPTGSGKTLLAqTLA~~L~  177 (452)
T TIGR00382       150 LSKSNILLIGPTGSGKTLLAQTLARILN  177 (452)
T ss_pred             HHCCCEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             3006624546888526899999998738


No 278
>TIGR00604 rad3 DNA repair helicase (rad3); InterPro: IPR013020   All proteins in this family for which functions are known are DNA-DNA helicases that function in the initiation of transcription and nucleotide excision repair as part of the TFIIH complex. .
Probab=94.78  E-value=0.014  Score=33.79  Aligned_cols=28  Identities=29%  Similarity=0.411  Sum_probs=19.7

Q ss_pred             HHHHHHHHH---HHHC-CCEEE-----EECCCCCHHH
Q ss_conf             789999999---9967-98099-----9588998689
Q gi|255764515|r    5 PHQTKIVDW---ILDH-KRCAI-----WASMGSGKTV   32 (458)
Q Consensus         5 p~Q~~~v~~---~~~~-~~~ll-----~~~~G~GKT~   32 (458)
                      |-|.....-   .++. +.+++     -++.|+|||+
T Consensus        18 p~q~~~~~~~~~~Ld~~~~~~~~~E~dE~PsgtgKt~   54 (813)
T TIGR00604        18 PEQRSYMRDLKRSLDRGDEAILSAEYDEMPSGTGKTI   54 (813)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             4554445777887714765246635565638887400


No 279
>PRK04132 replication factor C small subunit; Provisional
Probab=94.77  E-value=0.038  Score=31.21  Aligned_cols=36  Identities=22%  Similarity=0.222  Sum_probs=28.4

Q ss_pred             HHHHHHHHH------HCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             999999999------679809995889986899999999999
Q gi|255764515|r    7 QTKIVDWIL------DHKRCAIWASMGSGKTVSVLTALSYIH   42 (458)
Q Consensus         7 Q~~~v~~~~------~~~~~ll~~~~G~GKT~~al~~~~~l~   42 (458)
                      |...|..+.      +.+..|.|.+||+|||-.|++++..|.
T Consensus        30 QehIVkRLK~YVk~~smPHLLFaGPPGvGKt~~al~lar~l~   71 (863)
T PRK04132         30 QDHIVKRLKHYVKTGSMPHLLFAGPPGVGKTTAALALARELF   71 (863)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             499999999886238885443048998771447888888761


No 280
>pfam06745 KaiC KaiC. This family represents a conserved region within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein. This family includes KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria.
Probab=94.77  E-value=0.16  Score=27.54  Aligned_cols=45  Identities=24%  Similarity=0.182  Sum_probs=28.4

Q ss_pred             HHHHHHHHCC-----CEEEEECCCCCHHHHHHHHHHH-HHHCCCCCEEEEEC
Q ss_conf             9999999679-----8099958899868999999999-99759994999916
Q gi|255764515|r    9 KIVDWILDHK-----RCAIWASMGSGKTVSVLTALSY-IHLWGEKSVLVIAP   54 (458)
Q Consensus         9 ~~v~~~~~~~-----~~ll~~~~G~GKT~~al~~~~~-l~~~~~~~~LIv~P   54 (458)
                      .+.+.+++.+     -.++..++|+|||.-++-++.. ....| .+++.|+-
T Consensus         6 ~~LD~~l~GGi~~gs~~LI~G~pGsGKT~la~qfl~~ga~~~g-e~~lYis~   56 (231)
T pfam06745         6 PGLDEILKGGIPEGRVVLITGGPGTGKTIFGLQFLYNGALEYG-EPGVYVTL   56 (231)
T ss_pred             HHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCC-CCEEEEEE
T ss_conf             5688631699829969999858972599999999999998658-96899981


No 281
>pfam03354 Terminase_1 Phage Terminase. The majority of the members of this family are bacteriophage proteins, several of which are thought to be terminase large subunit proteins. There are also a number of bacterial proteins of unknown function.
Probab=94.75  E-value=0.19  Score=27.03  Aligned_cols=51  Identities=20%  Similarity=0.255  Sum_probs=30.0

Q ss_pred             HHHHHHHHHHHH----C-----CCEEEEECCCCCHHHHHHHHHH-HHHHCCCC--CEEEEECC
Q ss_conf             789999999996----7-----9809995889986899999999-99975999--49999160
Q gi|255764515|r    5 PHQTKIVDWILD----H-----KRCAIWASMGSGKTVSVLTALS-YIHLWGEK--SVLVIAPL   55 (458)
Q Consensus         5 p~Q~~~v~~~~~----~-----~~~ll~~~~G~GKT~~al~~~~-~l~~~~~~--~~LIv~P~   55 (458)
                      |||...+..+..    .     ++.++.-+=|-|||..+-+++. .+...+..  -+++++++
T Consensus         1 PwQ~f~i~~ifGw~~~~g~Rrfr~~~i~v~RkNGKS~l~a~i~ly~~~~~ge~~~ei~~~A~~   63 (473)
T pfam03354         1 PWQKFILGLMFGWRKGCGVRRFREAYVSVGRKNGKSYLMAIRVLYELLLGGKSNQEILVAATT   63 (473)
T ss_pred             CCHHHHHHHEEEEEECCCCEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECC
T ss_conf             946156251441892899889999999982686026999999999997099838749999798


No 282
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.    FtsH is a membrane-anchored ATP-dependent protease that degrades misfolded or misassembled membrane proteins as well as a subset of cytoplasmic regulatory proteins. FtsH is a 647-residue protein of 70 kDa, with two putative transmembrane segments towards its N terminus which anchor the protein to the membrane, giving rise to a periplasmic domain of 70 residues and a cytoplasmic segment of 520 residues containing the ATPase and protease domains . ; GO: 0004222 metalloendopeptidase activity, 0030163 protein catabolic process, 0016020 membrane.
Probab=94.73  E-value=0.018  Score=33.23  Aligned_cols=31  Identities=26%  Similarity=0.377  Sum_probs=22.0

Q ss_pred             HHHHHHHHH----------C-CCEEEEECCCCCHHHHHHHHH
Q ss_conf             999999996----------7-980999588998689999999
Q gi|255764515|r    8 TKIVDWILD----------H-KRCAIWASMGSGKTVSVLTAL   38 (458)
Q Consensus         8 ~~~v~~~~~----------~-~~~ll~~~~G~GKT~~al~~~   38 (458)
                      .|.|+||.+          - +++||..+|||||||.|=|.+
T Consensus        72 ~EiVdFLK~P~kf~~LGaKIPKGVLLvGPPGTGKTLLAKAvA  113 (505)
T TIGR01241        72 VEIVDFLKNPSKFTKLGAKIPKGVLLVGPPGTGKTLLAKAVA  113 (505)
T ss_pred             HHHHHHCCCCHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHH
T ss_conf             313422269637987278898714731787842467887520


No 283
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Probab=94.73  E-value=0.094  Score=28.86  Aligned_cols=23  Identities=22%  Similarity=0.232  Sum_probs=16.6

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             98099958899868999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSY   40 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~   40 (458)
                      .+.++..++|+|||..+-+.+..
T Consensus        19 ~~v~~~g~~~~~~t~~~~~~a~~   41 (494)
T COG0464          19 KGVLLHGPPGTGKTLLARALANE   41 (494)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHC
T ss_conf             21000368876503665676512


No 284
>PRK05917 DNA polymerase III subunit delta'; Validated
Probab=94.61  E-value=0.29  Score=25.93  Aligned_cols=25  Identities=16%  Similarity=-0.088  Sum_probs=19.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             0999588998689999999999975
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLW   44 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~   44 (458)
                      .|+..+-|+||+-.|..++..+.-.
T Consensus        22 yLf~Gp~G~GK~~~A~~~A~~LLc~   46 (290)
T PRK05917         22 ILLHGQDLSNLSQYAYELASLILLE   46 (290)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             8768999865999999999998578


No 285
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=94.58  E-value=0.29  Score=25.89  Aligned_cols=34  Identities=29%  Similarity=0.391  Sum_probs=23.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             09995889986899999999999759994999916
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAP   54 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P   54 (458)
                      .+++.++|.|||-+..-++..+..++ +++.+|+-
T Consensus         3 i~lvGptGvGKTTTiaKLA~~~~~~~-~kV~lit~   36 (173)
T cd03115           3 ILLVGLQGVGKTTTAAKLALYLKKKG-KKVLLVAA   36 (173)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEEC
T ss_conf             99989999988999999999999769-92899974


No 286
>PRK04328 hypothetical protein; Provisional
Probab=94.55  E-value=0.18  Score=27.20  Aligned_cols=44  Identities=20%  Similarity=0.090  Sum_probs=30.2

Q ss_pred             HHHHHHHHCC-----CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             9999999679-----80999588998689999999999975999499991
Q gi|255764515|r    9 KIVDWILDHK-----RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIA   53 (458)
Q Consensus         9 ~~v~~~~~~~-----~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~   53 (458)
                      .+.+.++..+     -.+++.++|+|||.-++-++..-...| .++|.|+
T Consensus        11 ~gLD~lL~GGlp~gs~~Lv~G~pGtGKT~la~qFl~~g~~~G-E~~lyis   59 (250)
T PRK04328         11 PGMDEILYGGIPERNVVLLSGGPGTGKSIFSQQFLWNGLQMG-EPGIYVA   59 (250)
T ss_pred             HHHHHHCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCC-CCEEEEE
T ss_conf             667875159987996999982899998999999999998769-9779999


No 287
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]
Probab=94.54  E-value=0.16  Score=27.49  Aligned_cols=53  Identities=17%  Similarity=0.212  Sum_probs=28.8

Q ss_pred             HHHHCCC--EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH-----HHHHHHHH
Q ss_conf             9996798--0999588998689999999999975999499991604656-----99999999
Q gi|255764515|r   13 WILDHKR--CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ-----SVWTSEVQ   67 (458)
Q Consensus        13 ~~~~~~~--~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~-----~~W~~Ei~   67 (458)
                      +....++  ..+..++|+|||+..=++.+.+ . +...+.|+.|+..+.     +-|..+++
T Consensus        45 ~~i~d~qg~~~vtGevGsGKTv~~Ral~~s~-~-~d~~~~v~i~~~~~s~~~~~~ai~~~l~  104 (269)
T COG3267          45 AAIADGQGILAVTGEVGSGKTVLRRALLASL-N-EDQVAVVVIDKPTLSDATLLEAIVADLE  104 (269)
T ss_pred             HHHHCCCCEEEEEECCCCCHHHHHHHHHHHC-C-CCCEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             7775178559997447776369999999855-7-8851799835763017889999999840


No 288
>pfam06733 DEAD_2 DEAD_2. This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin. RAD3 is involved in nucleotide excision repair, and forms part of the transcription factor TFIIH in yeast.
Probab=94.50  E-value=0.025  Score=32.35  Aligned_cols=38  Identities=16%  Similarity=0.212  Sum_probs=23.1

Q ss_pred             CCCCCEEEECCCCHHH--HHHHCCCCCCCCEEECCCCCCC
Q ss_conf             0779869980642023--3442000113220440453100
Q gi|255764515|r   92 KTPAVLYVINFENLGW--LVQELKGTWPFATIVVDESTKL  129 (458)
Q Consensus        92 ~~~~~i~i~s~e~~~~--~~~~~~~~~~~~~iIiDEaH~l  129 (458)
                      ....++++++|.-+-.  ..+.+....+-..||+||||++
T Consensus       112 ~~~AdiI~~pYnylld~~ir~~l~i~l~~~IvI~DEAHNl  151 (168)
T pfam06733       112 LKDADIIILPYNYLLDPKIRESLKINLKNSIVIFDEAHNI  151 (168)
T ss_pred             HHCCCEEEECCHHHCCHHHHHHHCCCCCCEEEEEECCCCH
T ss_conf             8539989966177619999998378758849999881375


No 289
>KOG1807 consensus
Probab=94.48  E-value=0.14  Score=27.82  Aligned_cols=65  Identities=22%  Similarity=0.192  Sum_probs=48.7

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCC-----CCCEEEEECCHHHHHHHHHHHH
Q ss_conf             7478999999999679809995889986899999999999759-----9949999160465699999999
Q gi|255764515|r    3 LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG-----EKSVLVIAPLRVAQSVWTSEVQ   67 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~-----~~~~LIv~P~~l~~~~W~~Ei~   67 (458)
                      |..-|..|.+.++..+-.++-.++|+|||++.+-+...|....     .-|+||+|-++-..+|.-.-+-
T Consensus       379 ldsSq~~A~qs~ltyelsliqgppGTgkt~vtlkav~tLL~n~s~~~~~epIlvvC~Tnhavdq~ligiy  448 (1025)
T KOG1807         379 LDSSQQFAKQSKLTYELSLIQGPPGTGKTLVTLKAVDTLLLNSSGYTEPEPILVVCLTNHAVDQYLIGIY  448 (1025)
T ss_pred             ECHHHHHHHHHHHHHHHHEEECCCCCCCEEEHHHHHHHHHHCCCCCCCCCCEEEEEHHHHHHHHHHHHHH
T ss_conf             0488999998776563211325998772203499999999626554555644664223578999999987


No 290
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf4 (CRISPR/cas Subtype as in A. ferrooxidans protein 1), as it lies farthest (fourth closest) from the repeats in the A. ferrooxidans genome.
Probab=94.48  E-value=0.23  Score=26.49  Aligned_cols=50  Identities=26%  Similarity=0.334  Sum_probs=27.7

Q ss_pred             HHCCC-EEEEECCCCCHHHHHHHH-HHHHHHCCCCCEEEEECCHHHHHHHHH
Q ss_conf             96798-099958899868999999-999997599949999160465699999
Q gi|255764515|r   15 LDHKR-CAIWASMGSGKTVSVLTA-LSYIHLWGEKSVLVIAPLRVAQSVWTS   64 (458)
Q Consensus        15 ~~~~~-~ll~~~~G~GKT~~al~~-~~~l~~~~~~~~LIv~P~~l~~~~W~~   64 (458)
                      ++.++ +++=..+|+|||+-=|.- +.+......++++|=+++-.++.|-.+
T Consensus        13 ~~~~~v~lVEAGTGTGKSLAYLvPAl~~a~~~~g~rVVISTaT~aLQeQL~~   64 (636)
T TIGR03117        13 LRQKRIGMLEASTGVGKTLAMIMAALTMLKERPDQKIAIAVPTLALMGQLWS   64 (636)
T ss_pred             HHCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHH
T ss_conf             6038489998999710889999999999985799988997987999999976


No 291
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB; InterPro: IPR013374    This model describes a protein involved in type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly, and is closely related to GspE (IPR013369 from INTERPRO) of type II secretion systems (also referred to as the main terminal branch of the general secretion pathway). Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0009297 pilus biogenesis.
Probab=94.47  E-value=0.044  Score=30.84  Aligned_cols=33  Identities=9%  Similarity=-0.060  Sum_probs=13.9

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             536899888999999851033452022347888875
Q gi|255764515|r  250 PQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKC  285 (458)
Q Consensus       250 ~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l  285 (458)
                      .|+|.+.|-+....   +..=-.++..+++.|+.-|
T Consensus       311 eP~Qk~~fL~Ai~k---PqGMvLVTGPTGSGKTVSL  343 (577)
T TIGR02538       311 EPDQKALFLEAIHK---PQGMVLVTGPTGSGKTVSL  343 (577)
T ss_pred             CHHHHHHHHHHHHC---CCCCEEEECCCCCCHHHHH
T ss_conf             88899999999707---9972886266598416878


No 292
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).  This family includes the cell division ABC transporter and the periplasmic substrate-binding protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In Escherichia coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.; GO: 0005525 GTP binding.
Probab=94.38  E-value=0.22  Score=26.65  Aligned_cols=127  Identities=18%  Similarity=0.292  Sum_probs=69.6

Q ss_pred             CCEEEEECC-CCCHHHHHHHHHHHHHHCCCCCEEEEEC----CHHHHHHHHHHHHHHCCCCCCEEEEEECCHH-HHHHHH
Q ss_conf             980999588-9986899999999999759994999916----0465699999999855888815999858978-988873
Q gi|255764515|r   18 KRCAIWASM-GSGKTVSVLTALSYIHLWGEKSVLVIAP----LRVAQSVWTSEVQRWSNFSHMNISVITGTVK-QRTKVL   91 (458)
Q Consensus        18 ~~~ll~~~~-G~GKT~~al~~~~~l~~~~~~~~LIv~P----~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~-~r~~~~   91 (458)
                      ++.++.-.+ |+|||=|---++..+..+| +++|+.|=    +..++ |    ++-|..  ...+.++.+... ..... 
T Consensus        82 p~Vil~VGVNG~GKTTTIaKLA~~l~~~G-k~V~laAgDTFRAAA~E-Q----L~~Wa~--R~gv~vi~~~~gn~DPAa-  152 (284)
T TIGR00064        82 PNVILFVGVNGVGKTTTIAKLANKLKKQG-KSVLLAAGDTFRAAAIE-Q----LEVWAK--RLGVDVIKQKEGNADPAA-  152 (284)
T ss_pred             CEEEEEEEEECCCHHHHHHHHHHHHHHCC-CEEEEECCCHHHHHHHH-H----HHHHHH--HHCCEEEECCCCCCCCHH-
T ss_conf             77999984408860102889999998749-90899827524799999-9----999898--838755407889887178-


Q ss_pred             CCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCC--CHHHHHHHHHHHHH-CCCE--EEEECCCCHHHHC
Q ss_conf             07798699806420233442000113220440453100246543--11567777665430-5980--7996584023100
Q gi|255764515|r   92 KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLR--QGSKTARALAKPAW-ESER--FIELTGTPSPNGL  166 (458)
Q Consensus        92 ~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~--~~s~~~~~l~~~~~-~~~~--~l~LTgTPi~n~~  166 (458)
                              +=|+++..-     ....+|.|+||=|=|+.|...=  .-+|-.|.+.+... .+|+  .+.|=||=-+|..
T Consensus       153 --------V~fDAi~~A-----k~~niDvvliDTAGRLqnk~NLm~EL~KI~RV~~k~~~~~aP~e~lLVlDAt~Gqna~  219 (284)
T TIGR00064       153 --------VIFDAIQAA-----KARNIDVVLIDTAGRLQNKVNLMDELKKIKRVIKKVDPVDAPDEVLLVLDATTGQNAL  219 (284)
T ss_pred             --------HHHHHHHHH-----HHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEHHHHHHHHH
T ss_conf             --------999989999-----8749978997347545466203999999999873210257875575422022203089


No 293
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=94.33  E-value=0.24  Score=26.43  Aligned_cols=25  Identities=20%  Similarity=0.045  Sum_probs=18.9

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9809995889986899999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIH   42 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~   42 (458)
                      ++-+|..|+|.|||..+=+++..+.
T Consensus       208 NNpiLvGepGVGKTAIvEGLA~rI~  232 (758)
T PRK11034        208 NNPLLVGESGVGKTAIAEGLAWRIV  232 (758)
T ss_pred             CCCEEECCCCCCHHHHHHHHHHHHH
T ss_conf             8960216999869999999999997


No 294
>TIGR00678 holB DNA polymerase III, delta' subunit; InterPro: IPR004622   DNA-directed DNA polymerase (2.7.7.7 from EC) catalyzes DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. DNA polymerase III is a complex, multi-chain enzyme responsible for most of the replicative synthesis in bacteria. The enzyme also has 3' to 5' exonuclease activity. It has a core composed of alpha, epsilon and theta chains, that associate with a tau subunit which allows the core dimerisation to form the PolIII' complex. PolIII' associates with the gamma complex (gamma, delta, delta', psi and chi chains) and with the beta chain. This domain is the N-terminal half of the delta' subunit of DNA polymerase III. Delta' is homologous to the gamma and tau subunits, which form an outgroup for phylogenetic comparison. The gamma/tau branch of the tree is much more tightly conserved than the delta' branch, and some members of that branch score more highly against this model than some proteins classified as delta'. The noise cut-off is set to detect weakly scoring delta' subunits rather than to exclude gamma/tau subunits.; GO: 0003887 DNA-directed DNA polymerase activity, 0008408 3'-5' exonuclease activity, 0006260 DNA replication.
Probab=94.20  E-value=0.28  Score=26.02  Aligned_cols=128  Identities=16%  Similarity=0.137  Sum_probs=63.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHH----HHH--HC
Q ss_conf             809995889986899999999999759994999916046569999999985588881599985897898----887--30
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQR----TKV--LK   92 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r----~~~--~~   92 (458)
                      -.|+..+.|+||...|..++..+.=...... -  |-..     ...+.++....+.+++++.=.....    ...  -.
T Consensus        16 A~LF~G~~G~Gk~~~A~~~A~~l~C~~~~~~-~--~Cg~-----C~~C~~~~~G~HPD~~~~~P~~~~~~~~~de~~~~~   87 (216)
T TIGR00678        16 AYLFTGPEGVGKELLALALAKALLCEPRGGG-E--PCGE-----CHSCRLIEAGNHPDLHRLEPEGQSKSLTADEAAEGE   87 (216)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCCCCCC-C--CCCC-----CHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHHHH
T ss_conf             1254448887489999999999807785778-8--8885-----888999870799823787423477777764589762


