BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus
Liberibacter asiaticus str. psy62]
         (458 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62]
 gi|254547866|gb|ACT57668.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62]
          Length = 458

 Score =  950 bits (2455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/458 (100%), Positives = 458/458 (100%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS 60
           MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS
Sbjct: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS 60

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
           VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT
Sbjct: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK
Sbjct: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP
Sbjct: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH
Sbjct: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG
Sbjct: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV
Sbjct: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 458
           YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
Sbjct: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 458


>gi|317120757|gb|ADV02578.1| SNF2 Dead box helicase [Candidatus Liberibacter asiaticus]
          Length = 460

 Score =  949 bits (2452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/458 (99%), Positives = 458/458 (100%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS 60
           +NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS
Sbjct: 3   LNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS 62

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
           VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT
Sbjct: 63  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 122

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK
Sbjct: 123 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 182

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP
Sbjct: 183 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 242

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH
Sbjct: 243 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 302

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG
Sbjct: 303 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 362

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV
Sbjct: 363 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 422

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 458
           YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
Sbjct: 423 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 460


>gi|317120700|gb|ADV02523.1| SNF2 Dead box helicase [Liberibacter phage SC1]
 gi|317120743|gb|ADV02565.1| SNF2 Dead box helicase [Liberibacter phage SC2]
 gi|317120804|gb|ADV02625.1| SNF2 Dead box helicase [Candidatus Liberibacter asiaticus]
          Length = 461

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/457 (83%), Positives = 406/457 (88%), Gaps = 1/457 (0%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVW 62
           L PHQ  +V+W+L H RCA+WASMGSGKTVSVL ALS I +   + VL+IAPLRVAQ VW
Sbjct: 5   LKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVW 64

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
             EV+RWS FS M +S + G+ +QR K L TPA LY+INFEN+ WLV+     W FATIV
Sbjct: 65  KDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIV 124

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
           VDESTKLKSFR  QG+K  RAL K A+   +RFIELTGTPSPNGLIDLWGQIWFLDKGKR
Sbjct: 125 VDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKR 184

Query: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
           LG  F+SFV RWF+T Q+GS IGAV++  K  AQKEIE +LSDCCLSLDIADYQNIDKPI
Sbjct: 185 LGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKEIEEKLSDCCLSLDIADYQNIDKPI 244

Query: 242 LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
           LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW
Sbjct: 245 LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 304

Query: 302 KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGK 361
           KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGK
Sbjct: 305 KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGK 364

Query: 362 IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY 421
           IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY
Sbjct: 365 IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY 424

Query: 422 YLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 458
           YLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
Sbjct: 425 YLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 461


>gi|317120844|gb|ADV02665.1| SNF2 Dead box helicase [Candidatus Liberibacter asiaticus]
          Length = 461

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/457 (80%), Positives = 398/457 (87%), Gaps = 1/457 (0%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVW 62
           L PHQ  +V+W+L H RCA+WASMGSGKTVSVL ALS I +   + VL+IAPLRVAQSVW
Sbjct: 5   LKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQSVW 64

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
             EV+RWS FS M +S + G+ +QR K L TPA LY+INFEN+ WLV+     W FATIV
Sbjct: 65  KDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIV 124

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
           VDEST+LKSFR  QG+K  RAL K A+   ERFIELTGTPSPNGLIDLWGQIWFLDKGKR
Sbjct: 125 VDESTRLKSFRTHQGTKQTRALGKVAFSKVERFIELTGTPSPNGLIDLWGQIWFLDKGKR 184

Query: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
           LG  F+SFV RWF+T ++GS IGAV++  K  AQKEIEAQLSDCCLSL+IADY +IDKP+
Sbjct: 185 LGLSFKSFVERWFHTQRVGSSIGAVKHIPKINAQKEIEAQLSDCCLSLNIADYHDIDKPL 244

