HHsearch alignment for GI: 255764515 and conserved domain: pfam02562

>pfam02562 PhoH PhoH-like protein. PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation.
Probab=98.55  E-value=2e-06  Score=57.12  Aligned_cols=133  Identities=17%  Similarity=0.201  Sum_probs=73.6

Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCC-CCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEEC
Q ss_conf             4789999999996798099958899868999999999997599-949999160465699999999855888815999858
Q gi|255764515|r    4 APHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG   82 (458)
Q Consensus         4 ~p~Q~~~v~~~~~~~~~ll~~~~G~GKT~~al~~~~~l~~~~~-~~~LIv~P~~l~~~~W~~Ei~kf~~~~~~~~~~~~g   82 (458)
T Consensus         6 ~~~Q~~~~~~l~~~~iv~~~GpAGtGKT~la~~~al~~l~~~~~~kiii~Rp~--v~~--g~~i-----------GfLPG   70 (205)
T pfam02562         6 TLGQKRYVEAIRKNDIVFGIGPAGTGKTYLAVAAAVDALKDGKVKRIILTRPA--VEA--GEKL-----------GFLPG   70 (205)
T ss_pred             CHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECC--CCC--CCCC-----------CCCCC
T ss_conf             88899999997179807998999860999999999999971894379997577--125--7754-----------55889


Q ss_pred             CHHHH--------------------HHHHCCCCCEEEECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHH
Q ss_conf             97898--------------------8873077986998064202334420001132204404531002465431156777
Q gi|255764515|r   83 TVKQR--------------------TKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTAR  142 (458)
Q Consensus        83 ~~~~r--------------------~~~~~~~~~i~i~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~  142 (458)
T Consensus        71 ~~~eK~~p~~~p~~d~l~~~~~~~~~~~l~~~~~Ie~~pl~~iRG------rTf~n~~iIvDEaQN~------t~~~lk~  138 (205)
T pfam02562        71 DLEEKVDPYLRPLYDALYDMLGAEKVEKLIERGVIEIAPLAYMRG------RTLNDAFIILDEAQNT------TPEQMKM  138 (205)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCEEECCHHHHCC------CCCCCCEEEEECHHCC------CHHHHHH
T ss_conf             789999999999999999872899999999759756614676554------7625688999722139------9999999


Q ss_pred             HHHHHHHCCCEEEEECCCCHHHH
Q ss_conf             76654305980799658402310
Q gi|255764515|r  143 ALAKPAWESERFIELTGTPSPNG  165 (458)
Q Consensus       143 ~l~~~~~~~~~~l~LTgTPi~n~  165 (458)
T Consensus       139 ilTRiG~~S--K~vi~GD~~Q~D  159 (205)
T pfam02562       139 FLTRIGFNS--KMVVTGDITQID  159 (205)
T ss_pred             HHHHCCCCC--EEEEECCHHHCC
T ss_conf             984217996--899947866517