Q ss_pred             C----CCCEEEECCCCHHHHHHHCCCC---CCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCC---EEEEECCCC
Q ss_conf             7----7986998064202334420001---1322044045310024654311567777665430598---079965840
Q gi|255764515|r   93 T----PAVLYVINFENLGWLVQELKGT---WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESE---RFIELTGTP  161 (458)
Q Consensus        93 ~----~~~i~i~s~e~~~~~~~~~~~~---~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~---~~l~LTgTP  161 (458)
                      .    ...--.|..|.++.+.+.+...   -.|..||||.|+.| |      ...++++.|.-.-.+   +.+++|-+|
T Consensus        88 ~g~a~~~~~~~Ik~dq~R~l~~~~~~~~~~~~~rVviI~~Ae~m-n------~~AANALLKtLEEPp~~t~fiL~~~~~  159 (216)
T TIGR00678        88 EGSAKRRALPQIKVDQVRELVEFLSLTPQESGRRVVIIEDAERM-N------EAAANALLKTLEEPPPNTLFILITHSP  159 (216)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHC-C------HHHHHHHHHHEECCCCCEEEEEECCCC
T ss_conf             56421136787872789999999860642147517997673232-5------898986510101279870798850888


No 295
>pfam01580 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive sequence similarity to wide variety of proteins from prokaryotes and plasmids, termed the FtsK/SpoIIIE family. This domain contains a putative ATP binding P-loop motif.  It is found in the FtsK cell division protein from E. coli and the stage III sporulation protein E SpoIIIE which has roles in regulation of prespore specific gene expression in B. subtilis. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer.
Probab=94.06  E-value=0.18  Score=27.10  Aligned_cols=42  Identities=21%  Similarity=0.177  Sum_probs=27.8

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHCC---CCCEEEEECCHH
Q ss_conf             679809995889986899999999999759---994999916046
Q gi|255764515|r   16 DHKRCAIWASMGSGKTVSVLTALSYIHLWG---EKSVLVIAPLRV   57 (458)
Q Consensus        16 ~~~~~ll~~~~G~GKT~~al~~~~~l~~~~---~~~~LIv~P~~l   57 (458)
                      +.+.+|++..+|+|||...-.++..+....   .-.+.++=|+..
T Consensus        37 ~~pH~Lv~G~tGsGKS~~l~~li~sl~~~~~p~~v~l~liD~K~~   81 (202)
T pfam01580        37 KMPHLLIAGATGSGKSTFLNTLILSLAARHSPEEVRLYLIDPKGG   81 (202)
T ss_pred             CCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             688689965899980099999999998737962069999748961


No 296
>PRK09694 hypothetical protein; Provisional
Probab=94.05  E-value=0.29  Score=25.89  Aligned_cols=101  Identities=20%  Similarity=0.236  Sum_probs=57.9

Q ss_pred             HHHHHC-CCCCEEEEHHHHHHHHHHHHHCCCC------------CCC-----HHHHHHHHHHHC-CCC---CCEEEEEHH
Q ss_conf             665412-4884034222367888664100026------------533-----445899876424-588---558998442
Q gi|255764515|r  313 EVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ------------GRT-----LDKDPCTIQEWN-EGK---IPLLFAHPA  370 (458)
Q Consensus       313 ~~il~~-~~~~kviif~~~~~~~~~i~~~~~~------------g~~-----~~~r~~~i~~f~-~~~---~~vli~s~~  370 (458)
                      ..+++. ..|..++|.||.+.....+.+.+.+            +.-     ......+++.|- +++   ..|+| .|+
T Consensus       552 ~~l~~~~~~G~~v~vI~NTV~rAq~~y~~L~~~~~~~~~v~L~HsRF~~~DR~~~E~~vl~~~Gk~~~r~~g~IlV-aTQ  630 (878)
T PRK09694        552 ERMIAAANAGAQVCVICNLVDDAQVCYQRLKELNNTQVDIDLFHARFTFNDRREKENRVISNFGKNGKRNVGRILV-ATQ  630 (878)
T ss_pred             HHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEE-ECC
T ss_conf             9999999789959999388999999999999852899877998688877669999999999868898899986999-773


Q ss_pred             HCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCC-CCHHC-CCCCCE
Q ss_conf             2111622001785999908998986864456666202-20203-787752
Q gi|255764515|r  371 SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVT-RQRQA-GFKRAV  418 (458)
Q Consensus       371 ~~~~GlnL~~a~~~iI~~~~~wn~~~~~Q~~gRi~~~-r~hR~-Gq~~~v  418 (458)
                      +....||+ .+ +++| -|+ =-...+.||.||++|. |..|. |...|+
T Consensus       631 VvEQSLDi-Df-D~li-TDL-APiDlLlQR~GRLhRH~R~~RP~g~~~P~  676 (878)
T PRK09694        631 VVEQSLDL-DF-DWLI-TQH-CPADLLFQRMGRLHRHHRKYRPAGFEIPV  676 (878)
T ss_pred             EEEEEECC-CC-CHHH-CCC-CCHHHHHHHHHHHHCCCCCCCCCCCCCCE
T ss_conf             33243033-53-3011-046-86999998742320589988887777876


No 297
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=93.81  E-value=0.39  Score=25.13  Aligned_cols=22  Identities=23%  Similarity=0.418  Sum_probs=16.1

Q ss_pred             CCEEEEECCCCCHHHHHHHHHH
Q ss_conf             9809995889986899999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALS   39 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~   39 (458)
                      ...++..++|+|||-.|-.++.
T Consensus        49 ~SmIl~GPPG~GKTTlA~liA~   70 (436)
T COG2256          49 HSMILWGPPGTGKTTLARLIAG   70 (436)
T ss_pred             CEEEEECCCCCCHHHHHHHHHH
T ss_conf             6057778999888899999987


No 298
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=93.66  E-value=0.45  Score=24.76  Aligned_cols=50  Identities=16%  Similarity=0.009  Sum_probs=32.8

Q ss_pred             CCHHHHHHHHHHHHC---C-CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             747899999999967---9-809995889986899999999999759994999916
Q gi|255764515|r    3 LAPHQTKIVDWILDH---K-RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAP   54 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~---~-~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P   54 (458)
                      ++||..  ++.+...   + =.+++..+|.|||.-++.++..+..+...+++++..
T Consensus        14 ~~pf~~--LD~~~~Gl~~GeL~viaarpg~GKT~f~~~~a~~~~~~~g~~vl~~Sl   67 (271)
T cd01122          14 WWPFPV--LNKLTKGLRKGELIILTAGTGVGKTTFLREYALDLITQHGVRVGTISL   67 (271)
T ss_pred             CCCCHH--HHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             588166--888737999980899996899869999999999999976990899970


No 299
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136   This entry represents the Ti-type conjugative transfer relaxase TraA. TraA contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, IPR005053 from INTERPRO) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, IPR014129 from INTERPRO). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer ..
Probab=93.53  E-value=0.47  Score=24.62  Aligned_cols=130  Identities=20%  Similarity=0.211  Sum_probs=66.2

Q ss_pred             CCHHHHHHHHHHHHCCC-EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEE
Q ss_conf             74789999999996798-09995889986899999999999759994999916046569999999985588881599985
Q gi|255764515|r    3 LAPHQTKIVDWILDHKR-CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT   81 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~~-~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~   81 (458)
                      |=.-|..||.++.+-++ ..+....|+|||.++ .++...+......|  +- +.|- -.=.++++.=+           
T Consensus       415 Ls~EQ~~Av~hvt~s~~iavVvG~AGtGKSt~L-~aAR~AWe~~Gy~V--~G-AALs-GKAAegLe~~s-----------  478 (888)
T TIGR02768       415 LSEEQKEAVRHVTGSGDIAVVVGRAGTGKSTML-KAAREAWEAAGYRV--IG-AALS-GKAAEGLEAES-----------  478 (888)
T ss_pred             CHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHH-HHHHHHHHHCCCEE--EE-HHHH-HHHHHHHHCCC-----------
T ss_conf             458999998753289964899748998766789-99999998739778--71-5455-58988730026-----------


Q ss_pred             CCHHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             89789888730779869980642023344200011322044045310024654311567777665430598079965840
Q gi|255764515|r   82 GTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTP  161 (458)
Q Consensus        82 g~~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTP  161 (458)
                      |....-...|.            +.| .+.......-|.+|||||=.+      ...++.+.| +.+.++--++.|=|=|
T Consensus       479 GI~SRTLASle------------~aW-~~G~d~L~~~dvLviDEAGMV------~S~Qm~r~l-~~A~~AGaKvVLvGD~  538 (888)
T TIGR02768       479 GIESRTLASLE------------YAW-ANGRDLLEDKDVLVIDEAGMV------GSRQMARVL-KEAEEAGAKVVLVGDP  538 (888)
T ss_pred             CCCHHHHHHHH------------HHH-HCCCCCCCCCCEEEEECCCCH------HHHHHHHHH-HHHHHCCCCEEEECCH
T ss_conf             87504788799------------998-738752247766898515441------467788999-9998727605984885


Q ss_pred             HHHHCCC
Q ss_conf             2310010
Q gi|255764515|r  162 SPNGLID  168 (458)
Q Consensus       162 i~n~~~e  168 (458)
                      -|=.|.+
T Consensus       539 ~QLqaI~  545 (888)
T TIGR02768       539 EQLQAIE  545 (888)
T ss_pred             HHHCHHH
T ss_conf             7824424


No 300
>TIGR00345 arsA arsenite-activated ATPase (arsA); InterPro: IPR003348   This ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.    In Escherichia coli an anion-translocating ATPase has been identified as the product of the arsenical resistance operon of resistance plasmid R773. This ATP-driven oxyanion pump catalyses extrusion of the oxyanions arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two polypeptides, the products of the arsA and arsB genes. This two-subunit enzyme produces resistance to arsenite and antimonite. A third gene, arsC, expands the substrate specificity to allow for arsenate pumping and resistance .   The ArsA and ArsB proteins form a membrane-bound pump that functions as an oxyanion-translocating ATPase. The ArsC protein is an arsenate reductase that reduces arsenate to arsenite, which is subsequently pumped out of the cell .; GO: 0005524 ATP binding, 0006820 anion transport, 0016020 membrane.
Probab=93.40  E-value=0.15  Score=27.71  Aligned_cols=41  Identities=24%  Similarity=0.311  Sum_probs=32.0

Q ss_pred             CCCHHHHHHHHHHHHHHC-CCCCEEEEE--CCHHHHHHHHHHHH
Q ss_conf             998689999999999975-999499991--60465699999999
Q gi|255764515|r   27 GSGKTVSVLTALSYIHLW-GEKSVLVIA--PLRVAQSVWTSEVQ   67 (458)
Q Consensus        27 G~GKT~~al~~~~~l~~~-~~~~~LIv~--P~~l~~~~W~~Ei~   67 (458)
                      |.|||=.+.|.+-.+-.+ +.+++|||.  |++=+.+.+..||-
T Consensus         7 GVGKTt~SaAtA~~lAe~qPGkkvLl~STDPAHsL~D~F~~e~G   50 (330)
T TIGR00345         7 GVGKTTISAATAIRLAEQQPGKKVLLVSTDPAHSLSDVFEQELG   50 (330)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHC
T ss_conf             82388899999999985189977999840860027886113217


No 301
>KOG1131 consensus
Probab=93.39  E-value=0.34  Score=25.48  Aligned_cols=54  Identities=28%  Similarity=0.415  Sum_probs=35.8

Q ss_pred             CCHHHHHHH---HHHHH-CCCEEEEECCCCCHHHHHHHHHH--HHHHCCCCCEEEEECCH
Q ss_conf             747899999---99996-79809995889986899999999--99975999499991604
Q gi|255764515|r    3 LAPHQTKIV---DWILD-HKRCAIWASMGSGKTVSVLTALS--YIHLWGEKSVLVIAPLR   56 (458)
Q Consensus         3 L~p~Q~~~v---~~~~~-~~~~ll~~~~G~GKT~~al~~~~--~l~~~~~~~~LIv~P~~   56 (458)
                      .||.|.+-.   ...++ .+.|+|-++.|+|||+..+.++-  ++.......-||-|...
T Consensus        17 iYPEQ~~YM~elKrsLDakGh~llEMPSGTGKTvsLLSli~aYq~~~p~~~~KliYCSRT   76 (755)
T KOG1131          17 IYPEQYEYMRELKRSLDAKGHCLLEMPSGTGKTVSLLSLIIAYQLHYPDEHRKLIYCSRT   76 (755)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             588999999999876345783799778888731289999999998677633358996375


No 302
>pfam01935 DUF87 Domain of unknown function DUF87. The function of this prokaryotic domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=93.38  E-value=0.18  Score=27.13  Aligned_cols=46  Identities=26%  Similarity=0.303  Sum_probs=33.6

Q ss_pred             HHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             99996798099958899868999999999997599949999160465
Q gi|255764515|r   12 DWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA   58 (458)
Q Consensus        12 ~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~   58 (458)
                      +.+.. +.+++...+|+|||.++-.+++.+......++||+=|-+-.
T Consensus        19 ~~lv~-rH~aIlg~TGsGKS~tv~vLl~~l~~~~~~~vlVfDpHgEY   64 (218)
T pfam01935        19 NKLVS-RHFAILGSTGSGKSNTVAVLLEELLEKKGATVLIFDPHGEY   64 (218)
T ss_pred             HHHHH-HHEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCC
T ss_conf             99634-21478726999769999999999985479978998288636


No 303
>PRK10436 hypothetical protein; Provisional
Probab=93.36  E-value=0.26  Score=26.23  Aligned_cols=14  Identities=7%  Similarity=-0.016  Sum_probs=6.0

Q ss_pred             CCCCEEEEECCHHH
Q ss_conf             99949999160465
Q gi|255764515|r   45 GEKSVLVIAPLRVA   58 (458)
Q Consensus        45 ~~~~~LIv~P~~l~   58 (458)
                      +..-.++++|.+-+
T Consensus        46 g~~i~~~~~~~~~i   59 (461)
T PRK10436         46 GKRIDIECWTRQQM   59 (461)
T ss_pred             CCCEEEEECCHHHH
T ss_conf             89418998089999


No 304
>PRK10490 sensor protein KdpD; Provisional
Probab=93.10  E-value=0.55  Score=24.21  Aligned_cols=107  Identities=14%  Similarity=0.080  Sum_probs=51.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHH-HHHCCCCCCEEEEEECCHHHHHHHHCCCCCE
Q ss_conf             809995889986899999999999759994999916046569999999-9855888815999858978988873077986
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEV-QRWSNFSHMNISVITGTVKQRTKVLKTPAVL   97 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei-~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i   97 (458)
                      +..++..+|.|||+.|+..+..+...|..-++=++-+.--..  ..++ +.....| .+...+.|..             
T Consensus        26 ki~lg~a~gvGKty~mL~~a~~~~~~g~dvvvg~ve~h~r~e--t~~l~~gl~~~p-~~~~~y~g~~-------------   89 (895)
T PRK10490         26 KVFFGACAGVGKTWAMLAEAQRLRAQGLDVVVGVVETHGRKE--TAALLEGLTVLP-PKRLAHRGRQ-------------   89 (895)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHH--HHHHHCCCCCCC-CCEEEECCCC-------------
T ss_conf             899426999868999999999999779947999961799689--999874866588-7114127832-------------


Q ss_pred             EEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9980642023344200011322044045310024654311567777665430
Q gi|255764515|r   98 YVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAW  149 (458)
Q Consensus        98 ~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~  149 (458)
                          .+-+  +.+..+. .++.++.+||=-|- |..+.++.|+.+-+..+-.
T Consensus        90 ----~~e~--dlda~l~-r~P~~~lvDelaht-n~pgsrh~kR~qdv~ell~  133 (895)
T PRK10490         90 ----ISEF--DLDAALA-RRPALILMDELAHS-NAPGSRHPKRWQDIEELLE  133 (895)
T ss_pred             ----CCCC--CHHHHHH-CCCCEEEEECCCCC-CCCCCCCCCHHHHHHHHHH
T ss_conf             ----3416--8989985-39988997334566-9998877640764999997


No 305
>CHL00176 ftsH cell division protein; Validated
Probab=93.06  E-value=0.1  Score=28.65  Aligned_cols=34  Identities=21%  Similarity=0.192  Sum_probs=21.6

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             98099958899868999999999997599949999160
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL   55 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~   55 (458)
                      ++.||..++|+|||+.|=|++.+    ..-|.+-+...
T Consensus       211 kGvLL~GpPGTGKTlLAkAvAgE----a~vpF~~~sgs  244 (631)
T CHL00176        211 KGVLLVGPPGTGKTLLAKAIAGE----AEVPFFSISGS  244 (631)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCC----CCCCEEEEEHH
T ss_conf             65898898998788999998565----58846998837


No 306
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=92.99  E-value=0.35  Score=25.38  Aligned_cols=50  Identities=28%  Similarity=0.463  Sum_probs=33.7

Q ss_pred             CCCHHHHHHHHHHHHCCCE--EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             8747899999999967980--99958899868999999999997599949999
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRC--AIWASMGSGKTVSVLTALSYIHLWGEKSVLVI   52 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~--ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv   52 (458)
                      -+.|.|.+.++.+...++|  +++.++|+|||=+.-+++..+.. ...+++-|
T Consensus        63 G~~~~~~~~l~~~~~~~~GlilitGptGSGKtTtl~a~l~~~~~-~~~~i~ti  114 (264)
T cd01129          63 GLKPENLEIFRKLLEKPHGIILVTGPTGSGKTTTLYSALSELNT-PEKNIITV  114 (264)
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCC-CCCEEEEE
T ss_conf             79999999999997089988999789999779999999986436-88508998


No 307
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=92.96  E-value=0.39  Score=25.14  Aligned_cols=59  Identities=25%  Similarity=0.248  Sum_probs=35.0

Q ss_pred             HHHHHHHHCC--C---EEEEECCCCCHHHHHHHHHHHHHHCC-----CCCEEEEECCHHHHHHHHHHHH
Q ss_conf             9999999679--8---09995889986899999999999759-----9949999160465699999999
Q gi|255764515|r    9 KIVDWILDHK--R---CAIWASMGSGKTVSVLTALSYIHLWG-----EKSVLVIAPLRVAQSVWTSEVQ   67 (458)
Q Consensus         9 ~~v~~~~~~~--~---~ll~~~~G~GKT~~al~~~~~l~~~~-----~~~~LIv~P~~l~~~~W~~Ei~   67 (458)
                      ..++.++..+  .   .-++.+.|+|||-.++.++......+     ..+++.|.-.+.....|..++.
T Consensus         6 ~~lD~~LgGGip~G~ItEi~G~~gsGKT~l~lqla~~~q~~~~~~~~~g~vvyIDtE~~f~~~rl~~i~   74 (226)
T cd01393           6 KALDELLGGGIPTGRITEIFGEFGSGKTQLCLQLAVEAQLPGELGGLEGKVVYIDTEGAFRPERLVQLA   74 (226)
T ss_pred             HHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHH
T ss_conf             789988579988883999999999989999999999985422116999619999557753199999998


No 308
>COG4626 Phage terminase-like protein, large subunit [General function prediction only]
Probab=92.94  E-value=0.58  Score=24.07  Aligned_cols=56  Identities=20%  Similarity=0.286  Sum_probs=37.9

Q ss_pred             CCCCHHHHHHHHHHHHC----------CCEEEEECCCCCHHHHHHHHH--HHHH-HCCCCCEEEEECCH
Q ss_conf             98747899999999967----------980999588998689999999--9999-75999499991604
Q gi|255764515|r    1 MNLAPHQTKIVDWILDH----------KRCAIWASMGSGKTVSVLTAL--SYIH-LWGEKSVLVIAPLR   56 (458)
Q Consensus         1 ~~L~p~Q~~~v~~~~~~----------~~~ll~~~~G~GKT~~al~~~--~~l~-~~~~~~~LIv~P~~   56 (458)
                      +.|.|||...+.-+..-          +-++|..+=|=|||-.+-+++  ..+. ......+.|++|+-
T Consensus        60 ~~l~PwQkFiia~l~G~~~k~T~~rrf~e~fI~v~RkngKt~l~A~i~~~~~l~~~~~~~~~~i~A~s~  128 (546)
T COG4626          60 ESLEPWQKFIVAALFGFYDKQTGIRRFKEAFIFIPRKNGKSTLAAGIMMTALLLNWRSGAGIYILAPSV  128 (546)
T ss_pred             CCCCCHHHHHHHHHHHEEECCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCH
T ss_conf             343518999999876035057870688899999745785578999999999876530476089983428


