HHsearch alignment for GI: 255764515 and conserved domain: pfam03237

>pfam03237 Terminase_6 Terminase-like family. This family represents a group of terminase proteins.
Probab=95.20  E-value=0.11  Score=28.35  Aligned_cols=133  Identities=21%  Similarity=0.160  Sum_probs=56.7

Q ss_pred             EECCCCCHHHHHHHHH-HHHHHCCCCCEEEEECCH--HHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHCCCCCEEE
Q ss_conf             9588998689999999-999975999499991604--6569999999985588881599985897898887307798699
Q gi|255764515|r   23 WASMGSGKTVSVLTAL-SYIHLWGEKSVLVIAPLR--VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYV   99 (458)
Q Consensus        23 ~~~~G~GKT~~al~~~-~~l~~~~~~~~LIv~P~~--l~~~~W~~Ei~kf~~~~~~~~~~~~g~~~~r~~~~~~~~~i~i   99 (458)
T Consensus         3 ~ggr~~GKT~~~~~~~~~~a~~~~~~~~~i~~~t~~~~~~~~~-~~~~~~~~~-~~~~~~~-~~~~~~-i~~~nGs~i~~   78 (380)
T pfam03237         3 LGSRQSGKTFAFAREALRHALGNGPKNQIILSASKAQARLEFK-KGIIEIAGD-LLEITFE-EKNGNP-IILPNGAKLYF   78 (380)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHH-HHHHHHHHH-HCCCCEE-ECCCCE-EEECCCCEEEE
T ss_conf             2645252839999999999985899728999799999999999-999996688-6387167-278873-99159988999


Q ss_pred             ECCCCHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHH
Q ss_conf             806420233442000113220440453100246543115677776654305980799658402310
Q gi|255764515|r  100 INFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNG  165 (458)
Q Consensus       100 ~s~e~~~~~~~~~~~~~~~~~iIiDEaH~lkn~~~~~~s~~~~~l~~~~~~~~~~l~LTgTPi~n~  165 (458)
T Consensus        79 ~~~~~~~~~-~~-~rG~~~~~i~~DE~a~~~~~~---~~~~~~~~~~~-~~~~~~~~~stp~~~~~  138 (380)
T pfam03237        79 LGLESETTA-QG-YRGASIAGIYFDEATWLPKFQ---ESELVRRLRAT-KGKWRKTFFSTPPSPGH  138 (380)
T ss_pred             EECCCCCCH-HH-CCCCCCCEEEEEEHHHCCCHH---HHHHHHHHHCC-CCCCCEEEEECCCCCCC
T ss_conf             625776643-10-348545549983045366278---99998644104-79975799988989985