Query: 242 LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
            +  KV L   ++K Y KFQREL+CD+QGENIEAFNSASKTVKCLQLANGAVYYDEEKHW
Sbjct: 245 RLIHKVTLSPSLLKLYRKFQRELFCDIQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 304

Query: 302 KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGK 361
           KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGK
Sbjct: 305 KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGK 364

Query: 362 IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY 421
           IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY
Sbjct: 365 IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY 424

Query: 422 YLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 458
           YLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV
Sbjct: 425 YLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 461


>gi|315122937|ref|YP_004063426.1| SNF2 related protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496339|gb|ADR52938.1| SNF2 related protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 456

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/451 (68%), Positives = 375/451 (83%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVW 62
           L  HQ K+V W+L +KRCA+WASMGSGKTVSVL ALSYI +   +  L+IAPLRVAQSVW
Sbjct: 4   LESHQIKMVHWMLQNKRCAVWASMGSGKTVSVLFALSYIQMLDPRPALIIAPLRVAQSVW 63

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
           ++EV+RWS F +M ++V TGT KQR + L  PA L V NFEN+ WLV+ L   W F+TI+
Sbjct: 64  SAEVKRWSAFKNMTVAVATGTEKQRIQALNQPASLVVTNFENVPWLVKLLGNQWNFSTII 123

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRL 182
           VDESTKLK+FR+RQG K  +ALA+PAW++E FIELTGTPSPNGLIDLWGQ+WFLDKGKRL
Sbjct: 124 VDESTKLKAFRIRQGGKMCKALARPAWQTEHFIELTGTPSPNGLIDLWGQLWFLDKGKRL 183

Query: 183 GRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
           G  +  F+ +WFNT ++G+H+ AV++T K  AQ+EIEA+LSD CLSL+IADY +I KPI 
Sbjct: 184 GMTYDCFLQKWFNTHRVGAHVSAVKHTPKPHAQQEIEAKLSDRCLSLNIADYHDISKPIC 243

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWK 302
              K+ L Q  +K Y KFQREL+C++QGE + AFNSASKTVKCLQLANGAVY DE   WK
Sbjct: 244 TIHKIALAQSTLKLYRKFQRELFCEIQGEPLVAFNSASKTVKCLQLANGAVYTDESHSWK 303

Query: 303 EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKI 362
           EVH+ KI+AL+ I+E+A  +P++VAYHFNSDL RL KAFPQGR LDK+P TI++WN GKI
Sbjct: 304 EVHNAKIEALKAIVEEAGRSPVLVAYHFNSDLMRLFKAFPQGRHLDKNPQTIKDWNAGKI 363

Query: 363 PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
           PLLFAHPASC HGLNLQYGGNILVFFSLWWDLE HQQMIERIG  RQ+QAGFKRAVF++Y
Sbjct: 364 PLLFAHPASCAHGLNLQYGGNILVFFSLWWDLETHQQMIERIGTLRQKQAGFKRAVFIHY 423

Query: 423 LIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           LIA++TIDEL+L+RL+TK+T+Q++LLNALKK
Sbjct: 424 LIAEHTIDELILKRLQTKATVQEILLNALKK 454


>gi|315121969|ref|YP_004062458.1| SNF2 related protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495371|gb|ADR51970.1| SNF2 related protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 456

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/451 (68%), Positives = 374/451 (82%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVW 62
           L  HQ K+V W+L +KRCA+WASMGSGKTVSVL ALSYI +   +  L+IAPLRVAQSVW
Sbjct: 4   LESHQIKMVHWMLQNKRCAVWASMGSGKTVSVLFALSYIQMLDPRPALIIAPLRVAQSVW 63

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
           ++EV+RWS F +M ++V TGT KQR + L  PA L V NFEN+ WLV+ L   W F+TI+
Sbjct: 64  SAEVKRWSAFKNMTVAVATGTEKQRIQALNQPASLVVTNFENVPWLVKLLGNQWNFSTII 123