No 309
>TIGR00631 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 All proteins in this family for which functions are known are DNA helicases that function in the nucleotide excision repair and are endonucleases that make the 3' incision next to DNA damage. They are part of a pathway requiring UvrA, UvrB, UvrC, and UvrD homologs.; GO: 0009381 excinuclease ABC activity, 0006289 nucleotide-excision repair, 0005737 cytoplasm, 0009380 excinuclease repair complex.
Probab=92.86  E-value=0.068  Score=29.72  Aligned_cols=73  Identities=18%  Similarity=0.235  Sum_probs=57.0

Q ss_pred             HHHHHHHHHHC-----CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEE
Q ss_conf             99999999967-----9809995889986899999999999759994999916046569999999985588881599985
Q gi|255764515|r    7 QTKIVDWILDH-----KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT   81 (458)
Q Consensus         7 Q~~~v~~~~~~-----~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~   81 (458)
                      |=+|++.|.++     +.=.|...||||||+|+-.+++.+    .+|+|||+|.-++..|=+.||+.|+|...+.|-+-+
T Consensus        14 QP~AI~~L~~~l~~G~~~QtLLGvTGsGKTFT~AnVIa~~----~rPTLV~aHNKTLAAQLY~EfKefFPeNAVEYFvSY   89 (667)
T TIGR00631        14 QPKAIAKLVEGLEAGEKEQTLLGVTGSGKTFTMANVIAQV----QRPTLVLAHNKTLAAQLYNEFKEFFPENAVEYFVSY   89 (667)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHH----CCCEEEECCCHHHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             1899999999985688714785321486278898999984----798499857776799999999863867724525520


Q ss_pred             CC
Q ss_conf             89
Q gi|255764515|r   82 GT   83 (458)
Q Consensus        82 g~   83 (458)
                      .+
T Consensus        90 YD   91 (667)
T TIGR00631        90 YD   91 (667)
T ss_pred             CC
T ss_conf             32


No 310
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]
Probab=92.74  E-value=0.4  Score=25.06  Aligned_cols=112  Identities=15%  Similarity=0.161  Sum_probs=54.1

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      .++..+=|+|||-+|=.++..++-.+. +  .-.|.....+  .++|..   ....++.-+.+.+..             
T Consensus        41 YlfsG~RGvGKTt~Ari~AkalNC~~~-~--~~ePC~~C~~--Ck~I~~---g~~~DviEiDaASn~-------------   99 (515)
T COG2812          41 YLFSGPRGVGKTTIARILAKALNCENG-P--TAEPCGKCIS--CKEINE---GSLIDVIEIDAASNT-------------   99 (515)
T ss_pred             HHHCCCCCCCCHHHHHHHHHHHCCCCC-C--CCCCCHHHHH--HHHHHC---CCCCCCHHHHHHHCC-------------
T ss_conf             651377776710499999999568898-7--7772253166--686514---886410113644454-------------


Q ss_pred             ECCCCHHHHHHHCC---CCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEEECCC
Q ss_conf             80642023344200---0113220440453100246543115677776654305-9807996584
Q gi|255764515|r  100 INFENLGWLVQELK---GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWE-SERFIELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~~~---~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~-~~~~l~LTgT  160 (458)
                       ..+-++.+.+..+   ...+|...||||+|.+.       ...++++.|.-.. ..+++..=||
T Consensus       100 -gVddiR~i~e~v~y~P~~~ryKVyiIDEvHMLS-------~~afNALLKTLEEPP~hV~FIlAT  156 (515)
T COG2812         100 -GVDDIREIIEKVNYAPSEGRYKVYIIDEVHMLS-------KQAFNALLKTLEEPPSHVKFILAT  156 (515)
T ss_pred             -CHHHHHHHHHHHCCCCCCCCCEEEEEECHHHHH-------HHHHHHHHCCCCCCCCCEEEEEEC
T ss_conf             -867999999872468866664189983187643-------788888751113686674899853


No 311
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=92.72  E-value=0.62  Score=23.89  Aligned_cols=93  Identities=16%  Similarity=0.145  Sum_probs=47.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      ..|..+.|+|||.-+-+++......+ .+++.+... -.. .+..++..                               
T Consensus        41 l~i~G~~GsGKTHLl~a~~~~~~~~~-~~~~yl~~~-~~~-~~~~~~l~-------------------------------   86 (226)
T TIGR03420        41 LYLWGESGSGKSHLLQAACAAAEERG-KSAIYLPLA-ELA-QADPEVLE-------------------------------   86 (226)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCC-CCEEEECHH-HHH-HHHHHHHH-------------------------------
T ss_conf             99989999988999999999986269-957995299-987-75399997-------------------------------


Q ss_pred             ECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCH
Q ss_conf             806420233442000113220440453100246543115677776654305980799658402
Q gi|255764515|r  100 INFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPS  162 (458)
Q Consensus       100 ~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi  162 (458)
                                    .....+++++|..|.+.+....+ ...+..+-.+....+ .+++|++.-
T Consensus        87 --------------~l~~~d~l~iDDi~~i~~~~~~e-~~lF~l~N~~~~~~~-~ilits~~~  133 (226)
T TIGR03420        87 --------------GLEQADLVCLDDVEAIAGQPEWQ-EALFHLYNRVREAGG-RLLIAGRAA  133 (226)
T ss_pred             --------------HCCCCCEEEEECHHHHCCCHHHH-HHHHHHHHHHHHHCC-EEEEECCCC
T ss_conf             --------------27448999996633343783789-999999999986528-289867888


No 312
>PRK10263 DNA translocase FtsK; Provisional
Probab=92.58  E-value=0.42  Score=24.93  Aligned_cols=12  Identities=33%  Similarity=0.543  Sum_probs=7.8

Q ss_pred             CCCHHHHHHHHH
Q ss_conf             998689999999
Q gi|255764515|r   27 GSGKTVSVLTAL   38 (458)
Q Consensus        27 G~GKT~~al~~~   38 (458)
                      ++|-|++.|.+.
T Consensus       160 ~lGaTL~LL~~W  171 (1355)
T PRK10263        160 SSGGTIALLCVW  171 (1355)
T ss_pred             HHHHHHHHHHHH
T ss_conf             063899999999


No 313
>pfam06068 TIP49 TIP49 C-terminus. This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear
Probab=92.54  E-value=0.12  Score=28.14  Aligned_cols=24  Identities=21%  Similarity=0.266  Sum_probs=19.7

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             980999588998689999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l   41 (458)
                      +..|++.++|+|||..|++++..|
T Consensus        51 raiLlaGppGTGKTAlA~aiakeL   74 (395)
T pfam06068        51 RAVLIAGPPGTGKTALAIAISKEL   74 (395)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             389987799988899999999974


No 314
>KOG4150 consensus
Probab=92.43  E-value=0.68  Score=23.65  Aligned_cols=85  Identities=9%  Similarity=0.039  Sum_probs=55.5

Q ss_pred             CCCCEEEEHHHHHHHHHHHHH------------------CCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCC
Q ss_conf             488403422236788866410------------------00265334458998764245885589984422111622001
Q gi|255764515|r  319 ANAAPIIVAYHFNSDLARLQK------------------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQY  380 (458)
Q Consensus       319 ~~~~kviif~~~~~~~~~i~~------------------~~~~g~~~~~r~~~i~~f~~~~~~vli~s~~~~~~GlnL~~  380 (458)
                      .++-.+|-||.-...-+.+..                  .+-+|-+.+.|+++-.+.--|+..-+| ++.|...||++-.
T Consensus       523 ~~~~R~IAFC~~R~~CEL~~~~~R~I~~ET~~~LV~~i~SYRGGY~A~DRRKIE~~~F~G~L~giI-aTNALELGIDIG~  601 (1034)
T KOG4150         523 QHGLRCIAFCPSRKLCELVLCLTREILAETAPHLVEAITSYRGGYIAEDRRKIESDLFGGKLCGII-ATNALELGIDIGH  601 (1034)
T ss_pred             HCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCEEEEEE-ECCHHHHCCCCCC
T ss_conf             718738996328989999999999999874478999998614775355677778885178268998-5360744424356


Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             7859999089989868644566662
Q gi|255764515|r  381 GGNILVFFSLWWDLEEHQQMIERIG  405 (458)
Q Consensus       381 a~~~iI~~~~~wn~~~~~Q~~gRi~  405 (458)
                       -+.+++...|.+.+.++|.-||.-
T Consensus       602 -LDAVl~~GFP~S~aNl~QQ~GRAG  625 (1034)
T KOG4150         602 -LDAVLHLGFPGSIANLWQQAGRAG  625 (1034)
T ss_pred             -CCEEEECCCCCHHHHHHHHHHHCC
T ss_conf             -436898268506778998721101


No 315
>TIGR00596 rad1 DNA repair protein (rad1); InterPro: IPR006167    All proteins in this family, for which functions are known, are components in a multiprotein endonuclease complex, usually made up of Rad1 and Rad10 homologues. This complex is used primarily for nucleotide excision repair but also for some aspects of recombinational repair in some species. Most Archaeal species also have homologues of these genes, but the function of the Archaeal proteins is not known, so are not included in this family.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity, 0006281 DNA repair.
Probab=92.41  E-value=0.28  Score=25.97  Aligned_cols=81  Identities=12%  Similarity=0.102  Sum_probs=50.4

Q ss_pred             CEEEEEHHHCCCCCCCCC-CCCEEEEECCCCCHHHHHHHHHHHHCCCCH-HCCCC-CCEEEEEEEECCCHHHHHHHHHHH
Q ss_conf             589984422111622001-785999908998986864456666202202-03787-752899998589968999999999
Q gi|255764515|r  363 PLLFAHPASCGHGLNLQY-GGNILVFFSLWWDLEEHQQMIERIGVTRQR-QAGFK-RAVFVYYLIAQNTIDELVLQRLRT  439 (458)
Q Consensus       363 ~vli~s~~~~~~GlnL~~-a~~~iI~~~~~wn~~~~~Q~~gRi~~~r~h-R~Gq~-~~v~v~~li~~~tide~i~~~~~~  439 (458)
                      .|||.+.++.....-|+. -=++||+||+.-|+-+  |.+    -+||. |.++. ....||+|+.-+||||.-|=.-.+
T Consensus       542 eilistfksL~~nC~L~e~~P~Yvimy~~d~~FIR--q~E----VY~A~v~~~~p~drmrVYFlyYGgS~EEQ~YLts~R  615 (939)
T TIGR00596       542 EILISTFKSLEDNCVLEELKPRYVIMYEPDVSFIR--QVE----VYKASVRPLRPLDRMRVYFLYYGGSVEEQRYLTSVR  615 (939)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCEE--EEE----EEEEEECCCCCCCCEEEEEEEECCCHHHHHHHHHHH
T ss_conf             10122334320033100278535898578879221--478----898885388695512577876177267877876788


Q ss_pred             H-HHHHHHHHH
Q ss_conf             9-999999985
Q gi|255764515|r  440 K-STIQDLLLN  449 (458)
Q Consensus       440 K-~~~~~~~~~  449 (458)
                      | ++.++-+++
T Consensus       616 REKdAF~kLIr  626 (939)
T TIGR00596       616 REKDAFEKLIR  626 (939)
T ss_pred             HHHHHHHHHHH
T ss_conf             88888878864


No 316
>PRK06321 replicative DNA helicase; Provisional
Probab=92.28  E-value=0.71  Score=23.54  Aligned_cols=41  Identities=12%  Similarity=0.328  Sum_probs=18.3

Q ss_pred             CCCCCEEEEECC--CCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             017859999089--98986864456666202202037877528999
Q gi|255764515|r  379 QYGGNILVFFSL--WWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       379 ~~a~~~iI~~~~--~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                      |.| ++|+|+--  .+++.. .+-+.-+ ...-||.|.+-.|...+
T Consensus       413 qdA-D~V~~l~R~~~~~~~~-~~~~~e~-ivaK~R~G~~g~v~~~f  455 (472)
T PRK06321        413 QDS-DLVMFLLRREYYDPND-KPGTAEL-IVAKNRHGSIGSVPLVF  455 (472)
T ss_pred             HHC-CEEEEECCHHHCCCCC-CCCCEEE-EEECCCCCCCCEEEEEE
T ss_conf             308-6899974453249878-8982699-99726789872599998


No 317
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321   These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction . Members of this family may be found in some species that do not have type IV pili but have related structures for DNA uptake and natural transformation. ; GO: 0005524 ATP binding, 0006810 transport.
Probab=92.11  E-value=0.37  Score=25.29  Aligned_cols=40  Identities=20%  Similarity=0.342  Sum_probs=21.7

Q ss_pred             HHHHHHCCCEEE--EECCCCCHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             999996798099--9588998689999999999975999499
Q gi|255764515|r   11 VDWILDHKRCAI--WASMGSGKTVSVLTALSYIHLWGEKSVL   50 (458)
Q Consensus        11 v~~~~~~~~~ll--~~~~G~GKT~~al~~~~~l~~~~~~~~L   50 (458)
                      +..+.+.++||+  ..++|||||=|.-+++.+++.....-+|
T Consensus       119 ~~~~a~~~~GLiLVTGPTGSGKSTTlAsmIDyIN~~~~~HIi  160 (350)
T TIGR01420       119 LRELAERPRGLILVTGPTGSGKSTTLASMIDYINKNKAGHII  160 (350)
T ss_pred             HHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCCCE
T ss_conf             999983669938987688986789999999787403888825


No 318
>PRK08082 consensus
Probab=91.93  E-value=0.78  Score=23.29  Aligned_cols=42  Identities=21%  Similarity=0.149  Sum_probs=18.9

Q ss_pred             CCCCCEEEEECCCC--CHHHHHHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             01785999908998--986864456666202202037877528999
Q gi|255764515|r  379 QYGGNILVFFSLWW--DLEEHQQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       379 ~~a~~~iI~~~~~w--n~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                      |.| ++|+|+-.+.  ++....+.+.-+. -.-||-|.+-.|...+
T Consensus       388 qdA-D~v~~l~R~~~y~~~~~~~~~~e~i-vaK~RnG~~g~v~l~f  431 (453)
T PRK08082        388 QDA-DIVAFLYRDDYYDRETENKNIIEII-IAKQRNGPVGTVELAF  431 (453)
T ss_pred             HHC-CEEEEECCHHHCCCCCCCCCEEEEE-EECCCCCCCCEEEEEE
T ss_conf             336-6898965565438888878806999-9736899861599998


No 319
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed
Probab=91.83  E-value=0.2  Score=26.82  Aligned_cols=43  Identities=16%  Similarity=0.287  Sum_probs=25.9

Q ss_pred             HHHHHHHHHC-----------CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             9999999967-----------9809995889986899999999999759994999916
Q gi|255764515|r    8 TKIVDWILDH-----------KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAP   54 (458)
Q Consensus         8 ~~~v~~~~~~-----------~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P   54 (458)
                      .+.|+|+.+-           ++.||..++|+|||+.|=+++..    ..-+.+-+..
T Consensus       165 ~EiVdfLk~P~k~~~~Gak~PkGvLL~GPPGtGKTlLAkAvAgE----a~vpF~~~sg  218 (644)
T PRK10733        165 AELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGE----AKVPFFTISG  218 (644)
T ss_pred             HHHHHHHHCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHCC----CCCEEEEEEH
T ss_conf             99999812979999749979985177798998778999998645----5980899784


No 320
>KOG0731 consensus
Probab=91.79  E-value=0.19  Score=27.06  Aligned_cols=22  Identities=23%  Similarity=0.256  Sum_probs=17.6

Q ss_pred             CCEEEEECCCCCHHHHHHHHHH
Q ss_conf             9809995889986899999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALS   39 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~   39 (458)
                      +++||..++|+|||+-|-|.+.
T Consensus       345 kGvLL~GPPGTGKTLLAKAiAG  366 (774)
T KOG0731         345 KGVLLVGPPGTGKTLLAKAIAG  366 (774)
T ss_pred             CCEEEECCCCCCHHHHHHHHHC
T ss_conf             7517878999867899998853


No 321
>PHA00350 putative assembly protein
Probab=91.79  E-value=0.28  Score=25.99  Aligned_cols=22  Identities=23%  Similarity=0.220  Sum_probs=14.9

Q ss_pred             EEEECCCCCHHHHHHHH--HHHHH
Q ss_conf             99958899868999999--99999
Q gi|255764515|r   21 AIWASMGSGKTVSVLTA--LSYIH   42 (458)
Q Consensus        21 ll~~~~G~GKT~~al~~--~~~l~   42 (458)
                      ++...+|+|||..|...  +-.|+
T Consensus         5 ~~~G~pGSyKS~~av~~~ilPALk   28 (402)
T PHA00350          5 AIVGRPGSYKSYEAVVYHIIPALK   28 (402)
T ss_pred             EEECCCCCCCCEEEEHHHHHHHHH
T ss_conf             982599997660110867688985


No 322
>PRK07132 DNA polymerase III subunit delta'; Validated
Probab=91.71  E-value=0.83  Score=23.14  Aligned_cols=23  Identities=13%  Similarity=0.098  Sum_probs=17.5

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             09995889986899999999999
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIH   42 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~   42 (458)
                      .|+..+-|+|||-+|..++..+.
T Consensus        23 YLF~G~~G~Gk~~~a~~~a~~l~   45 (303)
T PRK07132         23 FLLKSNYNNDLDESILYFLNKFN   45 (303)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC
T ss_conf             88678998679999999999972


No 323
>PRK08760 replicative DNA helicase; Provisional
Probab=91.69  E-value=0.83  Score=23.13  Aligned_cols=42  Identities=14%  Similarity=0.208  Sum_probs=18.1

Q ss_pred             CCCCCEEEEECCC--CCHHHHH-HHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             0178599990899--8986864-456666202202037877528999
Q gi|255764515|r  379 QYGGNILVFFSLW--WDLEEHQ-QMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       379 ~~a~~~iI~~~~~--wn~~~~~-Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                      |.| ++|+|+..+  +++.... +-+.-+. -.-||.|.+-.|.+.+
T Consensus       413 qdA-DvV~~l~R~~~y~~~~~~~~~~~e~i-vaKnR~G~~G~v~l~f  457 (476)
T PRK08760        413 QDA-DMIVFIYRDDYYNKENSPDKGLAEII-IGKHRGGPTGSCKLKF  457 (476)
T ss_pred             HCC-CEEEEECCHHHCCCCCCCCCCEEEEE-EECCCCCCCCEEEEEE
T ss_conf             208-68999624532387679888807999-9746789862699998


No 324
>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369    GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway. ; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015628 protein secretion by the type II secretion system, 0015627 type II protein secretion system complex.
Probab=91.64  E-value=0.53  Score=24.30  Aligned_cols=22  Identities=23%  Similarity=0.116  Sum_probs=12.5

Q ss_pred             CCCCCCCCCCCCCHHCCCCCCC
Q ss_conf             3541000223430001343333
Q gi|255764515|r  289 ANGAVYYDEEKHWKEVHDEKIK  310 (458)
Q Consensus       289 ~~~~~~~~~~~~~~~~~~~k~~  310 (458)
                      +.+|+.|+-.+....--++|+.
T Consensus       279 vEDPVEY~i~GIgQ~Qvn~kIg  300 (495)
T TIGR02533       279 VEDPVEYQIEGIGQIQVNPKIG  300 (495)
T ss_pred             EECCEEEEECCCCEEEECCCCC
T ss_conf             6578247624876365146543


No 325
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]
Probab=91.63  E-value=0.25  Score=26.31  Aligned_cols=23  Identities=22%  Similarity=0.215  Sum_probs=19.5

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             80999588998689999999999
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l   41 (458)
                      ..|++.++|+|||..|++++..|
T Consensus        67 giLi~GppgTGKTAlA~gIa~eL   89 (450)
T COG1224          67 GILIVGPPGTGKTALAMGIAREL   89 (450)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH
T ss_conf             79997899976889999999985


No 326
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=91.57  E-value=0.86  Score=23.05  Aligned_cols=33  Identities=27%  Similarity=0.226  Sum_probs=23.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             0999588998689999999999975999499991
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIA   53 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~   53 (458)
                      .+++...|+|||=++--++..+...+ +++++|+
T Consensus        78 I~lvG~~G~GKTTT~AKLA~~~~~~~-~kV~lia  110 (270)
T PRK06731         78 IALIGPTGVGKTTTLAKMAWQFHGKK-KTVGFIT  110 (270)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEE
T ss_conf             99988898988999999999998679-9089998


No 327
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB; InterPro: IPR014149   This entry represents TrbB, a protein, which is encoded in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer . TrbB is a homologue of the vir system VirB11 ATPase , and the Flp pilus system ATPase TadA ..
Probab=91.54  E-value=0.86  Score=23.04  Aligned_cols=34  Identities=24%  Similarity=0.287  Sum_probs=15.6

