HHsearch alignment for GI: 255764515 and conserved domain: pfam06733

>pfam06733 DEAD_2 DEAD_2. This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin. RAD3 is involved in nucleotide excision repair, and forms part of the transcription factor TFIIH in yeast.
Probab=94.50  E-value=0.025  Score=32.35  Aligned_cols=38  Identities=16%  Similarity=0.212  Sum_probs=23.1

Q ss_pred             CCCCCEEEECCCCHHH--HHHHCCCCCCCCEEECCCCCCC
Q ss_conf             0779869980642023--3442000113220440453100
Q gi|255764515|r   92 KTPAVLYVINFENLGW--LVQELKGTWPFATIVVDESTKL  129 (458)
Q Consensus        92 ~~~~~i~i~s~e~~~~--~~~~~~~~~~~~~iIiDEaH~l  129 (458)
T Consensus       112 ~~~AdiI~~pYnylld~~ir~~l~i~l~~~IvI~DEAHNl  151 (168)
T pfam06733       112 LKDADIIILPYNYLLDPKIRESLKINLKNSIVIFDEAHNI  151 (168)
T ss_pred             HHCCCEEEECCHHHCCHHHHHHHCCCCCCEEEEEECCCCH
T ss_conf             8539989966177619999998378758849999881375