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRL 182
           VDESTKLK+FR+RQG K  +ALA+PAW++E FIELTGTPSPNGLIDLWGQ+WFLDKGKRL
Sbjct: 124 VDESTKLKAFRIRQGGKMCKALARPAWQTEHFIELTGTPSPNGLIDLWGQLWFLDKGKRL 183

Query: 183 GRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
           G  +  F+ +WFNT ++G+H+ AV++T K  AQ+EIEA+LSD CLSL+IADY +I KPI 
Sbjct: 184 GMTYDCFLQKWFNTHRVGAHVSAVKHTPKPHAQQEIEAKLSDRCLSLNIADYHDISKPIC 243

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWK 302
              K+ L Q  +K Y KFQREL+C++QGE + AFNSASKTVKCLQLANGAVY DE   WK
Sbjct: 244 TIHKIALAQSTLKLYRKFQRELFCEIQGEPLVAFNSASKTVKCLQLANGAVYTDENHSWK 303

Query: 303 EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKI 362
           EVH+ KI+AL+ I+E+A   P++VAYHFNSDL RL KAFPQGR LDK+P TI++WN GKI
Sbjct: 304 EVHNAKIEALKAIVEEAGGCPLLVAYHFNSDLMRLFKAFPQGRHLDKNPQTIKDWNAGKI 363

Query: 363 PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
           PLLFAHPASC HGLNLQYGGNILVFFSLWWDLE HQQMIERIG  RQ+QAGFKRAVF++Y
Sbjct: 364 PLLFAHPASCAHGLNLQYGGNILVFFSLWWDLETHQQMIERIGPLRQKQAGFKRAVFIHY 423

Query: 423 LIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           LIA++TIDEL+L+RL+TK+T+Q++LLNALKK
Sbjct: 424 LIAEHTIDELILKRLQTKATVQEILLNALKK 454


>gi|41179407|ref|NP_958716.1| Bbp47 [Bordetella phage BPP-1]
 gi|45569539|ref|NP_996608.1| DEAD box helicase [Bordetella phage BMP-1]
 gi|45580790|ref|NP_996656.1| DEAD box helicase [Bordetella phage BIP-1]
 gi|40950146|gb|AAR97712.1| Bbp47 [Bordetella phage BPP-1]
          Length = 464

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 252/451 (55%), Positives = 324/451 (71%), Gaps = 3/451 (0%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSE 65
           +Q  ++D +LD  R A+WA MG GKTVS LTAL  + L      LV+APLRVA S W  E
Sbjct: 11  YQQPVIDHVLDVPRDAVWAGMGMGKTVSALTALDILELVEPGPSLVLAPLRVAASTWPDE 70

Query: 66  VQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDE 125
             +W++  ++ +S + GT +QR   LK PA ++  N++NL WL++ L   WPF  +V DE
Sbjct: 71  STKWAHLRNVEVSAVVGTPEQRRAALKRPANVFTTNYDNLPWLIEHLGDRWPFRKVVADE 130

Query: 126 STKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGR 184
           STKLKSFRL+QG K A AL + A  + +RFIELTGTPSPNGL DLWGQ WFLDKG+RLGR
Sbjct: 131 STKLKSFRLQQGGKRAHALGRVAHAKVDRFIELTGTPSPNGLQDLWGQAWFLDKGERLGR 190

Query: 185 VFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILIT 244
            F +F +RWF + Q+GS   AVR      AQ++IE +L D CLSLD  DY +I +PI+  
Sbjct: 191 SFGAFKSRWFQSIQVGSDRHAVRLEPLPFAQQQIEDRLRDLCLSLDARDYFDISEPIVNV 250

Query: 245 KKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE-EKHWK 302
            +V LP    + Y   +RE +  L+ G  IEAFN+ASKT+KCLQLANGA+Y D+    W 
Sbjct: 251 VRVELPAKARRLYRDMEREAFLALECGIEIEAFNAASKTIKCLQLANGAIYTDDTATTWA 310