Q ss_pred             HHHHH-HHHHHCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             99999-99996798099958899868999999999
Q gi|255764515|r    7 QTKIV-DWILDHKRCAIWASMGSGKTVSVLTALSY   40 (458)
Q Consensus         7 Q~~~v-~~~~~~~~~ll~~~~G~GKT~~al~~~~~   40 (458)
                      |...+ +.+..++|.++...+|+|||=-+=|++..
T Consensus       128 Q~d~l~~Av~ar~NIlv~GGTGSGKTTLaNAlla~  162 (315)
T TIGR02782       128 QRDVLREAVAARKNILVVGGTGSGKTTLANALLAE  162 (315)
T ss_pred             HHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHH
T ss_conf             99999999971298899814588579999999998


No 328
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=91.40  E-value=0.32  Score=25.60  Aligned_cols=43  Identities=16%  Similarity=0.080  Sum_probs=20.2

Q ss_pred             CEEECCCCCCCCCCCCCCHH-HHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             20440453100246543115-67777665430598079965840
Q gi|255764515|r  119 ATIVVDESTKLKSFRLRQGS-KTARALAKPAWESERFIELTGTP  161 (458)
Q Consensus       119 ~~iIiDEaH~lkn~~~~~~s-~~~~~l~~~~~~~~~~l~LTgTP  161 (458)
                      -.+.|||.|.+-..++..++ -+++.+...-.+..-+..-.-||
T Consensus       268 iILFIDEiHtliGaG~~~G~~DAaNlLKPaLarGelr~IgATT~  311 (852)
T TIGR03346       268 IILFIDELHTLVGAGKAEGAMDAGNMLKPALARGELHCIGATTL  311 (852)
T ss_pred             EEEEEHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCH
T ss_conf             79996125553268876664106777437874798559982789


No 329
>CHL00195 ycf46 Ycf46; Provisional
Probab=91.37  E-value=0.36  Score=25.34  Aligned_cols=44  Identities=23%  Similarity=0.114  Sum_probs=22.5

Q ss_pred             HHHHCCCCCCEEEEEHHHCCCCCC--CCCC--CCEEEEECCCCCHHHH
Q ss_conf             764245885589984422111622--0017--8599990899898686
Q gi|255764515|r  354 IQEWNEGKIPLLFAHPASCGHGLN--LQYG--GNILVFFSLWWDLEEH  397 (458)
Q Consensus       354 i~~f~~~~~~vli~s~~~~~~Gln--L~~a--~~~iI~~~~~wn~~~~  397 (458)
                      +...++.+.+|+++.+.--=..|+  |...  -+.++|.++|-...+.
T Consensus       351 Lt~m~e~~~~VfViattN~~~~L~pellR~GRFD~~~~v~lP~~~~R~  398 (491)
T CHL00195        351 ITWLSEKKSPVFVVATANNIDSLPLELLRKGRFDEIFFLDLPNLEERE  398 (491)
T ss_pred             HHHHCCCCCCEEEEEECCCCCCCCHHHCCCCCCCEEEECCCCCHHHHH
T ss_conf             998646899769999589975589877089877704764895989999


No 330
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=91.34  E-value=0.9  Score=22.91  Aligned_cols=48  Identities=23%  Similarity=0.266  Sum_probs=23.6

Q ss_pred             HCCCCCCEEEEEHHHCCCCC--CCCCCCCEE-EEECCCCCHHHHHHHHHHH
Q ss_conf             24588558998442211162--200178599-9908998986864456666
Q gi|255764515|r  357 WNEGKIPLLFAHPASCGHGL--NLQYGGNIL-VFFSLWWDLEEHQQMIERI  404 (458)
Q Consensus       357 f~~~~~~vli~s~~~~~~Gl--nL~~a~~~i-I~~~~~wn~~~~~Q~~gRi  404 (458)
                      .+.+..+|.|+|+++-..|=  -|+.-++.+ |=+..-.+|..+.++..+.
T Consensus       220 l~~~~~~V~lIT~DtyRigA~eQLk~ya~il~vp~~vv~~~~~l~~~l~~~  270 (282)
T TIGR03499       220 LEHGKKKVALITTDTYRIGAVEQLKTYAKILGVPVKVARDPKELAKALERL  270 (282)
T ss_pred             HHCCCCCEEEEEECCCCHHHHHHHHHHHHHHCCEEEEECCHHHHHHHHHHC
T ss_conf             973899679998077767899999999999597489939999999999865


No 331
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]
Probab=91.28  E-value=0.92  Score=22.87  Aligned_cols=103  Identities=16%  Similarity=0.171  Sum_probs=49.1

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCC-CCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCE
Q ss_conf             8099958899868999999999997599-949999160465699999999855888815999858978988873077986
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVL   97 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~-~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i   97 (458)
                      -..|..++|+|||--+=++..+....+. .+++.+..    + .|..++..-...         +.              
T Consensus       115 plfi~G~~GlGKTHLl~Aign~~~~~~~~a~v~y~~s----e-~f~~~~v~a~~~---------~~--------------  166 (408)
T COG0593         115 PLFIYGGVGLGKTHLLQAIGNEALANGPNARVVYLTS----E-DFTNDFVKALRD---------NE--------------  166 (408)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCH----H-HHHHHHHHHHHH---------HH--------------
T ss_conf             5799879999789999999999986299864885048----9-989999999885---------04--------------


Q ss_pred             EEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECC--CCH
Q ss_conf             99806420233442000113220440453100246543115677776654305980799658--402
Q gi|255764515|r   98 YVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTG--TPS  162 (458)
Q Consensus        98 ~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTg--TPi  162 (458)
                                 .+.++..+.-|++++|-.|.+.+....+ .-.+...-.+....+ .+++|+  +|-
T Consensus       167 -----------~~~Fk~~y~~dlllIDDiq~l~gk~~~q-eefFh~FN~l~~~~k-qIvltsdr~P~  220 (408)
T COG0593         167 -----------MEKFKEKYSLDLLLIDDIQFLAGKERTQ-EEFFHTFNALLENGK-QIVLTSDRPPK  220 (408)
T ss_pred             -----------HHHHHHHHCCCEEEECHHHHHCCCHHHH-HHHHHHHHHHHHCCC-EEEEECCCCCH
T ss_conf             -----------8888876426735551386756771579-999999998885088-79997078832


No 332
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]
Probab=91.26  E-value=0.59  Score=24.03  Aligned_cols=45  Identities=33%  Similarity=0.421  Sum_probs=30.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCC-----CCCEEEEECCHHHHHHHHHH
Q ss_conf             09995889986899999999999759-----99499991604656999999
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWG-----EKSVLVIAPLRVAQSVWTSE   65 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~-----~~~~LIv~P~~l~~~~W~~E   65 (458)
                      .++-...|+|||-.|+--.++|.+..     .+++||+.|..+.. -+.+.
T Consensus       229 lVVQGaAGSGKTtiALHRvAyLlY~~R~~l~~k~vlvl~PN~vFl-eYis~  278 (747)
T COG3973         229 LVVQGAAGSGKTTIALHRVAYLLYGYRGPLQAKPVLVLGPNRVFL-EYISR  278 (747)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEECCCHHHH-HHHHH
T ss_conf             899558888713588999999985356624668659982838999-99987


No 333
>PRK05595 replicative DNA helicase; Provisional
Probab=91.21  E-value=0.93  Score=22.83  Aligned_cols=42  Identities=12%  Similarity=0.295  Sum_probs=22.2

Q ss_pred             CCCCCEEEEECC--CCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             017859999089--98986864456666202202037877528999
Q gi|255764515|r  379 QYGGNILVFFSL--WWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       379 ~~a~~~iI~~~~--~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                      |.| ++|+|+-.  .+++....+-+..+.- .-||.|.+-.|...+
T Consensus       385 qdA-D~v~~l~R~~~y~~~~~~~~~~eliv-aKnR~G~~G~v~~~f  428 (444)
T PRK05595        385 QDA-DLVMFLYRDEYYNKETEDKNVAECII-AKQRNGPTGTVKLAW  428 (444)
T ss_pred             HHC-CEEEEECCHHHCCCCCCCCCCEEEEE-EECCCCCCCEEEEEE
T ss_conf             437-68989654421488877788258999-806889961599998


No 334
>smart00491 HELICc2 helicase superfamily c-terminal domain.
Probab=91.12  E-value=0.48  Score=24.58  Aligned_cols=55  Identities=13%  Similarity=0.284  Sum_probs=32.7

Q ss_pred             CCCCCCCHHHHHHHHHHHCCC-C--CCEEEEEH-HHCCCCCCCCC-CCCEEEEECCCCCH
Q ss_conf             002653344589987642458-8--55899844-22111622001-78599990899898
Q gi|255764515|r  340 AFPQGRTLDKDPCTIQEWNEG-K--IPLLFAHP-ASCGHGLNLQY-GGNILVFFSLWWDL  394 (458)
Q Consensus       340 ~~~~g~~~~~r~~~i~~f~~~-~--~~vli~s~-~~~~~GlnL~~-a~~~iI~~~~~wn~  394 (458)
                      .|.++....++...+++|... +  ..+|++.. ...+|||||.. .++.+|...+|+-+
T Consensus        23 vf~E~~~~~~~~~~l~~f~~~~~~~gaiL~~v~~Gk~sEGiDf~~~~~r~viivglP~p~   82 (142)
T smart00491       23 VFIEGKDSGETEELLEKYSAACEARGALLLAVARGKVSEGIDFPDDLGRAVIIVGIPFPN   82 (142)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHCCCCEEEEEEECCEEEEEECCCCCCEEEEEEEECCCCC
T ss_conf             999589835799999999986236981999984415752150599776599997089999


No 335
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only]
Probab=90.76  E-value=1  Score=22.57  Aligned_cols=138  Identities=13%  Similarity=0.100  Sum_probs=65.1

Q ss_pred             CCCCHHHHHHHHHHHHH-HCCCCCEEEEECCHHHHHHHHHHHHHHC-----CCCCCE-EEEEECCH---H-HHHHHHCCC
Q ss_conf             89986899999999999-7599949999160465699999999855-----888815-99985897---8-988873077
Q gi|255764515|r   26 MGSGKTVSVLTALSYIH-LWGEKSVLVIAPLRVAQSVWTSEVQRWS-----NFSHMN-ISVITGTV---K-QRTKVLKTP   94 (458)
Q Consensus        26 ~G~GKT~~al~~~~~l~-~~~~~~~LIv~P~~l~~~~W~~Ei~kf~-----~~~~~~-~~~~~g~~---~-~r~~~~~~~   94 (458)
                      -|+|||.....-+++|+ ..+.+++++-+-+..+.++...-+.+|.     ..|.+. ..+-++..   + .....+...
T Consensus       185 AGSGKT~~La~Kaa~lh~knPd~~I~~Tfftk~L~s~~r~lv~~F~f~~~e~~pdW~~~l~~h~wgG~t~~g~y~~~~~~  264 (660)
T COG3972         185 AGSGKTELLAHKAAELHSKNPDSRIAFTFFTKILASTMRTLVPEFFFMRVEKQPDWGTKLFCHNWGGLTKEGFYGMYRYI  264 (660)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCHHHHHHH
T ss_conf             47873029887778974479986389986667888999999999999886248872426888435787888603889998


Q ss_pred             CCEEEECCCC----HHHH----HHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHH--
Q ss_conf             9869980642----0233----44200011322044045310024654311567777665430598079965840231--
Q gi|255764515|r   95 AVLYVINFEN----LGWL----VQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPN--  164 (458)
Q Consensus        95 ~~i~i~s~e~----~~~~----~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n--  164 (458)
                      ....-++|..    ++..    ....+...-+|.|.+||++-+       ....+..+-.+.... .++.--+--.||  
T Consensus       265 ~~~~~~~fsg~g~~F~~aC~eli~~~~~~~~yD~ilIDE~QDF-------P~~F~~Lcf~~tkd~-KrlvyAyDelQNls  336 (660)
T COG3972         265 CHYYEIPFSGFGNGFDAACKELIADINNKKAYDYILIDESQDF-------PQSFIDLCFMVTKDK-KRLVYAYDELQNLS  336 (660)
T ss_pred             HCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCCC-------CHHHHHHHHHHHCCC-CEEEEEHHHHHCCC
T ss_conf             4266545478774067999999986425642317994245547-------789999999982475-43898657643111


Q ss_pred             -----HCCCHHH
Q ss_conf             -----0010134
Q gi|255764515|r  165 -----GLIDLWG  171 (458)
Q Consensus       165 -----~~~el~~  171 (458)
                           .|.|+|+
T Consensus       337 ~~~m~ppe~iFg  348 (660)
T COG3972         337 NVKMRPPEEIFG  348 (660)
T ss_pred             CCCCCCHHHHCC
T ss_conf             567799899648


No 336
>pfam05872 DUF853 Bacterial protein of unknown function (DUF853). This family consists of several bacterial proteins of unknown function. One member from Brucella melitensis is thought to be an ATPase.
Probab=90.76  E-value=0.33  Score=25.60  Aligned_cols=31  Identities=23%  Similarity=0.235  Sum_probs=25.0

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             6798099958899868999999999997599
Q gi|255764515|r   16 DHKRCAIWASMGSGKTVSVLTALSYIHLWGE   46 (458)
Q Consensus        16 ~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~   46 (458)
                      -|+.+|++..+|+|||.+.=.+++.+...|.
T Consensus        20 ~NRHGLiaGATGTGKTvTLq~lAE~~S~~GV   50 (504)
T pfam05872        20 ANRHGLIAGATGTGKTVTLQVLAESFSDAGV   50 (504)
T ss_pred             CCCCCEECCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             0521662265778617899999998745499


No 337
>PRK13765 ATP-dependent protease Lon; Provisional
Probab=90.72  E-value=0.58  Score=24.06  Aligned_cols=50  Identities=16%  Similarity=0.205  Sum_probs=32.2

Q ss_pred             HHHHHHHH---H-HCCCEEEEECCCCCHHHHHHHHHHHHHHCC-------------CCCEEEEECCH
Q ss_conf             99999999---9-679809995889986899999999999759-------------99499991604
Q gi|255764515|r    7 QTKIVDWI---L-DHKRCAIWASMGSGKTVSVLTALSYIHLWG-------------EKSVLVIAPLR   56 (458)
Q Consensus         7 Q~~~v~~~---~-~~~~~ll~~~~G~GKT~~al~~~~~l~~~~-------------~~~~LIv~P~~   56 (458)
                      |.+|++-+   . ++++.++..++|+||++.|=++.+.|-...             ..|.+-++|+.
T Consensus        36 Qe~Av~~i~~Aa~qrrhvlliG~PGtGKSmlakam~elLpk~~ledilv~pNp~d~~~P~v~~vpag  102 (637)
T PRK13765         36 QEHAVEVIKKAAKQRRHVMLIGSPGTGKSMLAKAMAELLPKEELQDILVYPNPEDPNNPKIRTVPAG  102 (637)
T ss_pred             HHHHHHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCEEEEECCC
T ss_conf             1999999999998437389868999879999999997579886562799679888889805741687


No 338
>TIGR01242 26Sp45 26S proteasome subunit P45 family; InterPro: IPR005937    Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system. The 26S proteasome (a 2 MDa complex) is made up of two subcomplexes: the 20S proteasome and the regulatory complex. The former is a 700 kDa cylindrical protease complex consisting of four stacks of heptameric rings with 28 subunits (i.e., 7777) with molecular masses of about 20-35 kDa, whereas the latter is a 700-1000 kDa complex consisting of at least 18 subunits with molecular masses of 28-110 kDa, including 6 putative ATPases (Rpt1-Rpt6) and 12 non-ATPase subunits (Rpn1-12).     Members of the 26S proteasome subunit P45 family: ATPase p45/Sug1/Rpt6 may be phosphorylated within the proteasome. This phosphorylation event may play a key role in ATP-dependent proteolysis because a good correlation exists between the inhibition pattern of protein kinase inhibitors against the phosphorylation of p45 and that against the ATP-dependent proteolytic activity , .   More information about these protein can be found at Protein of the Month: AAA ATPases .; GO: 0016787 hydrolase activity, 0030163 protein catabolic process, 0005634 nucleus, 0005737 cytoplasm.
Probab=90.55  E-value=0.2  Score=26.87  Aligned_cols=20  Identities=20%  Similarity=0.348  Sum_probs=9.4

Q ss_pred             CEEEEECCCCCHHHHHHHHH
Q ss_conf             80999588998689999999
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTAL   38 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~   38 (458)
                      +.||..++|+|||+.|=|.+
T Consensus       158 GvLLyGPPGtGKTLlAKAvA  177 (364)
T TIGR01242       158 GVLLYGPPGTGKTLLAKAVA  177 (364)
T ss_pred             CEEEECCCCCCHHHHHHHHH
T ss_conf             65700757976889999863


No 339
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR013462    The GvpN protein is associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy , . It belongs to a larger family of ATPases .; GO: 0000166 nucleotide binding, 0005524 ATP binding, 0031412 gas vesicle organization and biogenesis, 0031411 gas vesicle.
Probab=90.47  E-value=0.46  Score=24.68  Aligned_cols=39  Identities=15%  Similarity=0.280  Sum_probs=24.2

Q ss_pred             HHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             9999679809995889986899999999999759994999916
Q gi|255764515|r   12 DWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAP   54 (458)
Q Consensus        12 ~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P   54 (458)
                      .||....-.=+-.+.|+|||-.|+.++..    -.+|+++|.=
T Consensus        16 ~yL~~G~PvHl~GPaG~GKT~LA~hvA~~----r~RPV~l~~G   54 (265)
T TIGR02640        16 RYLKSGYPVHLRGPAGTGKTTLAMHVARK----RDRPVVLING   54 (265)
T ss_pred             HHHCCCCCEEEECCCCCCHHHHHHHHHHH----CCCCEEEEEC
T ss_conf             63227886674478885568999999973----6896899865


No 340
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.; GO: 0003677 DNA binding, 0005524 ATP binding, 0009378 Holliday junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=90.38  E-value=0.24  Score=26.36  Aligned_cols=24  Identities=17%  Similarity=0.207  Sum_probs=18.6

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             980999588998689999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l   41 (458)
                      ..+||+.+||+|||=-|-..|.++
T Consensus        31 DH~LL~GPPGLGKTTLA~IiA~Em   54 (305)
T TIGR00635        31 DHLLLYGPPGLGKTTLAHIIANEM   54 (305)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             416631756874678999999983


No 341
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=90.37  E-value=1.1  Score=22.36  Aligned_cols=57  Identities=12%  Similarity=-0.010  Sum_probs=35.2

Q ss_pred             HHHHHHHCC-----CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             999999679-----80999588998689999999999975999499991604656999999998
Q gi|255764515|r   10 IVDWILDHK-----RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQR   68 (458)
Q Consensus        10 ~v~~~~~~~-----~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~k   68 (458)
                      .++.++..+     -.++..++|+|||+.+.-++......| .++++|+.-.... .|.+..+.
T Consensus        12 ~ld~~lggGip~gs~~li~G~~GtGKsi~~~~~~~~~l~~g-~~~~yis~e~t~~-~~i~qm~s   73 (230)
T PRK08533         12 ELHKRLGGGIPFGSIILIEGDESTGKSILSQRLAYGFLQNG-YSVSYVSSQLTTT-EFIKQMMS   73 (230)
T ss_pred             HHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEEECCCHH-HHHHHHHH
T ss_conf             57887178988984899986899878999999999998789-8699999438999-99999998


No 342
>PRK10416 cell division protein FtsY; Provisional
Probab=90.35  E-value=1.1  Score=22.35  Aligned_cols=18  Identities=22%  Similarity=0.174  Sum_probs=9.6

Q ss_pred             HHHHHHHCCCCCCEEEEE
Q ss_conf             998764245885589984
Q gi|255764515|r  351 PCTIQEWNEGKIPLLFAH  368 (458)
Q Consensus       351 ~~~i~~f~~~~~~vli~s  368 (458)
                      ...++...+..++|+|+-
T Consensus       367 ~dai~~a~~~~~DvviiD  384 (499)
T PRK10416        367 FDAIQAAKARNVDVLIAD  384 (499)
T ss_pred             HHHHHHHHHCCCCEEEEE
T ss_conf             999999997299989985


No 343
>pfam07015 VirC1 VirC1 protein. This family consists of several bacterial VirC1 proteins. In Agrobacterium tumefaciens, a cis-active 24-base-pair sequence adjacent to the right border of the T-DNA, called overdrive, stimulates tumour formation by increasing the level of T-DNA processing. It is thought that the virC operon which enhances T-DNA processing probably does so because the VirC1 protein interacts with overdrive. It has now been shown that the virC1 gene product binds to overdrive but not to the right border of T-DNA.
Probab=90.07  E-value=1.2  Score=22.20  Aligned_cols=115  Identities=16%  Similarity=0.133  Sum_probs=56.8

