HHsearch alignment for GI: 255764515 and conserved domain: pfam01695

>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=97.21  E-value=0.0013  Score=40.22  Aligned_cols=52  Identities=21%  Similarity=0.185  Sum_probs=38.2

Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             99999999967980999588998689999999999975999499991604656
Q gi|255764515|r    7 QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQ   59 (458)
Q Consensus         7 Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~~~~LIv~P~~l~~   59 (458)
T Consensus        37 ~L~~~~~i~~~~Nlll~G~~GtGKThLA~Ai~~~~~~~g-~~v~f~~~~~L~~   88 (178)
T pfam01695        37 ELAGLDWIEQAENLLLLGPPGVGKTHLACALGHQACRAG-YSVLFTRTPDLVE   88 (178)
T ss_pred             HHHCCCCHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCC-CEEEEEECHHHHH
T ss_conf             885597421587689989999878999999999999869-8599996167999