Query: 303 EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKI 362
           +VHD K++ALE I+ +A   P++VAYHF SDLARLQ+AFPQGR LD++P TI++WN GKI
Sbjct: 311 DVHDVKLQALESIVAEAAGMPVLVAYHFKSDLARLQRAFPQGRALDQNPQTIRDWNAGKI 370

Query: 363 PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
           PLLFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG  R VF+Y+
Sbjct: 371 PLLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHDRPVFIYH 430

Query: 423 LIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           ++A +T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 431 IVATDTMDELVMARRESKREVQDLLLEAMKR 461


>gi|71276270|ref|ZP_00652548.1| SNF2-related [Xylella fastidiosa Dixon]
 gi|71162878|gb|EAO12602.1| SNF2-related [Xylella fastidiosa Dixon]
          Length = 472

 Score =  502 bits (1292), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 241/457 (52%), Positives = 326/457 (71%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++NL WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQDADIYCINYDNLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALAKHVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR      A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAVQIGSDPHAVRLVPAPNASQEIQDKIRDLCLSLDPHAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP+   + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPEHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK+P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKNPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG KR
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHKR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A NT+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAANTVDELVMARRESKREVQDLLLEAVKR 457


>gi|71900964|ref|ZP_00683077.1| SNF2-related [Xylella fastidiosa Ann-1]
 gi|71729269|gb|EAO31387.1| SNF2-related [Xylella fastidiosa Ann-1]
          Length = 472

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 240/457 (52%), Positives = 326/457 (71%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++NL WLV+  +  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQDADIYCINYDNLKWLVEFYQDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALAKHVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR      A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAVQIGSDPHAVRLVPAPNASQEIQDKIRDLCLSLDPHAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP+   + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPEHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK+P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKNPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG KR
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHKR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A NT+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAANTVDELVMARRESKREVQDLLLEAVKR 457


>gi|71274496|ref|ZP_00650784.1| SNF2-related [Xylella fastidiosa Dixon]
 gi|71900325|ref|ZP_00682460.1| SNF2-related [Xylella fastidiosa Ann-1]
 gi|71164228|gb|EAO13942.1| SNF2-related [Xylella fastidiosa Dixon]
 gi|71729900|gb|EAO31996.1| SNF2-related [Xylella fastidiosa Ann-1]
          Length = 472

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 240/457 (52%), Positives = 325/457 (71%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++NL WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQDADIYCINYDNLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALAKHVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR      A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAVQIGSDPHAVRLVPAPNASQEIQDKIRDLCLSLDPHAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP+   + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPEHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK+P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKNPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHTR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A NT+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAANTVDELVMARRESKREVQDLLLEAVKR 457


>gi|71902063|ref|ZP_00684103.1| SNF2-related [Xylella fastidiosa Ann-1]
 gi|71728174|gb|EAO30365.1| SNF2-related [Xylella fastidiosa Ann-1]
          Length = 472

 Score =  498 bits (1281), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 239/457 (52%), Positives = 324/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++NL WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQDADIYCINYDNLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALAKHVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR      A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAVQIGSDPHAVRLVPAPNASQEIQDKIRDLCLSLDPHAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP+   + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPEHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK+P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKNPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHTR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|71275472|ref|ZP_00651758.1| SNF2-related [Xylella fastidiosa Dixon]
 gi|71163772|gb|EAO13488.1| SNF2-related [Xylella fastidiosa Dixon]
          Length = 472

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 238/457 (52%), Positives = 324/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++NL WLV+  +  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQDADIYCINYDNLKWLVEFYQDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALAKHVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR      A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAVQIGSDPHAVRLVPAPNASQEIQDKIRDLCLSLDPHAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP+   + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPEHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK+P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKNPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHTR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|170023443|ref|YP_001719948.1| hypothetical protein YPK_1197 [Yersinia pseudotuberculosis YPIII]
 gi|169749977|gb|ACA67495.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII]
          Length = 463