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEE-E-CCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEEECCC
Q ss_conf             899868999999999997599949999-1-60465699999999855888815999858978988873077986998064
Q gi|255764515|r   26 MGSGKTVSVLTALSYIHLWGEKSVLVI-A-PLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFE  103 (458)
Q Consensus        26 ~G~GKT~~al~~~~~l~~~~~~~~LIv-~-P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i~s~e  103 (458)
                      =|+|||-.++.++..+...|. ++++| + |..-+. .|.+.-.+-...+.. ..+......                 .
T Consensus        11 GG~GKtT~a~~la~~~~~~g~-~V~liD~Dpq~s~~-~W~~~a~~~~~~~~~-~~v~~~~~~-----------------~   70 (231)
T pfam07015        11 GGAGKTTALMGLCSALASDGK-RVALFEADENRPLT-KWRENALRKGTWDPA-CEIFNADEL-----------------P   70 (231)
T ss_pred             CCCCHHHHHHHHHHHHHHCCC-EEEEEECCCCCCHH-HHHHHHHHCCCCCCC-CCEECCCCH-----------------H
T ss_conf             986599999999999996899-59999689986889-999987646888876-522205660-----------------1


Q ss_pred             CHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCHHHHHHHC
Q ss_conf             2023344200011322044045310024654311567777665430598079965840231001013467751
Q gi|255764515|r  104 NLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL  176 (458)
Q Consensus       104 ~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~~~el~~ll~~l  176 (458)
                      .+....+.. ....||.||+|=.-..        +.......   ..+..++.    |++-++.|+|.-...+
T Consensus        71 ~l~~~~~~~-~~~~yD~VIIDtpg~~--------s~~~~~AI---~~ADlVLI----P~qpSplD~~~a~~t~  127 (231)
T pfam07015        71 LLEQAYEHA-EGSGFDYALADTHGGS--------SELNNTII---ASSDLLLI----PTMLTPLDIDEALATY  127 (231)
T ss_pred             HHHHHHHHH-HHCCCCEEEECCCCCC--------CHHHHHHH---HHCCEEEE----CCCCCHHHHHHHHHHH
T ss_conf             589999988-6579998998399857--------58999999---97898997----7899823399999999


No 344
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR005938    The ATPase Cdc48 is required for membrane fusion and protein degradation. It possesses chaperone-like activities and can functionally interact with Hsc70. Yeast CDC48 plays a role in cell division control whereas eukaryotic homologues are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.; GO: 0016787 hydrolase activity.
Probab=89.96  E-value=0.49  Score=24.54  Aligned_cols=23  Identities=22%  Similarity=0.323  Sum_probs=17.5

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             98099958899868999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSY   40 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~   40 (458)
                      ++.+|..++|+|||+.|=+.+..
T Consensus       241 kG~ll~GPPGtGktllaka~ane  263 (980)
T TIGR01243       241 KGVLLYGPPGTGKTLLAKAVANE  263 (980)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHH
T ss_conf             73587558986178999998753


No 345
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=89.87  E-value=1.2  Score=22.11  Aligned_cols=44  Identities=18%  Similarity=0.072  Sum_probs=28.9

Q ss_pred             HHHHHHHC-----CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             99999967-----980999588998689999999999975999499991
Q gi|255764515|r   10 IVDWILDH-----KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIA   53 (458)
Q Consensus        10 ~v~~~~~~-----~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~   53 (458)
                      +.+.+++.     .-.|+...+|+|||.-++-++..--..+..+.|.|+
T Consensus        12 GLD~iL~GGlp~g~~~LV~G~pGsGKTtla~QfL~~Ga~~~GE~~lyit   60 (501)
T PRK09302         12 GFDDITNGGLPKGRPTLVSGTAGTGKTLFALQFLHNGIKSFGEPGVFVT   60 (501)
T ss_pred             CHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             1577854898899779998389999999999999999885599789998


No 346
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms]
Probab=89.85  E-value=1.2  Score=22.10  Aligned_cols=35  Identities=23%  Similarity=0.260  Sum_probs=26.7

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             80999588998689999999999975999499991
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIA   53 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~   53 (458)
                      +..++..+|.|||+.|+..+..+...|..-++=++
T Consensus        24 kIf~G~apGVGKTyaML~~a~~~~~~G~DvviG~v   58 (890)
T COG2205          24 KIFLGAAPGVGKTYAMLSEAQRLLAEGVDVVIGVV   58 (890)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             89962688862799999999999975996799983


No 347
>PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed
Probab=89.74  E-value=1.3  Score=22.04  Aligned_cols=22  Identities=32%  Similarity=0.326  Sum_probs=18.1

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             8998689999999999975999
Q gi|255764515|r   26 MGSGKTVSVLTALSYIHLWGEK   47 (458)
Q Consensus        26 ~G~GKT~~al~~~~~l~~~~~~   47 (458)
                      =|+|||=.++.++..+...|.+
T Consensus        60 GGtGKTP~v~~la~~l~~~g~~   81 (334)
T PRK00652         60 GGNGKTPVVIWLAEQLQARGVK   81 (334)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCC
T ss_conf             8877799999999999976993


No 348
>PRK10867 signal recognition particle protein; Provisional
Probab=89.68  E-value=1.3  Score=22.02  Aligned_cols=34  Identities=29%  Similarity=0.307  Sum_probs=25.4

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             0999588998689999999999975999499991
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIA   53 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~   53 (458)
                      .+++.--|+|||=++--++.+++..+.+++|+||
T Consensus       103 Im~vGLqGsGKTTT~aKLA~~lk~k~~k~vllva  136 (453)
T PRK10867        103 VLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVS  136 (453)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             9997468885185899999999973898379855


No 349
>PRK10037 cell division protein; Provisional
Probab=89.58  E-value=1.3  Score=21.97  Aligned_cols=98  Identities=20%  Similarity=0.266  Sum_probs=48.9

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEE--ECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEEECCC
Q ss_conf             899868999999999997599949999--160465699999999855888815999858978988873077986998064
Q gi|255764515|r   26 MGSGKTVSVLTALSYIHLWGEKSVLVI--APLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFE  103 (458)
Q Consensus        26 ~G~GKT~~al~~~~~l~~~~~~~~LIv--~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i~s~e  103 (458)
                      =|.|||-.+.+++..|...| +++|+|  +|.+++.-.+.-.+   ....+.--....|. .-+...+.....+.+..|.
T Consensus        11 GGVGkTTltAnLA~aL~~~g-~~VlaID~dpqN~Lrlhfg~~~---~~~~Gwa~a~l~g~-~W~~a~~~~~~gl~~LPfG   85 (250)
T PRK10037         11 GGVGTTSITAALAWSLQMLG-ENVLVIDACPDNLLRLSFNVDF---THRQGWARALLDGQ-DWRDAGLRYTSQLDLLPFG   85 (250)
T ss_pred             CCCCHHHHHHHHHHHHHHCC-CCEEEEECCHHHHHHHHCCCCC---CCCCCHHHHHHCCC-CHHHHHHHCCCCCEEEECC
T ss_conf             88768999999999999779-9189995782566787549985---44772999985699-7899985056993697278


Q ss_pred             CHHHHH------------------HHCCCCCCCCEEECCCCCC
Q ss_conf             202334------------------4200011322044045310
Q gi|255764515|r  104 NLGWLV------------------QELKGTWPFATIVVDESTK  128 (458)
Q Consensus       104 ~~~~~~------------------~~~~~~~~~~~iIiDEaH~  128 (458)
                      .+....                  ..+.....|+.||+|=.+.
T Consensus        86 ~l~~~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~~vliD~P~g  128 (250)
T PRK10037         86 QLSIEEQENPQHWQTTLGDICSALQQLKASGRYQWILLDLPRG  128 (250)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCC
T ss_conf             7998998638877651799999986200257899899965999


No 350
>TIGR00376 TIGR00376 DNA helicase, putative; InterPro: IPR004483 Eukaryotic members of this family have been characterised as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterised as helicases.; GO: 0003677 DNA binding, 0005524 ATP binding.
Probab=89.50  E-value=1.3  Score=21.94  Aligned_cols=80  Identities=23%  Similarity=0.322  Sum_probs=52.4

Q ss_pred             CCHHHHHHHHHHHHCC-CEEEEECCCCCHHHHHHHHHHHHHHCCC-CCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             7478999999999679-8099958899868999999999997599-9499991604656999999998558888159998
Q gi|255764515|r    3 LAPHQTKIVDWILDHK-RCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI   80 (458)
Q Consensus         3 L~p~Q~~~v~~~~~~~-~~ll~~~~G~GKT~~al~~~~~l~~~~~-~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~   80 (458)
                      |..-|..++.+.+... -.++-.++|+|||.+...++......+. .++|+.+|.++..+.-.+-+..  ..|...+.-+
T Consensus       203 l~~~~~~~~~~~~~~~~~~~~~gp~g~g~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~d~~~~~~~~--~~p~~~~~~~  280 (709)
T TIGR00376       203 LNESQKEAVGFALSSKDLFLIHGPPGTGKTRTLVELIRQLVKRGPEERVLVTAPSNIAVDNLLERLAP--LYPDLKLLRL  280 (709)
T ss_pred             CCHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHHH--HCCCCEEEEC
T ss_conf             22346777654312344168726777762156899999998528533067623531037788888764--1454102222


Q ss_pred             ECCHH
Q ss_conf             58978
Q gi|255764515|r   81 TGTVK   85 (458)
Q Consensus        81 ~g~~~   85 (458)
                       |.+.
T Consensus       281 -g~p~  284 (709)
T TIGR00376       281 -GHPA  284 (709)
T ss_pred             -CCHH
T ss_conf             -6604


No 351
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=88.84  E-value=0.93  Score=22.83  Aligned_cols=46  Identities=20%  Similarity=0.406  Sum_probs=20.8

Q ss_pred             CCCEEEEHHHHHHHHHHHH-HCCCCCCCHHH-HHH-HH------HHH-CCCCCCEEEEE
Q ss_conf             8840342223678886641-00026533445-899-87------642-45885589984
Q gi|255764515|r  320 NAAPIIVAYHFNSDLARLQ-KAFPQGRTLDK-DPC-TI------QEW-NEGKIPLLFAH  368 (458)
Q Consensus       320 ~~~kviif~~~~~~~~~i~-~~~~~g~~~~~-r~~-~i------~~f-~~~~~~vli~s  368 (458)
                      ...++|||   ..+++.|- +++-.+++.++ -++ ++      +-| ..+.++|+.++
T Consensus       242 ekaPsIIF---iDEIDAIg~kR~d~~t~gDrEVQRTmleLL~qlDGFD~~~nvKVI~AT  297 (406)
T COG1222         242 EKAPSIIF---IDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFDPRGNVKVIMAT  297 (406)
T ss_pred             HCCCEEEE---EECHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEEC
T ss_conf             14984999---831122311113688885099999999999860588978876899855


No 352
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=88.81  E-value=0.96  Score=22.75  Aligned_cols=35  Identities=29%  Similarity=0.237  Sum_probs=26.4

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             809995889986899999999999759994999916
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAP   54 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P   54 (458)
                      ..++..++|+|||+-++-++......| .+++.|+-
T Consensus        25 ~~lI~G~pGsGKT~f~~qfl~~~~~~g-e~vlyvs~   59 (260)
T COG0467          25 VVLITGPPGTGKTIFALQFLYEGAREG-EPVLYVST   59 (260)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHCC-CEEEEEEE
T ss_conf             899993899868999999999776269-85899992


No 353
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=88.69  E-value=0.64  Score=23.81  Aligned_cols=25  Identities=24%  Similarity=0.139  Sum_probs=17.8

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9809995889986899999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIH   42 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~   42 (458)
                      .+-+|..|+|.|||..+=.++..+-
T Consensus       192 NNPvLiGEpGVGKTAIvEGLA~rIv  216 (786)
T COG0542         192 NNPVLVGEPGVGKTAIVEGLAQRIV  216 (786)
T ss_pred             CCCEEECCCCCCHHHHHHHHHHHHH
T ss_conf             9984766898889999989999974


No 354
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=88.53  E-value=1.5  Score=21.52  Aligned_cols=116  Identities=22%  Similarity=0.190  Sum_probs=61.9

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             09995889986899999999999759994999916046569999999985588881599985897898887307798699
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
                      .|++.|+|.||+=..+-++..+...+  ++|+|+----. .||.--..|.. .+.                    ..+++
T Consensus        96 iLIgGdPGIGKSTLLLQva~~lA~~~--~vLYVsGEES~-~QiklRA~RL~-~~~--------------------~~l~l  151 (456)
T COG1066          96 ILIGGDPGIGKSTLLLQVAARLAKRG--KVLYVSGEESL-QQIKLRADRLG-LPT--------------------NNLYL  151 (456)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCC--CEEEEECCCCH-HHHHHHHHHHC-CCC--------------------CCEEE
T ss_conf             99736898779899999999987059--57999677678-99999999828-996--------------------45577


Q ss_pred             ECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCC----CCHHH---HHHHHHHHHHCCCEEEEECCC
Q ss_conf             80642023344200011322044045310024654----31156---777766543059807996584
Q gi|255764515|r  100 INFENLGWLVQELKGTWPFATIVVDESTKLKSFRL----RQGSK---TARALAKPAWESERFIELTGT  160 (458)
Q Consensus       100 ~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~----~~~s~---~~~~l~~~~~~~~~~l~LTgT  160 (458)
                      .....+......+ ...+++++|+|=.+.+-++.-    ...+|   .+..+.+++....--+++.|-
T Consensus       152 ~aEt~~e~I~~~l-~~~~p~lvVIDSIQT~~s~~~~SapGsVsQVRe~t~~L~~~AK~~~i~~fiVGH  218 (456)
T COG1066         152 LAETNLEDIIAEL-EQEKPDLVVIDSIQTLYSEEITSAPGSVSQVREVAAELMRLAKTKNIAIFIVGH  218 (456)
T ss_pred             EHHCCHHHHHHHH-HHCCCCEEEEECCCEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             4112899999999-854997899965412302633579985899999999999999875973999988


No 355
>PRK09270 frcK putative fructose transport system kinase; Reviewed
Probab=88.52  E-value=0.95  Score=22.77  Aligned_cols=39  Identities=21%  Similarity=0.279  Sum_probs=25.9

Q ss_pred             CCCE--EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             7980--99958899868999999999997599949999160
Q gi|255764515|r   17 HKRC--AIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL   55 (458)
Q Consensus        17 ~~~~--ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~   55 (458)
                      +++.  .|+..+|+|||-.|=.++..+...+.....+++|-
T Consensus        32 ~rR~lIgIaG~pGSGKSTlA~~l~~~L~~~~~~~~~~~vpm   72 (230)
T PRK09270         32 QRRTVVGIAGPPGAGKSTLAETLWEALSQQGPELPAIQVPM   72 (230)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEECC
T ss_conf             97189999899988999999999999862379985799736


No 356
>TIGR00368 TIGR00368 Mg chelatase homolog; InterPro: IPR004482   This family of bacterial proteins are variously described as 'hypothetical protein yifB', 'competence protein', 'hypothetical protein' or 'Mg chelatase-related protein'. These proteins are a subset of the magnesium chelatase, ChlI subunit family and either belong to or show significant homology to the non-peptidase homologs of the MEROPS peptidase family S16 (lon protease family, clan SF), IPR001984 from INTERPRO. .
Probab=88.47  E-value=0.27  Score=26.11  Aligned_cols=16  Identities=31%  Similarity=0.395  Sum_probs=10.3

Q ss_pred             CEEEEECCCCCHHHHH
Q ss_conf             8099958899868999
Q gi|255764515|r   19 RCAIWASMGSGKTVSV   34 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~a   34 (458)
                      |.++..+||+|||+.|
T Consensus       215 Nlll~GPPGsGKTmla  230 (505)
T TIGR00368       215 NLLLLGPPGSGKTMLA  230 (505)
T ss_pred             CEEEECCCCCCHHHHH
T ss_conf             4376782496268999


No 357
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=88.42  E-value=1.6  Score=21.48  Aligned_cols=46  Identities=24%  Similarity=0.312  Sum_probs=28.0

Q ss_pred             CHHHHHHHHHHH-HCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             478999999999-679809995889986899999999999759994999
Q gi|255764515|r    4 APHQTKIVDWIL-DHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLV   51 (458)
Q Consensus         4 ~p~Q~~~v~~~~-~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LI   51 (458)
                      -|-|.+.+..+. .+.+.+++.+||+|||=.+-+++.++  ....++++
T Consensus        11 ~~~~~~~L~~~v~~~~nIlIsG~tGSGKTTll~al~~~i--~~~~rivt   57 (186)
T cd01130          11 SPLQAAYLWLAVEARKNILISGGTGSGKTTLLNALLAFI--PPDERIIT   57 (186)
T ss_pred             CHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHC--CCCCCEEE
T ss_conf             999999999999859989998999998999999999613--34564598


No 358
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR005751    The DNA helicase PcrA is found mainly in Gram-positive bacteria and belongs to a superfamily of helicases, together with Rep and UvrD helicases from Escherichia coli. The action of the 3'5' bacterial DNA helicase is based upon two separate but coupled activities, ssDNA translocation and duplex destabilisation, and is driven by energy derived from the continuous ATP-binding and hydrolysis events that take place in the active-site cleft. The resulting conformational changes that accompany these events underpin the coupling process and allow the helicase to translocate along the DNA, destabilising the duplex and separating the two strands in an active process .; GO: 0004003 ATP-dependent DNA helicase activity, 0006268 DNA unwinding during replication, 0005737 cytoplasm.
Probab=88.26  E-value=1.2  Score=22.17  Aligned_cols=118  Identities=19%  Similarity=0.254  Sum_probs=59.4

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCC---CCCEEEEECCH------------HHHHHHHH-H
Q ss_conf             87478999999999679809995889986899999999999759---99499991604------------65699999-9
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG---EKSVLVIAPLR------------VAQSVWTS-E   65 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~---~~~~LIv~P~~------------l~~~~W~~-E   65 (458)
                      .|.+-|.+||....  +=.||.+.=|+|||-.--.=|++|....   .+++|=|+=++            ++...|.. |
T Consensus         4 ~LN~~Q~~AV~tt~--GPLLi~AGAGSGKTRVLThRIA~L~~e~~v~P~nILAiTFTNKAArEMkERv~~L~g~awaqqe   81 (811)
T TIGR01073         4 GLNPEQREAVKTTE--GPLLIMAGAGSGKTRVLTHRIAHLLAEKNVAPWNILAITFTNKAAREMKERVEKLLGPAWAQQE   81 (811)
T ss_pred             CCCHHHHHHHHHCC--CCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             02489999973037--8410101378873105789999999722369850465532205316789999998524665457


Q ss_pred             H-HHHCCCCCCEEEEEECCHHHHHHHH-CCCCCEEEECCCCHH-----HHHH----HCCCCCCCCEEECCCCC
Q ss_conf             9-9855888815999858978988873-077986998064202-----3344----20001132204404531
Q gi|255764515|r   66 V-QRWSNFSHMNISVITGTVKQRTKVL-KTPAVLYVINFENLG-----WLVQ----ELKGTWPFATIVVDEST  127 (458)
Q Consensus        66 i-~kf~~~~~~~~~~~~g~~~~r~~~~-~~~~~i~i~s~e~~~-----~~~~----~~~~~~~~~~iIiDEaH  127 (458)
                      | .+|.-...      ..........+ ....++.|.|++++-     .+.+    .+...+.-..=|+|++-
T Consensus        82 fsqrwellGk------yeqkqllsrvyk~~a~~~WisTFHS~cvRILRrdid~~qd~~Grr~~~~FsI~D~~D  148 (811)
T TIGR01073        82 FSQRWELLGK------YEQKQLLSRVYKDVAEDIWISTFHSMCVRILRRDIDKLQDRIGRRINRNFSIIDTSD  148 (811)
T ss_pred             HHHHHHHHHH------HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHH
T ss_conf             7678887434------667899999886521423230389999998888888898762114541576111788


No 359
>pfam01637 Arch_ATPase Archaeal ATPase. This family contain a conserved P-loop motif that is involved in binding ATP. This family is almost exclusively found in archaebacteria and particularly in Methanococcus jannaschii that encodes sixteen members of this family.
Probab=88.24  E-value=1.6  Score=21.41  Aligned_cols=49  Identities=14%  Similarity=0.101  Sum_probs=26.2

Q ss_pred             HHHHHHHHHCC-C--EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCH
Q ss_conf             99999999679-8--0999588998689999999999975999499991604
Q gi|255764515|r    8 TKIVDWILDHK-R--CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLR   56 (458)
Q Consensus         8 ~~~v~~~~~~~-~--~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~   56 (458)
                      .+.+...+.++ +  .++...=|.|||-.+..++..+...+...+.+.+...
T Consensus         8 L~~L~~~~~~~~~~~ivi~G~RR~GKTsLi~~~~~~~~~~~~~~i~~~~~~~   59 (223)
T pfam01637         8 LKELEEWAERGTYPIIVVYGPRRCGKTALLREFLEELRELGYRVIYYDPLRR   59 (223)
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEECHHH
T ss_conf             9999999966997189998688787999999999863346852899951444


