BLAST/PSIBLAST alignment of GI: 255764515 and GI: 315122937 at iteration 1
>gi|315122937|ref|YP_004063426.1| SNF2 related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 456
>gi|313496339|gb|ADR52938.1| SNF2 related protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 456
 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/451 (68%), Positives = 375/451 (83%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVW 62
           L  HQ K+V W+L +KRCA+WASMGSGKTVSVL ALSYI +   +  L+IAPLRVAQSVW
Sbjct: 4   LESHQIKMVHWMLQNKRCAVWASMGSGKTVSVLFALSYIQMLDPRPALIIAPLRVAQSVW 63

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
           ++EV+RWS F +M ++V TGT KQR + L  PA L V NFEN+ WLV+ L   W F+TI+
Sbjct: 64  SAEVKRWSAFKNMTVAVATGTEKQRIQALNQPASLVVTNFENVPWLVKLLGNQWNFSTII 123

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRL 182
           VDESTKLK+FR+RQG K  +ALA+PAW++E FIELTGTPSPNGLIDLWGQ+WFLDKGKRL
Sbjct: 124 VDESTKLKAFRIRQGGKMCKALARPAWQTEHFIELTGTPSPNGLIDLWGQLWFLDKGKRL 183

Query: 183 GRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
           G  +  F+ +WFNT ++G+H+ AV++T K  AQ+EIEA+LSD CLSL+IADY +I KPI 
Sbjct: 184 GMTYDCFLQKWFNTHRVGAHVSAVKHTPKPHAQQEIEAKLSDRCLSLNIADYHDISKPIC 243

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWK 302
              K+ L Q  +K Y KFQREL+C++QGE + AFNSASKTVKCLQLANGAVY DE   WK
Sbjct: 244 TIHKIALAQSTLKLYRKFQRELFCEIQGEPLVAFNSASKTVKCLQLANGAVYTDESHSWK 303

Query: 303 EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKI 362
           EVH+ KI+AL+ I+E+A  +P++VAYHFNSDL RL KAFPQGR LDK+P TI++WN GKI
Sbjct: 304 EVHNAKIEALKAIVEEAGRSPVLVAYHFNSDLMRLFKAFPQGRHLDKNPQTIKDWNAGKI 363

Query: 363 PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
           PLLFAHPASC HGLNLQYGGNILVFFSLWWDLE HQQMIERIG  RQ+QAGFKRAVF++Y
Sbjct: 364 PLLFAHPASCAHGLNLQYGGNILVFFSLWWDLETHQQMIERIGTLRQKQAGFKRAVFIHY 423

Query: 423 LIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           LIA++TIDEL+L+RL+TK+T+Q++LLNALKK
Sbjct: 424 LIAEHTIDELILKRLQTKATVQEILLNALKK 454