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 237/457 (51%), Positives = 325/457 (71%), Gaps = 6/457 (1%)

Query: 5   PH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQS 60
           PH  Q +I+   +D  R  +WA MG GKTV+ LT+L  + + G ++   LV+APLRVA+S
Sbjct: 7   PHEYQNQIILHEIDAPRSNVWAGMGMGKTVATLTSLEDLFMSGSETQPTLVLAPLRVARS 66

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTP-AVLYVINFENLGWLVQELKGTWPFA 119
            W  EV +W +  ++ +  + GT ++R   L+ P A ++  N++NL WL++ L G WPF 
Sbjct: 67  TWPDEVDKWDHLRNIEMQPVVGTAQERLAALRNPNASVFTTNYDNLVWLIEALNGEWPFG 126

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKG 179
           T++ DEST+LKSFRLR+G K A ALAK A  S R++ L+GTP+PNGL DLWGQ WFLDKG
Sbjct: 127 TVIADESTRLKSFRLRKGGKRAAALAKVAHRSGRWVNLSGTPAPNGLQDLWGQAWFLDKG 186

Query: 180 KRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK 239
           +RLGR F +F  RWFN   IG+  G  +   +E AQ++++  L D  +SL+ AD+ +ID+
Sbjct: 187 QRLGRTFSAFTDRWFNRIPIGT-TGFNKIEPRECAQQQMQDALRDVTISLNAADWFDIDE 245

Query: 240 PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEK 299
           PI    +V L      QY + ++E++  +    IEA N+ASKT+KCLQLA+GA+Y DE  
Sbjct: 246 PIHSVVRVGLSPKARSQYKEMEKEMFLQIGDHGIEAMNAASKTMKCLQLASGAIYTDEAG 305

Query: 300 HWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNE 359
           +W E+HD K++ALE II +A+  P++VAYHF SDLARL KAFP+GR LD DP T ++WN 
Sbjct: 306 NWTEIHDAKLQALESIITEASGMPVLVAYHFKSDLARLLKAFPKGRHLDADPQTQRDWNA 365

Query: 360 GKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVF 419
           G IP+LFAHPAS GHGLNLQ GGNIL FFS WWDLE++QQ+IERIG TRQ QAG KR V+
Sbjct: 366 GLIPVLFAHPASAGHGLNLQDGGNILAFFSHWWDLEQYQQIIERIGPTRQAQAGHKRPVW 425

Query: 420 VYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           +Y++IA++T+DELV +R  +K  +QD+LL A+KK  +
Sbjct: 426 IYHIIAEDTVDELVKERRDSKREVQDILLEAMKKRGL 462


>gi|262043428|ref|ZP_06016553.1| SNF2 domain protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259039254|gb|EEW40400.1| SNF2 domain protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 464

 Score =  494 bits (1272), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 236/456 (51%), Positives = 328/456 (71%), Gaps = 5/456 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVW 62
           P+Q  I++  +D +RC IWA MG GKTV+ LTAL  + + G ++   LV+APLRVA S W
Sbjct: 9   PYQDLIINHEIDIQRCNIWAGMGMGKTVATLTALEDLFMCGAETQPALVLAPLRVAASTW 68

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTP-AVLYVINFENLGWLVQELKGTWPFATI 121
             E  +W +  ++++  I GT K RT  L    A ++ IN++NL WLV+EL G WPF T+
Sbjct: 69  PDEAVKWGHLRNIDVQPIVGTAKARTAALANGNASVFTINYDNLAWLVEELGGRWPFGTV 128

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR G K A AL K A +   R++ LTGTP+PNGL+DLWGQ WF+D+G+
Sbjct: 129 IPDESTRLKSFRLRGGGKRAAALGKVAHKHVRRWMNLTGTPAPNGLVDLWGQAWFVDQGQ 188