No 360
>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251   This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO). LonB proteins are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ) and are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore during sporulation, under control of sigmaF . The lonB gene, despite being located immediately upstream of lonA, was shown to be monocistronic. LonB appears to be involved in the post-translation control of sigmaH, but lonB mutation did not produce an obvious sporulation defect under the conditions tested . Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and these are excluded from this entry. .
Probab=88.13  E-value=1.1  Score=22.38  Aligned_cols=28  Identities=21%  Similarity=0.275  Sum_probs=20.9

Q ss_pred             HHHHHHHHH---H--CC-CEEEEECCCCCHHHHH
Q ss_conf             999999999---6--79-8099958899868999
Q gi|255764515|r    7 QTKIVDWIL---D--HK-RCAIWASMGSGKTVSV   34 (458)
Q Consensus         7 Q~~~v~~~~---~--~~-~~ll~~~~G~GKT~~a   34 (458)
                      |.+++..|.   .  |+ ..++..++|.|||--|
T Consensus        70 Qe~GI~ALKAALCGPNPQHVIiYGPPGVGKTAAA  103 (532)
T TIGR02902        70 QEEGIKALKAALCGPNPQHVIIYGPPGVGKTAAA  103 (532)
T ss_pred             CHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHH
T ss_conf             3556899998606868963898788696178999


No 361
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]
Probab=88.08  E-value=0.71  Score=23.52  Aligned_cols=34  Identities=29%  Similarity=0.373  Sum_probs=24.7

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEE--ECCHHHH
Q ss_conf             899868999999999997599949999--1604656
Q gi|255764515|r   26 MGSGKTVSVLTALSYIHLWGEKSVLVI--APLRVAQ   59 (458)
Q Consensus        26 ~G~GKT~~al~~~~~l~~~~~~~~LIv--~P~~l~~   59 (458)
                      =|.|||-+|+.++..|...+.+++|+|  =|.+-..
T Consensus        12 GGvGKTT~a~nLa~~La~~~~~kVLliDlDpQ~s~t   47 (259)
T COG1192          12 GGVGKTTTAVNLAAALAKRGGKKVLLIDLDPQGSLT   47 (259)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHH
T ss_conf             885199999999999998389978999789994177


No 362
>PRK05636 replicative DNA helicase; Provisional
Probab=88.08  E-value=1.6  Score=21.34  Aligned_cols=13  Identities=23%  Similarity=0.089  Sum_probs=7.2

Q ss_pred             HHCCCCCCEEEEE
Q ss_conf             2037877528999
Q gi|255764515|r  410 RQAGFKRAVFVYY  422 (458)
Q Consensus       410 hR~Gq~~~v~v~~  422 (458)
                      ||.|++-.|.+.+
T Consensus       482 nRnG~~G~v~l~f  494 (507)
T PRK05636        482 HRGGPIDTVQVAH  494 (507)
T ss_pred             CCCCCCEEEEEEE
T ss_conf             6889851699998


No 363
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=88.04  E-value=1.6  Score=21.33  Aligned_cols=34  Identities=26%  Similarity=0.298  Sum_probs=23.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             09995889986899999999999759994999916
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAP   54 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P   54 (458)
                      .+++.++|+|||-.++.++......+ .+++++.-
T Consensus         2 ~li~g~~g~GKttl~~~~~~~~~~~~-~~~~~~~~   35 (165)
T cd01120           2 ILVFGPTGSGKTTLALQLALNIATKG-GKVVYVDI   35 (165)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEEC
T ss_conf             89998999989999999999987639-97999986


No 364
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR014155   This entry contains VirB11, a protein that is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer . VirB11 is believed to be an ATPase  and is a homologue of the P-like conjugation system TrbB protein and the Flp pilus system protein TadA ..
Probab=88.02  E-value=0.67  Score=23.70  Aligned_cols=16  Identities=44%  Similarity=0.517  Sum_probs=12.1

Q ss_pred             HCCCEEEEECCCCCHH
Q ss_conf             6798099958899868
Q gi|255764515|r   16 DHKRCAIWASMGSGKT   31 (458)
Q Consensus        16 ~~~~~ll~~~~G~GKT   31 (458)
                      .+++.+|+..+|+|||
T Consensus       157 ~~knIii~GGTgSGKT  172 (328)
T TIGR02788       157 SRKNIIISGGTGSGKT  172 (328)
T ss_pred             CCCEEEEEECCCCHHH
T ss_conf             3891999906897189


No 365
>KOG1806 consensus
Probab=87.99  E-value=1.4  Score=21.76  Aligned_cols=63  Identities=16%  Similarity=0.127  Sum_probs=41.5

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHH-HCCCCCEEEEECCHHHHHHHHH
Q ss_conf             87478999999999679809995889986899999999999-7599949999160465699999
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIH-LWGEKSVLVIAPLRVAQSVWTS   64 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~-~~~~~~~LIv~P~~l~~~~W~~   64 (458)
                      +.-|-|.+++.--...+-..++.++|+|||-+|.-++..+. ..+..++||++-.+-..|+-.+
T Consensus       738 ~ft~~qveai~sg~qpgltmvvgppgtgktd~avqil~~lyhn~p~qrTlivthsnqaln~lfe  801 (1320)
T KOG1806         738 KFTPTQVEAILSGMQPGLTMVVGPPGTGKTDVAVQILSVLYHNSPNQRTLIVTHSNQALNQLFE  801 (1320)
T ss_pred             CCCHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHH
T ss_conf             0688999998834787754630699999743024454456516987624899852312567877


No 366
>PRK08694 consensus
Probab=87.94  E-value=1.7  Score=21.29  Aligned_cols=42  Identities=10%  Similarity=0.309  Sum_probs=22.0

Q ss_pred             CCCCCEEEEECC--CCCHHHHHHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             017859999089--98986864456666202202037877528999
Q gi|255764515|r  379 QYGGNILVFFSL--WWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       379 ~~a~~~iI~~~~--~wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                      |.| ++|+|+.-  .+++....+-+..+.- --||.|.+-.|...+
T Consensus       404 qDA-D~v~~l~R~~~y~~~~~~~~~~e~iv-aK~R~G~~G~v~l~f  447 (468)
T PRK08694        404 QDA-DLIMFMYRDEYYNQDSPMKGLAECII-GKHRNGPVGKIFLTW  447 (468)
T ss_pred             HHC-CEEEEECCHHHCCCCCCCCCEEEEEE-ECCCCCCCCEEEEEE
T ss_conf             337-68999634310388988788079999-705789861599998


No 367
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=87.92  E-value=1.1  Score=22.47  Aligned_cols=46  Identities=28%  Similarity=0.254  Sum_probs=30.7

Q ss_pred             HHHHHHHHCC-----CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             9999999679-----8099958899868999999999997599949999160
Q gi|255764515|r    9 KIVDWILDHK-----RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL   55 (458)
Q Consensus         9 ~~v~~~~~~~-----~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~   55 (458)
                      ..++.++..+     =.+++.++|+|||-.++-++......| .++|.|+--
T Consensus        10 ~~lD~~LgGGi~~G~itei~G~pG~GKTtl~lq~a~~~~~~g-~~vlYidtE   60 (224)
T PRK09361         10 KSLDELLGGGIERGTITQIYGPPGSGKTNICIQLAVEAARQG-KKVIYIDTE   60 (224)
T ss_pred             HHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC-CCEEEECCC
T ss_conf             899986269988887999989999859999999999999749-909996787


No 368
>TIGR03453 partition_RepA plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error.
Probab=87.87  E-value=0.69  Score=23.63  Aligned_cols=12  Identities=17%  Similarity=0.221  Sum_probs=4.6

Q ss_pred             HHHCCCEEEEEC
Q ss_conf             430598079965
Q gi|255764515|r  147 PAWESERFIELT  158 (458)
Q Consensus       147 ~~~~~~~~l~LT  158 (458)
                      ++.+..++++.=
T Consensus       129 LA~~G~RVLvID  140 (387)
T TIGR03453       129 LALRGYRVLAID  140 (387)
T ss_pred             HHHCCCCEEEEE
T ss_conf             997799889995


No 369
>PRK13869 plasmid-partitioning protein RepA; Provisional
Probab=87.59  E-value=0.75  Score=23.41  Aligned_cols=16  Identities=19%  Similarity=0.196  Sum_probs=6.9

Q ss_pred             HHHHCCCEEEEECCCC
Q ss_conf             5430598079965840
Q gi|255764515|r  146 KPAWESERFIELTGTP  161 (458)
Q Consensus       146 ~~~~~~~~~l~LTgTP  161 (458)
                      .++.+..++++.=--|
T Consensus       145 ~LA~~G~RVLlIDLDP  160 (405)
T PRK13869        145 YLALQGYRVLAVDLDP  160 (405)
T ss_pred             HHHHCCCCEEEEECCH
T ss_conf             9997799889996456


No 370
>KOG0734 consensus
Probab=87.51  E-value=0.7  Score=23.57  Aligned_cols=44  Identities=30%  Similarity=0.262  Sum_probs=22.7

Q ss_pred             HCCCCCCEEEEEEEEC--------CC---HHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             0378775289999858--------99---68999999999999999998554137
Q gi|255764515|r  411 QAGFKRAVFVYYLIAQ--------NT---IDELVLQRLRTKSTIQDLLLNALKKE  454 (458)
Q Consensus       411 R~Gq~~~v~v~~li~~--------~t---ide~i~~~~~~K~~~~~~~~~~~~~~  454 (458)
                      ..|..+.|-...+.+.        .|   ||..|-+++++--+.+..+|...+||
T Consensus       655 ~fGMSd~vG~v~~~~~~~~~s~~~~t~~lidaEi~~lL~~sYeRak~iL~~h~kE  709 (752)
T KOG0734         655 KFGMSDKVGPVTLSAEDNSSSLSPRTQELIDAEIKRLLRDSYERAKSILKTHKKE  709 (752)
T ss_pred             HCCCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7086554364342235788887800588899999999999999999999987899


No 371
>PTZ00293 thymidine kinase; Provisional
Probab=87.50  E-value=1.8  Score=21.13  Aligned_cols=105  Identities=16%  Similarity=0.157  Sum_probs=51.6

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEEE
Q ss_conf             99958899868999999999997599949999160465699999999855888815999858978988873077986998
Q gi|255764515|r   21 AIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVI  100 (458)
Q Consensus        21 ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i~  100 (458)
                      ++..+|=+|||=..|--+..... ..++++||-|..--.  +.          .-.+..+.+..      +.     .+.
T Consensus         8 VI~GPMFSGKTTELIRRlrR~~i-a~kkvlVIK~a~DtR--Y~----------~~~V~THD~~~------i~-----a~~   63 (284)
T PTZ00293          8 LIIGPMFAGKTTELMRRVKREIH-ARRSCFVIKYSKDTR--YD----------EHNVASHDQLM------LR-----AQA   63 (284)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHH-CCCEEEEECCCCCCC--CC----------CCCEECCCCCE------EE-----CCH
T ss_conf             99807237805999999999997-797399981898887--89----------98556789973------51-----200


Q ss_pred             CCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE--EECCC
Q ss_conf             0642023344200011322044045310024654311567777665430598079--96584
Q gi|255764515|r  101 NFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFI--ELTGT  160 (458)
Q Consensus       101 s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l--~LTgT  160 (458)
                      ....+....   .....+|.|-|||+|.+.+        ....+..+....+.++  +|-|+
T Consensus        64 ~v~~L~ei~---~~~~~~DVIgIDEaQFF~D--------Lvdf~e~lAn~GK~VIVAGLDGD  114 (284)
T PTZ00293         64 AVSQLTEVR---DTWKRFDVLAIDEGQFFSD--------LVDFCNTAADAGKVVMVSALDGD  114 (284)
T ss_pred             HHHHHHHHH---HHHHCCCEEEEECHHCCCC--------HHHHHHHHHHCCCEEEEEECCCC
T ss_conf             140699998---7753588899970341623--------89999999868998999945876


No 372
>KOG0736 consensus
Probab=87.44  E-value=0.47  Score=24.65  Aligned_cols=10  Identities=30%  Similarity=0.544  Sum_probs=4.6

Q ss_pred             EEEECCCCHH
Q ss_conf             7996584023
Q gi|255764515|r  154 FIELTGTPSP  163 (458)
Q Consensus       154 ~l~LTgTPi~  163 (458)
                      .++|+|+|..
T Consensus       433 ~vLLhG~~g~  442 (953)
T KOG0736         433 SVLLHGPPGS  442 (953)
T ss_pred             EEEEECCCCC
T ss_conf             7998679998


No 373
>TIGR02785 addA_Gpos recombination helicase AddA; InterPro: IPR014152   AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologues between the Firmicutes and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species..
Probab=87.41  E-value=0.8  Score=23.23  Aligned_cols=51  Identities=25%  Similarity=0.217  Sum_probs=31.3

Q ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCC-----CCEEEEECCHH
Q ss_conf             789999999996798099958899868999999999997599-----94999916046
Q gi|255764515|r    5 PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-----KSVLVIAPLRV   57 (458)
Q Consensus         5 p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~-----~~~LIv~P~~l   57 (458)
                      +-|.+||.--  ..+.|+++.=|+|||...+-=+-.....|+     .+.|||+=++.
T Consensus         4 ~~Q~~AI~~~--G~nILVsAsAGSGKTaVLVERii~~i~~gE~pvdiDrLLVVTFTna   59 (1295)
T TIGR02785         4 DEQWQAIYDR--GQNILVSASAGSGKTAVLVERIIKKILRGENPVDIDRLLVVTFTNA   59 (1295)
T ss_pred             HHHHHHHHHC--CCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHH
T ss_conf             8889999636--8864765322666147899999999647887702021036788899


No 374
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional
Probab=87.34  E-value=1.8  Score=21.08  Aligned_cols=11  Identities=9%  Similarity=0.322  Sum_probs=4.8

Q ss_pred             CCCEEEEEECC
Q ss_conf             88159998589
Q gi|255764515|r   73 SHMNISVITGT   83 (458)
Q Consensus        73 ~~~~~~~~~g~   83 (458)
                      |...+.+++|.
T Consensus        74 ~~~pvIviT~~   84 (469)
T PRK10923         74 PMLPVIIMTAH   84 (469)
T ss_pred             CCCCEEEEECC
T ss_conf             89978999899


No 375
>PRK13705 plasmid-partitioning protein SopA; Provisional
Probab=87.24  E-value=0.85  Score=23.08  Aligned_cols=15  Identities=13%  Similarity=0.087  Sum_probs=6.3

Q ss_pred             HHHHHHCCCEEEEEC
Q ss_conf             665430598079965
Q gi|255764515|r  144 LAKPAWESERFIELT  158 (458)
Q Consensus       144 l~~~~~~~~~~l~LT  158 (458)
                      ...++.+..++++.=
T Consensus       128 A~~LAl~G~RVLlID  142 (388)
T PRK13705        128 AQDLALKGLRVLLVE  142 (388)
T ss_pred             HHHHHHCCCEEEEEE
T ss_conf             999997799089995


No 376
>PRK13894 conjugal transfer ATPase TrbB; Provisional
Probab=87.13  E-value=1.9  Score=21.00  Aligned_cols=17  Identities=6%  Similarity=-0.148  Sum_probs=7.4

Q ss_pred             HHHHCCCCCCEEEEEEC
Q ss_conf             99855888815999858
Q gi|255764515|r   66 VQRWSNFSHMNISVITG   82 (458)
Q Consensus        66 i~kf~~~~~~~~~~~~g   82 (458)
                      +..+...|.+.=..+.+
T Consensus        27 l~~~L~Dp~VtEI~iN~   43 (320)
T PRK13894         27 LLAALNDPKTVEIMLNA   43 (320)
T ss_pred             HHHHHCCCCCEEEEECC
T ss_conf             99971799967999869


No 377
>TIGR00347 bioD dethiobiotin synthase; InterPro: IPR004472 The enzyme is involved in biotin biosynthesis and catalyses the reaction (CO2 + 7,8-diaminononanoate + ATP = dethiobiotin + phosphate + ADP). The enzyme binds ATP and requires magnesium as a co-factor. The Thr residue at position seven of the seed alignment is necessary for the binding of ATP.; GO: 0004141 dethiobiotin synthase activity, 0005524 ATP binding, 0009102 biotin biosynthetic process.
Probab=87.01  E-value=0.53  Score=24.31  Aligned_cols=25  Identities=24%  Similarity=0.157  Sum_probs=21.2

Q ss_pred             EECCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             9588998689999999999975999
Q gi|255764515|r   23 WASMGSGKTVSVLTALSYIHLWGEK   47 (458)
Q Consensus        23 ~~~~G~GKT~~al~~~~~l~~~~~~   47 (458)
                      +-|+|.|||+.+-+++..++..|..
T Consensus         4 GtDT~VGKT~~ss~La~~lk~~G~~   28 (187)
T TIGR00347         4 GTDTGVGKTVVSSALAKKLKKAGYS   28 (187)
T ss_pred             EEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             2245861789989999999975985


No 378
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model.
Probab=86.87  E-value=1.9  Score=20.91  Aligned_cols=12  Identities=8%  Similarity=0.044  Sum_probs=6.9

Q ss_pred             CCCCCEEEEECCC
Q ss_conf             0178599990899
Q gi|255764515|r  379 QYGGNILVFFSLW  391 (458)
Q Consensus       379 ~~a~~~iI~~~~~  391 (458)
                      |.| ++|+|+..+
T Consensus       378 qdA-DvV~fl~R~  389 (421)
T TIGR03600       378 QDA-DVIGLIHRE  389 (421)
T ss_pred             CCC-CEEEEECCC
T ss_conf             047-489996133


No 379
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=86.77  E-value=1  Score=22.55  Aligned_cols=31  Identities=23%  Similarity=0.407  Sum_probs=20.0

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             0999588998689999999999975999499
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVL   50 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~L   50 (458)
                      .+++.++|+|||-++-+++.++.......++
T Consensus         4 iLitG~TGSGKTTtl~all~~i~~~~~~~Ii   34 (198)
T cd01131           4 VLVTGPTGSGKSTTLAAMIDYINKNKTHHIL   34 (198)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCEEE
T ss_conf             9998999997999999999853637883699


No 380
>KOG2543 consensus
Probab=86.72  E-value=1.7  Score=21.25  Aligned_cols=145  Identities=14%  Similarity=0.142  Sum_probs=67.4

Q ss_pred             CHHHHHHHHHHHHCCCE------EEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             47899999999967980------999588998689999999999975999499991604656999999998558888159
Q gi|255764515|r    4 APHQTKIVDWILDHKRC------AIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI   77 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~~------ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~   77 (458)
                      +..|..-..-++.+.-+      .|....|+|||...-.++..+    +.+...+++-...  .|..-+++-.....  .
T Consensus        11 Re~qi~~L~~Llg~~~~~~PS~~~iyG~sgTGKT~~~r~~l~~~----n~~~vw~n~~ecf--t~~~lle~IL~~~~--~   82 (438)
T KOG2543          11 RESQIRRLKSLLGNNSCTIPSIVHIYGHSGTGKTYLVRQLLRKL----NLENVWLNCVECF--TYAILLEKILNKSQ--L   82 (438)
T ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHC----CCCCEEEEHHHHC--CHHHHHHHHHHHHC--C
T ss_conf             68999999998478986665157996147874559999998603----7863054157751--67999999998735--6


Q ss_pred             EEEECCHHHH-HHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             9985897898-887307798699806420233442000113220440453100246543115677776654305980799
Q gi|255764515|r   78 SVITGTVKQR-TKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIE  156 (458)
Q Consensus        78 ~~~~g~~~~r-~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~  156 (458)
                      .-..|...+- ...+.. .......++...+.       ..--.+|+|-+..++...+.--...++ +-.+.....-++.
T Consensus        83 ~d~dg~~~~~~~en~~d-~i~~l~q~~~~t~~-------d~~~~liLDnad~lrD~~a~ll~~l~~-L~el~~~~~i~ii  153 (438)
T KOG2543          83 ADKDGDKVEGDAENFSD-FIYLLVQWPAATNR-------DQKVFLILDNADALRDMDAILLQCLFR-LYELLNEPTIVII  153 (438)
T ss_pred             CCCCHHHHHHHHHHHHH-HHHHHHHHHHHHCC-------CCEEEEEECCHHHHHCCCHHHHHHHHH-HHHHHCCCCEEEE
T ss_conf             78740555427999999-99999844776446-------744999974777663065078899998-9987377736999


Q ss_pred             ECCCCHHHH
Q ss_conf             658402310
Q gi|255764515|r  157 LTGTPSPNG  165 (458)
Q Consensus       157 LTgTPi~n~  165 (458)
                      +++++.++.
T Consensus       154 ls~~~~e~~  162 (438)
T KOG2543         154 LSAPSCEKQ  162 (438)
T ss_pred             EECCCCHHH
T ss_conf             832666777


No 381
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=86.70  E-value=0.6  Score=24.00  Aligned_cols=24  Identities=25%  Similarity=0.293  Sum_probs=19.0

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             980999588998689999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l   41 (458)
                      .+.|+..++|+|||+.|=.++..|
T Consensus        98 SNILLiGPTGsGKTlLAqTLAk~L  121 (408)
T COG1219          98 SNILLIGPTGSGKTLLAQTLAKIL  121 (408)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             317998889975779999999984


No 382
>cd01127 TrwB Bacterial conjugation protein TrwB,  ATP binding domain. TrwB is a homohexamer encoded by conjugative plasmids in Gram-negative bacteria. TrwB also has an all alpha domain which has been hypothesized to be responsible for DNA binding. TrwB is a component of Type IV secretion and is responsible for the horizontal transfer of DNA between bacteria.
Probab=86.66  E-value=1.9  Score=21.00  Aligned_cols=40  Identities=23%  Similarity=0.338  Sum_probs=27.5

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             79809995889986899999999999759994999916046
Q gi|255764515|r   17 HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRV   57 (458)
Q Consensus        17 ~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l   57 (458)
                      .++.++...+|+|||.....++......| .+++|.=|+.-
T Consensus        42 ~~H~lv~G~tGsGKT~~i~~li~~~~~rg-~~~II~DpkGe   81 (410)
T cd01127          42 EAHTMIIGTTGTGKTTQIRELLASIRARG-DRAIIYDPNGG   81 (410)
T ss_pred             HCCEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEECCCH
T ss_conf             27479988999988999999999999869-90999958854


No 383
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]
Probab=86.63  E-value=0.96  Score=22.74  Aligned_cols=45  Identities=24%  Similarity=0.335  Sum_probs=27.9

Q ss_pred             EEEEEC-CCCCHHHHHHHHHHHHHHCCCCCEEEEE--CCHHHHHHHHHH
Q ss_conf             099958-8998689999999999975999499991--604656999999
Q gi|255764515|r   20 CAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIA--PLRVAQSVWTSE   65 (458)
Q Consensus        20 ~ll~~~-~G~GKT~~al~~~~~l~~~~~~~~LIv~--P~~l~~~~W~~E   65 (458)
                      .+++.. =|.|||=+|.+.+..+-..| +++|+|.  |+.-+.+.+..|
T Consensus         4 iv~f~GKGGVGKTT~aaA~A~~lA~~g-~kvLlvStDPAhsL~d~f~~e   51 (322)
T COG0003           4 IVFFTGKGGVGKTTIAAATAVKLAESG-KKVLLVSTDPAHSLGDVFDLE   51 (322)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCC-CCEEEEEECCCCCHHHHHCCC
T ss_conf             999936885458999999999999759-907999848987447654230


No 384
>KOG1942 consensus
Probab=86.52  E-value=0.66  Score=23.74  Aligned_cols=45  Identities=24%  Similarity=0.406  Sum_probs=27.4

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             980999588998689999999999975999499991604656999999998
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQR   68 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~~W~~Ei~k   68 (458)
                      +..|+|.++|+|||..|+++...|   |.+-  =.||-.-- ..+-.|++|
T Consensus        65 ravLlaGppgtGKTAlAlaisqEL---G~kv--PFcpmvgS-EvyS~EvKK  109 (456)
T KOG1942          65 RAVLLAGPPGTGKTALALAISQEL---GPKV--PFCPMVGS-EVYSNEVKK  109 (456)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH---CCCC--CCCCCCCH-HHHHHHHHH
T ss_conf             279973699876568999999974---7999--85666410-555434557


No 385
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=86.48  E-value=2  Score=20.79  Aligned_cols=15  Identities=13%  Similarity=0.443  Sum_probs=6.7

Q ss_pred             CCCEEECCCCCCCCC
Q ss_conf             322044045310024
Q gi|255764515|r  117 PFATIVVDESTKLKS  131 (458)
Q Consensus       117 ~~~~iIiDEaH~lkn  131 (458)
                      .+|.|++|=|-|+.|
T Consensus       221 ~~DvvliDTAGRLhn  235 (340)
T COG0552         221 GIDVVLIDTAGRLHN  235 (340)
T ss_pred             CCCEEEEECCCCCCC
T ss_conf             999999967554457


No 386
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=86.47  E-value=2  Score=20.78  Aligned_cols=12  Identities=0%  Similarity=0.285  Sum_probs=5.6

Q ss_pred             CEEECCCCCCCC
Q ss_conf             204404531002
Q gi|255764515|r  119 ATIVVDESTKLK  130 (458)
Q Consensus       119 ~~iIiDEaH~lk  130 (458)
                      |++++|..|.+.
T Consensus       204 DvLLIDDIQfl~  215 (455)
T PRK12422        204 DALFIEDIEVFS  215 (455)
T ss_pred             CEEEEEHHHHHH
T ss_conf             877631478872


No 387
>PHA02519 plasmid partition protein SopA; Reviewed
Probab=86.32  E-value=1  Score=22.53  Aligned_cols=14  Identities=14%  Similarity=0.138  Sum_probs=6.0

Q ss_pred             HHHHHCCCEEEEEC
Q ss_conf             65430598079965
Q gi|255764515|r  145 AKPAWESERFIELT  158 (458)
Q Consensus       145 ~~~~~~~~~~l~LT  158 (458)
                      ..++.+..++++.=
T Consensus       129 ~~LAl~G~RVL~ID  142 (387)
T PHA02519        129 QWLALQGHRVLLIE  142 (387)
T ss_pred             HHHHHCCCCEEEEE
T ss_conf             99997699689995


No 388
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.
Probab=86.25  E-value=1  Score=22.65  Aligned_cols=28  Identities=29%  Similarity=0.323  Sum_probs=21.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             88998689999999999975999499991
Q gi|255764515|r   25 SMGSGKTVSVLTALSYIHLWGEKSVLVIA   53 (458)
Q Consensus        25 ~~G~GKT~~al~~~~~l~~~~~~~~LIv~   53 (458)
                      -=|.|||-+|.+.+..+...| +++|+|-
T Consensus         7 KGGVGKTTvAaalA~~lA~~G-~rvLlvs   34 (217)
T cd02035           7 KGGVGKTTIAAATAVRLAEEG-KKVLLVS   34 (217)
T ss_pred             CCCCCHHHHHHHHHHHHHHCC-CEEEEEE
T ss_conf             996619999999999999689-9499995


No 389
>TIGR01075 uvrD DNA helicase II; InterPro: IPR005753    The SOS response is required for efficient nucleotide excision repair (NER) of the major ultraviolet light (UV) induced DNA lesions. The expression of three NER genes, uvrA, uvrB, and uvrD, is upregulated as part of the SOS response. UvrD differs from the others in that it is not involved in lesion recognition but rather in promoting the post-incision steps of NER, including turnover of the UvrBC incision complex . The form of the UvrD helicase with optimal helicase activity is oligomeric with at least two sites for binding the DNA substrate, where one site contacts regions of the 3'-ssDNA tail that are distal from the single-stranded/double-stranded DNA junction.; GO: 0004003 ATP-dependent DNA helicase activity, 0006268 DNA unwinding during replication, 0005737 cytoplasm.
Probab=86.12  E-value=0.4  Score=25.03  Aligned_cols=32  Identities=28%  Similarity=0.234  Sum_probs=25.5

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHH
Q ss_conf             8747899999999967980999588998689999
Q gi|255764515|r    2 NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVL   35 (458)
Q Consensus         2 ~L~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al   35 (458)
                      .|.|-|.+||.+-.+  +.|+...-|+|||-.-.
T Consensus         4 ~LN~~QreaVaap~~--~~LvLAGAGSGKTRVL~   35 (741)
T TIGR01075         4 GLNDKQREAVAAPPG--NLLVLAGAGSGKTRVLT   35 (741)
T ss_pred             CCCHHHHHHHCCCCC--CCEEEEECCCCCCHHHH
T ss_conf             566577887403422--55487306888502478


No 390
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ. Members of this family are the YhjQ protein, found immediately upsteam of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae. In several species it is seen clearly as part of the bcs operon. It is identified as a probable component of the bacterial cellulose metabolic process not only by gene location, but also by partial phylogenetic profiling, or Haft-Selengut algorithm (PMID:16930487), based on a bacterial cellulose biosynthesis genome property profile. Cellulose plays an important role in biofilm formation and structural integrity in some bacteria. Mutants in yhjQ in Escherichia coli, show altered morphology an growth, but the function of YhjQ has not yet been determined.
Probab=86.02  E-value=1.1  Score=22.40  Aligned_cols=32  Identities=31%  Similarity=0.437  Sum_probs=23.3

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEE--ECCHHH
Q ss_conf             899868999999999997599949999--160465
Q gi|255764515|r   26 MGSGKTVSVLTALSYIHLWGEKSVLVI--APLRVA   58 (458)
Q Consensus        26 ~G~GKT~~al~~~~~l~~~~~~~~LIv--~P~~l~   58 (458)
                      =|.|||-+|+.++..+...| +++|+|  -|.+.+
T Consensus        11 GGVGKTT~avNLA~~La~~G-~rVLlIDlDpQ~~l   44 (246)
T TIGR03371        11 GGVGRTTLTAALASALKLLG-EPVLAIDLDPQNLL   44 (246)
T ss_pred             CCCCHHHHHHHHHHHHHHCC-CCEEEEECCCCCCH
T ss_conf             98549999999999999689-97899975999850


No 391
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780    The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , . SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor . In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane.    This entry represents various SRP subunits.; GO: 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle.
Probab=85.88  E-value=0.97  Score=22.73  Aligned_cols=42  Identities=26%  Similarity=0.294  Sum_probs=26.7

Q ss_pred             CCCCHHHHHHHHHHH-HHHCCCCCEEEEE-----CCHHHHHHHHHHHHHHC
Q ss_conf             899868999999999-9975999499991-----60465699999999855
Q gi|255764515|r   26 MGSGKTVSVLTALSY-IHLWGEKSVLVIA-----PLRVAQSVWTSEVQRWS   70 (458)
Q Consensus        26 ~G~GKT~~al~~~~~-l~~~~~~~~LIv~-----P~~l~~~~W~~Ei~kf~   70 (458)
                      -|+|||=++--++.+ +.....+++|.|+     |++.  +| -.-+-.-.
T Consensus       111 QGsGKTTt~gKLA~~ll~kk~~~kvLLva~D~yRPAA~--~Q-L~~Lg~Q~  158 (439)
T TIGR00959       111 QGSGKTTTAGKLALYLLKKKEGKKVLLVACDLYRPAAI--EQ-LKVLGEQV  158 (439)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCEEEEEHHCCCHHHH--HH-HHHHHHHC
T ss_conf             78857889999999999986389703403210347899--99-99976752


No 392
>KOG0733 consensus
Probab=85.75  E-value=1.7  Score=21.25  Aligned_cols=24  Identities=21%  Similarity=0.191  Sum_probs=17.8

Q ss_pred             CCEEEEE-CCCCCHHHHHHHHHHHH
Q ss_conf             9809995-88998689999999999
Q gi|255764515|r   18 KRCAIWA-SMGSGKTVSVLTALSYI   41 (458)
Q Consensus        18 ~~~ll~~-~~G~GKT~~al~~~~~l   41 (458)
                      ++|+|.| ++|.|||..|=+++.++
T Consensus       223 prGvLlHGPPGCGKT~lA~AiAgel  247 (802)
T KOG0733         223 PRGVLLHGPPGCGKTSLANAIAGEL  247 (802)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHC
T ss_conf             9751644899864789999975212


No 393
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=85.51  E-value=0.9  Score=22.91  Aligned_cols=25  Identities=24%  Similarity=0.286  Sum_probs=19.2

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             7980999588998689999999999
Q gi|255764515|r   17 HKRCAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        17 ~~~~ll~~~~G~GKT~~al~~~~~l   41 (458)
                      ..+.|+..++|+|||+.|=.++..+
T Consensus       109 KsNILliGPTG~GKTlla~tLAk~l  133 (411)
T PRK05342        109 KSNILLIGPTGSGKTLLAQTLARIL  133 (411)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             4538998999977889999999986


No 394
>pfam00308 Bac_DnaA Bacterial dnaA protein.
Probab=85.45  E-value=2.3  Score=20.47  Aligned_cols=101  Identities=14%  Similarity=0.117  Sum_probs=48.7

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEE
Q ss_conf             0999588998689999999999975-999499991604656999999998558888159998589789888730779869
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLW-GEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLY   98 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~-~~~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~   98 (458)
                      ..|..+.|+|||--.=+++...... ...++..+.+... .+.+...+..             +......+         
T Consensus        37 l~i~G~~G~GKTHLLqA~~~~~~~~~~~~~v~yl~~~~~-~~~~~~~l~~-------------~~~~~f~~---------   93 (219)
T pfam00308        37 LFIYGGVGLGKTHLLHAIGNYALRNFPNLRVVYLTSEEF-LNDFVDALRD-------------NKIEAFKK---------   93 (219)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEHHHH-HHHHHHHHHC-------------CCHHHHHH---------
T ss_conf             699889999888999999999998499982888439999-9988999981-------------88889999---------


Q ss_pred             EECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             98064202334420001132204404531002465431156777766543059807996584
Q gi|255764515|r   99 VINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT  160 (458)
Q Consensus        99 i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgT  160 (458)
                                     .....+++++|..|.+.+....+ ...+..+-.+... ...+++|+.
T Consensus        94 ---------------~l~~~d~l~iDDi~~l~~~~~~e-e~lf~l~N~~~~~-~~~lllts~  138 (219)
T pfam00308        94 ---------------SYRNVDLLLIDDIQFLAGKEKTQ-EEFFHTFNALHEN-NKQIVLTSD  138 (219)
T ss_pred             ---------------HHHHCCHHHHCCHHHHCCCHHHH-HHHHHHHHHHHHC-CCEEEEECC
T ss_conf             ---------------97632336522367656864789-9999999999972-986999779


No 395
>pfam10412 TrwB_AAD_bind Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export.
Probab=85.43  E-value=2.1  Score=20.70  Aligned_cols=41  Identities=22%  Similarity=0.368  Sum_probs=26.5

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             679809995889986899999999999759994999916046
Q gi|255764515|r   16 DHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRV   57 (458)
Q Consensus        16 ~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l   57 (458)
                      +++..++..++|+|||.....++......+ ..++|+=|+.-
T Consensus        14 ~~~H~lviG~tGsGKT~~i~~~i~~~~~~~-~s~iv~DpKGe   54 (386)
T pfam10412        14 ETQHILIVGTTGTGKTQALRELLDQIRARG-DRAIIYDPTGT   54 (386)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCC-CCEEEEECCCH
T ss_conf             767589988999988879999999999779-91999958736


No 396
>KOG0741 consensus
Probab=85.41  E-value=0.77  Score=23.33  Aligned_cols=36  Identities=19%  Similarity=0.262  Sum_probs=22.4

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             98099958899868999999999997599949999160
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL   55 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~   55 (458)
                      ++.||..++|+|||++|=-+-.+|+.+  .|-+|=-|-
T Consensus       257 KGiLLyGPPGTGKTLiARqIGkMLNAr--ePKIVNGPe  292 (744)
T KOG0741         257 KGILLYGPPGTGKTLIARQIGKMLNAR--EPKIVNGPE  292 (744)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCCC--CCCCCCCHH
T ss_conf             357887799987018999987874579--986347578


No 397
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional
Probab=85.36  E-value=1.6  Score=21.46  Aligned_cols=29  Identities=28%  Similarity=0.310  Sum_probs=23.2

Q ss_pred             CCEEEEEC-CCCCHHHHHHHHHHHHHHCCC
Q ss_conf             98099958-899868999999999997599
Q gi|255764515|r   18 KRCAIWAS-MGSGKTVSVLTALSYIHLWGE   46 (458)
Q Consensus        18 ~~~ll~~~-~G~GKT~~al~~~~~l~~~~~   46 (458)
                      ++.+|+.+ -|+|||..+++++..|..+|.
T Consensus         2 kgilIAa~~SgsGKTtvt~gL~~aL~~rG~   31 (432)
T PRK13896          2 DGVVLAGTSSGVGKTVATLAVLQALADAGY   31 (432)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             628997789999899999999999997849


No 398
>PRK10365 transcriptional regulatory protein ZraR; Provisional
Probab=85.31  E-value=1.5  Score=21.50  Aligned_cols=17  Identities=18%  Similarity=0.302  Sum_probs=7.3

Q ss_pred             ECCCCCHHHHHHHHHHH
Q ss_conf             08998986864456666
Q gi|255764515|r  388 FSLWWDLEEHQQMIERI  404 (458)
Q Consensus       388 ~~~~wn~~~~~Q~~gRi  404 (458)
                      |+-|=|...+.+.+.|.
T Consensus       352 y~WPGNvREL~n~iera  368 (441)
T PRK10365        352 YDWPGNIRELENAVERA  368 (441)
T ss_pred             CCCCCHHHHHHHHHHHH
T ss_conf             99998999999999999


No 399
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]
Probab=85.30  E-value=2.3  Score=20.43  Aligned_cols=50  Identities=24%  Similarity=0.345  Sum_probs=28.3

Q ss_pred             HHHHHHHHHHHCCC--EEEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECC
Q ss_conf             89999999996798--09995889986899999999999759-9949999160
Q gi|255764515|r    6 HQTKIVDWILDHKR--CAIWASMGSGKTVSVLTALSYIHLWG-EKSVLVIAPL   55 (458)
Q Consensus         6 ~Q~~~v~~~~~~~~--~ll~~~~G~GKT~~al~~~~~l~~~~-~~~~LIv~P~   55 (458)
                      .|.+..+++.+.+.  ..+-.+=|=|||..+..++..+...+ ..+++|.+|.
T Consensus       218 ~~l~~~~~l~~~~~~~~vlTAdRGRGKSA~lGi~~~~~~~~~~~~~iiVTAP~  270 (758)
T COG1444         218 EALEILERLLDAPKRALVLTADRGRGKSAALGIALAAAARLAGSVRIIVTAPT  270 (758)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             99999999970898359998677874768874999999973377208996797


No 400
>pfam09455 Cas_DxTHG CRISPR-associated (Cas) DxTHG family. Cas are a group of proteins associated with clustered regularly interspaced short palindromic repeats - CRISPS - of DNA found in nearly half of bacterial and archaeal genomes. The family describes Cas proteins of about 400 residues that include the motif [VIL]-D-x-[ST]-H-[GS]. The CRISPR and associated proteins are thought to be involved in the evolution of host resistance. The exact molecular function of this family is currently unknown.
Probab=85.29  E-value=1.4  Score=21.80  Aligned_cols=134  Identities=9%  Similarity=0.060  Sum_probs=61.7

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHH------------------------HHHHHHHHHCCCCCCEEEEEECC
Q ss_conf             986899999999999759994999916046569------------------------99999998558888159998589
Q gi|255764515|r   28 SGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS------------------------VWTSEVQRWSNFSHMNISVITGT   83 (458)
Q Consensus        28 ~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~~------------------------~W~~Ei~kf~~~~~~~~~~~~g~   83 (458)
                      -++|.+++.++...  .+..+++|++|-++...                        .-..++..+......++.++.|.
T Consensus        24 ~~~s~~s~~~l~~~--~~~dk~vi~~~dSl~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~l~~~~~~V~V~P~v  101 (387)
T pfam09455        24 KVESLASASVLREA--LKPDKTVILLPDSLSTALQKLEDLVDDYKELILTKLEEKLENYEKEIKNFLNINNIDVIVLPSV  101 (387)
T ss_pred             EECCCCCHHHHHHH--CCCCEEEEEEEHHHCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             00022418999965--2887399998611054010232367888877666689999999998766523688609993661


Q ss_pred             HHHHHHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHH----HCCCEEEEECC
Q ss_conf             78988873077986998064202334420001132204404531002465431156777766543----05980799658
Q gi|255764515|r   84 VKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPA----WESERFIELTG  159 (458)
Q Consensus        84 ~~~r~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~----~~~~~~l~LTg  159 (458)
                      .......+.++..  ..-+..+..+.+.+.. ...+-|++|=.|-+ |.-+.....+.+.+..+.    .+.........
T Consensus       102 G~~~~~~f~g~~~--~~~~~~~~~l~~~l~~-~~~~ei~lD~thGi-Ny~~~~~~~a~~~~~~~~~~~~~~~v~l~~ynS  177 (387)
T pfam09455       102 GTYGNYYFDGDPD--DFFSFVYYSLLKRLEK-EGPDEIILDLTHGI-NYMPLLALEAARLALSLYAAAGRKKVSLEIYNS  177 (387)
T ss_pred             CCCCCEEEECCHH--HHHHHHHHHHHHHHHC-CCCCEEEEECCCCH-HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             0022369947899--9999999999999860-79968999756760-179999999999999999976247864999837