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWFN+ Q        +      +Q EI+  L+D  +SLD AD+ +I +P
Sbjct: 189 RLGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFAHSQDEIQRALADVTISLDAADWFDIKEP 247

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I    +V +P    +QY + ++E++ +L GE IEA N+A+KTVKCLQ+A+GAVY D+   
Sbjct: 248 IHNVVRVDMPPKARQQYREMEKEMFLELNGEGIEAPNAAAKTVKCLQIASGAVYTDDAGS 307

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD K++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN G
Sbjct: 308 WSELHDAKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNAG 367

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIP+LFAHPAS GHGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 368 KIPVLFAHPASAGHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFI 427

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           +++IA +T+DE+V++R  +K T+QD+LL+A+KK  I
Sbjct: 428 HHIIAVDTMDEMVMERRDSKRTVQDILLDAMKKRGI 463


>gi|71898924|ref|ZP_00681091.1| SNF2-related [Xylella fastidiosa Ann-1]
 gi|71731336|gb|EAO33400.1| SNF2-related [Xylella fastidiosa Ann-1]
          Length = 472

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 237/457 (51%), Positives = 322/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++ L WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDTLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALA     + ER++ LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALATHVHTKVERYVGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR+     A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAMQIGSDPHAVRFVPTPHASQEIQDKIRDICLSLDPHAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKHPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNILVFF  WWDLE++QQ+IERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILVFFGHWWDLEQYQQIIERIGPTRQAQAGHTR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|273810423|ref|YP_003344894.1| helicase [Xylella phage Xfas53]
 gi|257097798|gb|ACV41104.1| helicase [Xylella phage Xfas53]
          Length = 472

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 236/457 (51%), Positives = 322/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++ L WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDTLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALA     + ER++ LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALATHVHTKVERYVGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR+     A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAMQIGSDPHAVRFAPTPHASQEIQDKIRDLCLSLDPQAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKHPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG +R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHQR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|71898992|ref|ZP_00681158.1| SNF2-related [Xylella fastidiosa Ann-1]
 gi|71731238|gb|EAO33303.1| SNF2-related [Xylella fastidiosa Ann-1]
          Length = 472

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 237/457 (51%), Positives = 322/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++ L WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDTLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALA     + ER++ LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALATHVHTKVERYVGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR+     A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGAHFKAFIDRWFRAVQIGSDPHAVRFVPTPHASQEIQDKIRDICLSLDPHAYFDLC 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKHPETIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG KR
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHKR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|71901323|ref|ZP_00683419.1| SNF2-related [Xylella fastidiosa Ann-1]
 gi|71728907|gb|EAO31042.1| SNF2-related [Xylella fastidiosa Ann-1]
          Length = 472

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 237/457 (51%), Positives = 322/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++ L WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDTLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALA     + ER++ LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALATHVHTKVERYVGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR+     A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGAHFKAFIDRWFRAMQIGSDPHAVRFVPTPHASQEIQDKIRDICLSLDPHAYFDLC 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKHPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG KR
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHKR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|28198299|ref|NP_778613.1| hypothetical protein PD0382 [Xylella fastidiosa Temecula1]
 gi|28199082|ref|NP_779396.1| hypothetical protein PD1194 [Xylella fastidiosa Temecula1]
 gi|182680936|ref|YP_001829096.1| SNF2-related protein [Xylella fastidiosa M23]
 gi|182681808|ref|YP_001829968.1| SNF2-related protein [Xylella fastidiosa M23]
 gi|28056369|gb|AAO28262.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|28057180|gb|AAO29045.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|182631046|gb|ACB91822.1| SNF2-related protein [Xylella fastidiosa M23]
 gi|182631918|gb|ACB92694.1| SNF2-related protein [Xylella fastidiosa M23]
 gi|307579404|gb|ADN63373.1| SNF2-related protein [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 472