Q ss_pred             CCHHHHCC
Q ss_conf             40231001
Q gi|255764515|r  160 TPSPNGLI  167 (458)
Q Consensus       160 TPi~n~~~  167 (458)
                      .|+..+..
T Consensus       178 dP~~~~~~  185 (387)
T pfam09455       178 DPYGKSSK  185 (387)
T ss_pred             CCCCCCCC
T ss_conf             78889986


No 401
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252   This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria. Proteins in this entry are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ). They are restricted to a subset of endospore-forming species, and probably participate in the program of endospore formation. We propose the designation LonC..
Probab=85.22  E-value=1.4  Score=21.79  Aligned_cols=34  Identities=24%  Similarity=0.341  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHC-----C-CEEEEECCCCCHHHHHHHHHHH
Q ss_conf             99999999967-----9-8099958899868999999999
Q gi|255764515|r    7 QTKIVDWILDH-----K-RCAIWASMGSGKTVSVLTALSY   40 (458)
Q Consensus         7 Q~~~v~~~~~~-----~-~~ll~~~~G~GKT~~al~~~~~   40 (458)
                      |..|+..|+.+     + ..+|..+||.|||=.|=.+++.
T Consensus       160 QerAI~aLlaK~aSPfPQHiiLYGPPGVGKTTaARl~LEe  199 (616)
T TIGR02903       160 QERAIKALLAKLASPFPQHIILYGPPGVGKTTAARLALEE  199 (616)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHH
T ss_conf             4689999997631888660785573388478999998762


No 402
>pfam09140 MipZ ATPase MipZ. MipZ is an ATPase that forms a complex with the chromosome partitioning protein ParB near the chromosomal origin of replication. It is responsible for the temporal and spatial regulation of FtsZ ring formation.
Probab=85.14  E-value=1.3  Score=21.97  Aligned_cols=28  Identities=25%  Similarity=0.302  Sum_probs=21.9

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEE--EC
Q ss_conf             899868999999999997599949999--16
Q gi|255764515|r   26 MGSGKTVSVLTALSYIHLWGEKSVLVI--AP   54 (458)
Q Consensus        26 ~G~GKT~~al~~~~~l~~~~~~~~LIv--~P   54 (458)
                      =|+|||-+++.++..|...| +++|+|  =|
T Consensus        10 GGvGKTTtavnLA~aLA~~G-~rVllIDlDp   39 (261)
T pfam09140        10 GGSGKSTTAVHVAVALLYLG-ARVATIDLDL   39 (261)
T ss_pred             CCCCHHHHHHHHHHHHHHCC-CCEEEEECCC
T ss_conf             98729999999999999889-9789997999


No 403
>COG0714 MoxR-like ATPases [General function prediction only]
Probab=85.12  E-value=1.8  Score=21.04  Aligned_cols=29  Identities=17%  Similarity=0.127  Sum_probs=22.0

Q ss_pred             HHHHCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             99967980999588998689999999999
Q gi|255764515|r   13 WILDHKRCAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        13 ~~~~~~~~ll~~~~G~GKT~~al~~~~~l   41 (458)
                      .++.++..++-+++|+|||..+=.++..+
T Consensus        39 a~~~~~~vll~G~PG~gKT~la~~lA~~l   67 (329)
T COG0714          39 ALLAGGHVLLEGPPGVGKTLLARALARAL   67 (329)
T ss_pred             HHHCCCCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             99859977877989877799999999983


No 404
>PRK06904 replicative DNA helicase; Validated
Probab=84.70  E-value=2.3  Score=20.50  Aligned_cols=42  Identities=12%  Similarity=0.165  Sum_probs=18.4

Q ss_pred             CCCCCEEEEECCC--CCHHHH-HHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             0178599990899--898686-4456666202202037877528999
Q gi|255764515|r  379 QYGGNILVFFSLW--WDLEEH-QQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       379 ~~a~~~iI~~~~~--wn~~~~-~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                      |.| ++|+|+-.+  |+.... .+-+..+. -.-||.|.+-.|.+.+
T Consensus       408 qdA-D~V~~l~R~~~y~~~~~~~~~~~eli-vaKnR~G~~G~v~~~f  452 (472)
T PRK06904        408 QDA-DLIMFIYRDEVYNETTEDNKGVAEII-IGKQRNGPIGRVRLAF  452 (472)
T ss_pred             HHC-CEEEEECCHHCCCCCCCCCCCCEEEE-EECCCCCCCCEEEEEE
T ss_conf             428-68999644200488876778837999-9747789861699998


No 405
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA).  This ATPase is involved in transport of arsenite, antimonite or other oxyanions across biological membranes in all three kingdoms of life.  ArsA contains a highly conserved AAA motif present in the AAA+ ATPase superfamily associated with a variety of cellular activities.   To form a functional ATP-driven pump, ArsA interacts with the permease ArsB, which is a channel-forming integral membrane protein. One of the most interesting features of ArsA is the allosteric activation by its transport substrates.  A divalent cation, typically Mg2+, is required for its enzymatic activity.
Probab=84.33  E-value=1.4  Score=21.76  Aligned_cols=44  Identities=20%  Similarity=0.308  Sum_probs=28.5

Q ss_pred             EEEEEC-CCCCHHHHHHHHHHHHHHCCCCCEEEEE--CCHHHHHHHHH
Q ss_conf             099958-8998689999999999975999499991--60465699999
Q gi|255764515|r   20 CAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIA--PLRVAQSVWTS   64 (458)
Q Consensus        20 ~ll~~~-~G~GKT~~al~~~~~l~~~~~~~~LIv~--P~~l~~~~W~~   64 (458)
                      .+++.. =|.|||-+|.+.+..+-..| +++|+|.  |++-+.+.+..
T Consensus         2 ~i~~~GKGGVGKTT~AaalA~~lA~~G-~kVLlvstDPahsLsd~f~~   48 (254)
T cd00550           2 YIFFGGKGGVGKTTISAATAVRLAEQG-KKVLLVSTDPAHSLSDSFNQ   48 (254)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEECCCCCCHHHHHCC
T ss_conf             899968985548999999999999689-94999958986448898488


No 406
>PRK05748 replicative DNA helicase; Provisional
Probab=84.15  E-value=2.6  Score=20.13  Aligned_cols=42  Identities=19%  Similarity=0.184  Sum_probs=19.9

Q ss_pred             CCCCCEEEEECCC--CCHHHHHHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             0178599990899--8986864456666202202037877528999
Q gi|255764515|r  379 QYGGNILVFFSLW--WDLEEHQQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       379 ~~a~~~iI~~~~~--wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                      |.| ++|+|+..+  +++....+-+.-+. -.-||.|.+-.|...+
T Consensus       389 qdA-D~v~~l~R~~~y~~~~~~~~~~e~i-vaKnR~G~~g~v~~~f  432 (448)
T PRK05748        389 QDA-DIVAFLYRDDYYDEETENKNTIEII-IGKQRNGPVGTVRLAF  432 (448)
T ss_pred             HHC-CEEEEECCHHHCCCCCCCCCEEEEE-EECCCCCCCCEEEEEE
T ss_conf             207-6898965343238888889827999-9726899860599998


No 407
>PRK13230 nitrogenase reductase-like protein; Reviewed
Probab=84.04  E-value=1.5  Score=21.60  Aligned_cols=33  Identities=27%  Similarity=0.418  Sum_probs=24.8

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             8099958899868999999999997599949999
Q gi|255764515|r   19 RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVI   52 (458)
Q Consensus        19 ~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv   52 (458)
                      ...++.-=|.|||-|++.++..|-..| +++|+|
T Consensus         3 ~ia~yGKGGVGKTTTavNLAaALA~~G-kkVLlI   35 (292)
T PRK13230          3 QIAFYGKGGIGKSTTVCNLAAALSKSG-KKVIVV   35 (292)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEE
T ss_conf             799917998578989999999999879-959997


No 408
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892    Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by IPR003136 from INTERPRO.; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=83.66  E-value=0.73  Score=23.45  Aligned_cols=24  Identities=29%  Similarity=0.225  Sum_probs=19.1

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             999588998689999999999975
Q gi|255764515|r   21 AIWASMGSGKTVSVLTALSYIHLW   44 (458)
Q Consensus        21 ll~~~~G~GKT~~al~~~~~l~~~   44 (458)
                      .+..+||+|||=.|-.++..|.++
T Consensus         4 ~ISGpPGSGktTvA~~lA~~Lsl~   27 (173)
T TIGR02173         4 TISGPPGSGKTTVAKILAEKLSLK   27 (173)
T ss_pred             EEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             873589686478999999863983


No 409
>PRK00313 lpxK tetraacyldisaccharide 4'-kinase; Provisional
Probab=83.66  E-value=2.7  Score=19.99  Aligned_cols=21  Identities=29%  Similarity=0.251  Sum_probs=17.8

Q ss_pred             CCCCHHHHHHHHHHHHHHCCC
Q ss_conf             899868999999999997599
Q gi|255764515|r   26 MGSGKTVSVLTALSYIHLWGE   46 (458)
Q Consensus        26 ~G~GKT~~al~~~~~l~~~~~   46 (458)
                      =|+|||=.++.++..|...|.
T Consensus        62 GGTGKTP~v~~La~~L~~~G~   82 (332)
T PRK00313         62 GGTGKTPLILWLIEHCRRRGL   82 (332)
T ss_pred             CCCCHHHHHHHHHHHHHHCCC
T ss_conf             887777999999999997799


No 410
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional
Probab=83.64  E-value=2.7  Score=19.99  Aligned_cols=21  Identities=29%  Similarity=0.249  Sum_probs=11.2

Q ss_pred             EEEECCCCCHHHHHHHHHHHH
Q ss_conf             999089989868644566662
Q gi|255764515|r  385 LVFFSLWWDLEEHQQMIERIG  405 (458)
Q Consensus       385 iI~~~~~wn~~~~~Q~~gRi~  405 (458)
                      +.-|+-|=|...+...+.|..
T Consensus       353 L~~y~WPGNvREL~n~ierav  373 (457)
T PRK11361        353 LTAWSWPGNIRELSNVIERAV  373 (457)
T ss_pred             HHCCCCCCHHHHHHHHHHHHH
T ss_conf             956999979999999999999


No 411
>PRK08006 replicative DNA helicase; Provisional
Probab=83.62  E-value=2.7  Score=19.98  Aligned_cols=42  Identities=14%  Similarity=0.095  Sum_probs=22.1

Q ss_pred             CCCCCEEEEECCCC--CHHHHHHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             01785999908998--986864456666202202037877528999
Q gi|255764515|r  379 QYGGNILVFFSLWW--DLEEHQQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       379 ~~a~~~iI~~~~~w--n~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                      |.| ++|+|+..++  ++....+.+..+. ..-||.|.+-.|.+.+
T Consensus       410 qdA-D~V~~l~R~~~y~~~~~~~~~~eli-vaKnR~G~~G~v~l~f  453 (471)
T PRK08006        410 QDA-DLIMFIYRDEVYHENSDLKGIAEII-IGKQRNGPIGTVRLTF  453 (471)
T ss_pred             HHC-CEEEEECCCCCCCCCCCCCCCEEEE-EECCCCCCCEEEEEEE
T ss_conf             428-6899975503357888878816999-9736889860699998


No 412
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=83.53  E-value=2.8  Score=19.96  Aligned_cols=24  Identities=25%  Similarity=0.331  Sum_probs=17.5

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             980999588998689999999999
Q gi|255764515|r   18 KRCAIWASMGSGKTVSVLTALSYI   41 (458)
Q Consensus        18 ~~~ll~~~~G~GKT~~al~~~~~l   41 (458)
                      .-..|..|-|+|||.++.+++..+
T Consensus        32 E~lgiVGESGsGKS~~~~aim~ll   55 (316)
T COG0444          32 EILGIVGESGSGKSVLAKAIMGLL   55 (316)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCC
T ss_conf             689998389788999999998466


No 413
>PRK08840 replicative DNA helicase; Provisional
Probab=83.46  E-value=2.8  Score=19.94  Aligned_cols=43  Identities=12%  Similarity=0.162  Sum_probs=23.2

Q ss_pred             CCCCCEEEEECCC--CCHHHHHHHHHHHHCCCCHHCCCCCCEEEEEE
Q ss_conf             0178599990899--89868644566662022020378775289999
Q gi|255764515|r  379 QYGGNILVFFSLW--WDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL  423 (458)
Q Consensus       379 ~~a~~~iI~~~~~--wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~l  423 (458)
                      |.| ++|+|+..+  ++|....+.+..+.- .-||.|.+-.|...+-
T Consensus       403 qdA-D~V~~l~R~~~y~~~~~~~~~~eliv-aKnR~G~~G~v~l~f~  447 (464)
T PRK08840        403 QDA-DLIMFIYRDEVYNPDSPLKGTAEIII-GKQRNGPIGSVRLTFQ  447 (464)
T ss_pred             HHC-CEEEEECCHHHCCCCCCCCCEEEEEE-ECCCCCCCEEEEEEEE
T ss_conf             438-68999644310489888788069999-7268898606999985


No 414
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=83.37  E-value=2.3  Score=20.48  Aligned_cols=33  Identities=27%  Similarity=0.260  Sum_probs=22.3

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             0999588998689999999999975999499991
Q gi|255764515|r   20 CAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIA   53 (458)
Q Consensus        20 ~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~   53 (458)
                      .+++.+.|+|||-.|=.+...+...+.+ +.|+.
T Consensus         2 IgIaG~SgSGKTT~a~~L~~~l~~~~~~-~~vis   34 (179)
T cd02028           2 VGIAGPSGSGKTTFAKKLSNQLRVNGIG-PVVIS   34 (179)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCC-EEEEE
T ss_conf             8998989778999999999998464885-39995


No 415
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=83.22  E-value=2.5  Score=20.24  Aligned_cols=46  Identities=24%  Similarity=0.183  Sum_probs=29.9

Q ss_pred             HHHHHHHHCC-----CEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             9999999679-----8099958899868999999999997599949999160
Q gi|255764515|r    9 KIVDWILDHK-----RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPL   55 (458)
Q Consensus         9 ~~v~~~~~~~-----~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~   55 (458)
                      ..++.++..+     =.+++.++|+|||-.++-++......+ .+++.|.--
T Consensus         6 ~~lD~vLgGGi~~G~it~i~G~pG~GKStl~lq~a~~~~~~g-~~v~YidtE   56 (218)
T cd01394           6 KGLDELLGGGVERGTVTQVYGPPGTGKTNIAIQLAVETAGQG-KKVAYIDTE   56 (218)
T ss_pred             HHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEECC
T ss_conf             789998569987887999989999849999999999986369-869999665


No 416
>pfam02374 ArsA_ATPase Anion-transporting ATPase. This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell.
Probab=83.19  E-value=1.8  Score=21.15  Aligned_cols=45  Identities=22%  Similarity=0.338  Sum_probs=28.3

Q ss_pred             CEEEEE-CCCCCHHHHHHHHHHHHHHCCCCCEEEEE--CCHHHHHHHHH
Q ss_conf             809995-88998689999999999975999499991--60465699999
Q gi|255764515|r   19 RCAIWA-SMGSGKTVSVLTALSYIHLWGEKSVLVIA--PLRVAQSVWTS   64 (458)
Q Consensus        19 ~~ll~~-~~G~GKT~~al~~~~~l~~~~~~~~LIv~--P~~l~~~~W~~   64 (458)
                      |.+++. -=|.|||-+|.+.+..+-..| +++|+|.  |+.-+.+.+..
T Consensus         2 r~i~~~GKGGVGKTT~AaA~A~~~A~~G-~rvLlvStDPAhsL~D~~~~   49 (304)
T pfam02374         2 RWIFFGGKGGVGKTTVSCATAVRLSEQG-KKVLLVSTDPAHSLSDSFNQ   49 (304)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEECCCCCHHHHHHCC
T ss_conf             1999957985748999999999999589-92999946972148898488


No 417
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase. Members of this protein family are related to a known protein-tyrosine autokinase and to numerous homologs from exopolysaccharide biosynthesis region proteins, many of which are designated as chain length determinants. Most members of this family contain a short region, immediately C-terminal to the region modeled here, with an abundance of Tyr residues. These C-terminal tyrosine residues are likely to be autophosphorylation sites. Some members of this family are fusion proteins.
Probab=83.12  E-value=1.8  Score=21.03  Aligned_cols=33  Identities=21%  Similarity=0.253  Sum_probs=24.3

Q ss_pred             EEEE-CCCCCHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             9995-88998689999999999975999499991
Q gi|255764515|r   21 AIWA-SMGSGKTVSVLTALSYIHLWGEKSVLVIA   53 (458)
Q Consensus        21 ll~~-~~G~GKT~~al~~~~~l~~~~~~~~LIv~   53 (458)
                      ++.. .+|-|||.+|..++..+-..+.+++|+|=
T Consensus        39 ~VTS~~pgeGKTtva~nLA~~lA~~~~~~VLLVD   72 (207)
T TIGR03018        39 MVTSSLPGEGKSFTAINLAISLAQEYDKTVLLID   72 (207)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9978999998899999999999972498599995


No 418
>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family.
Probab=83.10  E-value=1.8  Score=21.15  Aligned_cols=26  Identities=27%  Similarity=0.400  Sum_probs=20.9

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             899868999999999997599949999
Q gi|255764515|r   26 MGSGKTVSVLTALSYIHLWGEKSVLVI   52 (458)
Q Consensus        26 ~G~GKT~~al~~~~~l~~~~~~~~LIv   52 (458)
                      =|.|||-+++.++..|-..| +++|+|
T Consensus         9 GGVGKTTtsvNLA~aLA~~G-krVlli   34 (269)
T pfam00142         9 GGIGKSTTSQNTSAALAEMG-KKVLIV   34 (269)
T ss_pred             CCCCHHHHHHHHHHHHHHCC-CEEEEE
T ss_conf             97688999999999999879-909998


No 419
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.
Probab=82.87  E-value=1.8  Score=21.11  Aligned_cols=30  Identities=23%  Similarity=0.421  Sum_probs=22.3

Q ss_pred             EEECCCCCHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             9958899868999999999997599949999
Q gi|255764515|r   22 IWASMGSGKTVSVLTALSYIHLWGEKSVLVI   52 (458)
Q Consensus        22 l~~~~G~GKT~~al~~~~~l~~~~~~~~LIv   52 (458)
                      +..-=|.|||-+++.++..|...| +++|+|
T Consensus         6 i~GKGGVGKTTtavNLA~aLa~~G-kkVlli   35 (270)
T cd02040           6 IYGKGGIGKSTTTQNLSAALAEMG-KKVMIV   35 (270)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHCC-CEEEEE
T ss_conf             979985778999999999999879-949998


No 420
>PRK07004 replicative DNA helicase; Provisional
Probab=82.81  E-value=2.8  Score=19.89  Aligned_cols=42  Identities=12%  Similarity=0.196  Sum_probs=21.0

Q ss_pred             CCCCCEEEEECCC--CCHHHHHHHHHHHHCCCCHHCCCCCCEEEEE
Q ss_conf             0178599990899--8986864456666202202037877528999
Q gi|255764515|r  379 QYGGNILVFFSLW--WDLEEHQQMIERIGVTRQRQAGFKRAVFVYY  422 (458)
Q Consensus       379 ~~a~~~iI~~~~~--wn~~~~~Q~~gRi~~~r~hR~Gq~~~v~v~~  422 (458)
                      |.| ++|+|+-.+  +++....+.+..+.- --||.|.+-.|...+
T Consensus       398 QDA-DvV~fL~r~~~y~~~~~~~~~~e~iv-aK~R~G~~g~v~l~f  441 (460)
T PRK07004        398 QDA-DVILFIYRDEVYNPDSPDKGTAEIII-GKQRNGPIGPVRLTF  441 (460)
T ss_pred             HCC-CEEEEECCCCCCCCCCCCCCEEEEEE-ECCCCCCCEEEEEEE
T ss_conf             207-78999754101589988888169999-736889960699998


No 421
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]
Probab=82.67  E-value=1.8  Score=21.14  Aligned_cols=10  Identities=30%  Similarity=0.345  Sum_probs=7.4

Q ss_pred             CEEEEECCCC
Q ss_conf             8079965840
Q gi|255764515|r  152 ERFIELTGTP  161 (458)
Q Consensus       152 ~~~l~LTgTP  161 (458)
                      .-++.+.||+
T Consensus       287 ~gviviaaTN  296 (596)
T COG0465         287 EGVIVIAATN  296 (596)
T ss_pred             CCEEEECCCC
T ss_conf             7548852678


No 422
>COG4646 DNA methylase [Transcription / DNA replication, recombination, and repair]
Probab=82.61  E-value=0.66  Score=23.72  Aligned_cols=15  Identities=20%  Similarity=0.220  Sum_probs=5.5

Q ss_pred             EEEECCCCHHHHCCC
Q ss_conf             799658402310010
Q gi|255764515|r  154 FIELTGTPSPNGLID  168 (458)
Q Consensus       15