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 236/457 (51%), Positives = 321/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++ L WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDTLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALA     + ER++ LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALATHVHTKVERYVGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR+     A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAMQIGSDPHAVRFAPTPHASQEIQDKIRDLCLSLDPQAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKHPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHTR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|212712312|ref|ZP_03320440.1| hypothetical protein PROVALCAL_03400 [Providencia alcalifaciens DSM
           30120]
 gi|212685058|gb|EEB44586.1| hypothetical protein PROVALCAL_03400 [Providencia alcalifaciens DSM
           30120]
          Length = 463

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 238/454 (52%), Positives = 328/454 (72%), Gaps = 5/454 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVW 62
           P+Q  I+   +D KR  +WA MG GKTV+ LT+L Y+ + G ++   LV+APLRVA S W
Sbjct: 11  PYQDLILSHEIDIKRSNVWAGMGMGKTVATLTSLEYLFMAGSETQPALVLAPLRVASSTW 70

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLK-TPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +W++  ++++  I GT K+R   +K T A ++ IN++NL WLV+     WPF TI
Sbjct: 71  PDEAVKWNHLRNIDVQPIIGTAKERMAAIKNTNASVFTINYDNLVWLVEIFGEHWPFGTI 130

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR+G K A ALAK A +   R++ LTGTPSPNGLIDLWGQ WF+D+G+
Sbjct: 131 IADESTRLKSFRLRKGGKRAAALAKVAHKHVHRWVNLTGTPSPNGLIDLWGQAWFVDQGQ 190

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWFN  Q      + +      AQ++++  L D  +SLD AD+ +I++P
Sbjct: 191 RLGRTYSAFTSRWFNNIQFPGQQWS-KLEPWPFAQEQMQDALRDVTISLDAADWFDIEEP 249

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I    K+ LP    KQY + ++E++ +L+ E +EA N+A+KTVKCLQ+A+GA+Y D+ K+
Sbjct: 250 IHNIIKLELPTKARKQYQEMEKEMFLELEHEGVEALNAAAKTVKCLQIASGAIYTDDSKN 309

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD KI+ALE II ++   PI+VAYH+  DL RL KAFP+GR LD DP T+++WN G
Sbjct: 310 WVELHDTKIQALESIISESGGMPILVAYHWKHDLERLLKAFPKGRNLDADPQTLRDWNAG 369

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIP+LFAHPAS GHGLNLQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG+ R VF+
Sbjct: 370 KIPILFAHPASAGHGLNLQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGYNRPVFI 429

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           ++LIA  T+DE+V++R  +K  IQDLLL A+K++
Sbjct: 430 HHLIAAGTMDEVVMERRNSKREIQDLLLEAMKRK 463


>gi|28199605|ref|NP_779919.1| hypothetical protein PD1730 [Xylella fastidiosa Temecula1]
 gi|182682346|ref|YP_001830506.1| SNF2-related protein [Xylella fastidiosa M23]
 gi|28057720|gb|AAO29568.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|182632456|gb|ACB93232.1| SNF2-related protein [Xylella fastidiosa M23]
 gi|307578627|gb|ADN62596.1| SNF2-related protein [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 472

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 236/457 (51%), Positives = 322/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++ L WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDTLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALA     + ER++ LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALATHVHTKVERYVGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR+     A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAMQIGSDPHAVRFAPTPHASQEIQDKIRDLCLSLDPQAYFDLC 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKHPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG +R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHQR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|9633588|ref|NP_051002.1| hypothetical protein APSE-1_41 [Acyrthosiphon pisum bacteriophage
           APSE-1]
 gi|9910955|sp|Q9T1Q7|VP41_BPAPS RecName: Full=Putative protein p41
 gi|6118036|gb|AAF03984.1|AF157835_41 P41 [Endosymbiont phage APSE-1]
          Length = 460

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 238/454 (52%), Positives = 322/454 (70%), Gaps = 5/454 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVW 62
           P+Q  I++ +LD KR  +WA MG GKT + LTAL  ++L G   K  LV+APLRVAQS W
Sbjct: 8   PYQHLIINHLLDIKRSNVWAGMGMGKTAATLTALENLYLSGSETKPTLVLAPLRVAQSTW 67

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLK-TPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +WS+  ++ +  I G+ K R   LK T A ++ +N++NL WLV  L  TWPF TI
Sbjct: 68  PDEALKWSHLRNIEVQPIIGSAKARIAALKNTHASVFTVNYDNLVWLVDILGDTWPFGTI 127

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR+G K   ALAK A +S  R++ LTGTPSPNGL+DLWGQ WF+D+G+
Sbjct: 128 IADESTRLKSFRLRKGGKRTAALAKIAHKSVHRWVNLTGTPSPNGLMDLWGQAWFVDQGE 187

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWF   Q+     + R+     A  +I   LSD  LSLD AD+ +ID+P
Sbjct: 188 RLGRTYNAFTSRWFKRIQLPGQQWS-RFEPLGFAHLQIPLALSDVTLSLDAADWFDIDEP 246

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I     V LP      YH  ++EL+ +L    IEA N+A+KT+K LQ+A+GA+Y D+ ++
Sbjct: 247 IHNVINVELPAKARAHYHAMEKELFLELGESAIEALNAAAKTIKILQIASGAIYSDDNRN 306

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD KI+ALE I+ ++   P++VAYH+  DL RL KAFP+G+ LD +P T+ +WN G
Sbjct: 307 WTEIHDAKIQALESIVNESGGTPVLVAYHWKHDLERLLKAFPKGKNLDANPRTLTDWNNG 366

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIPLLFAHPASCGHGLNLQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 367 KIPLLFAHPASCGHGLNLQDGGNILVFFSHWWDLEQYQQIIERIGPTRQAQAGHNRPVFI 426

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           ++++A++T+DE+V++R  +K  IQDLLL A+K++
Sbjct: 427 HHIVAKDTLDEVVMERRNSKRAIQDLLLEAMKRK 460


>gi|170729638|ref|YP_001775071.1| hypothetical protein Xfasm12_0427 [Xylella fastidiosa M12]
 gi|167964431|gb|ACA11441.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 472

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 237/457 (51%), Positives = 322/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++NL WLV+  +  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQDADIYCINYDNLKWLVEFYQDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PN L DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALAKHVHTKVERYIGLTGTPAPNRLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F  RWF   QIGS   AVR      A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFSDRWFRAVQIGSDPHAVRLVPAPNASQEIQDKIRDLCLSLDPHAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP+   + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPEHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK+P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKNPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHTR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|15837282|ref|NP_297970.1| hypothetical protein XF0680 [Xylella fastidiosa 9a5c]
 gi|9105562|gb|AAF83490.1|AE003912_2 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 472

 Score =  491 bits (1264), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 235/457 (51%), Positives = 320/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  +VD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTMVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++NL WL +     WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQDADIYCINYDNLKWLAEFYGDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALAKHVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR      A KE++ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRVVQIGSDPHAVRLVPTPNASKEMQDKIRDLCLSLDPQAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   ++E++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQEMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ RLQ+AFP+GR LD+ P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHEIIEEAAGMPVLVAYHFKSDVTRLQRAFPKGRVLDQHPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ++ERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIVERIGPTRQAQAGHDR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A NT+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAANTVDELVMARRESKREVQDLLLEAVKR 457


>gi|28199029|ref|NP_779343.1| hypothetical protein PD1137 [Xylella fastidiosa Temecula1]
 gi|182681751|ref|YP_001829911.1| SNF2-related protein [Xylella fastidiosa M23]
 gi|28057127|gb|AAO28992.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|182631861|gb|ACB92637.1| SNF2-related protein [Xylella fastidiosa M23]
 gi|307580180|gb|ADN64149.1| SNF2-related protein [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 472

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 236/457 (51%), Positives = 321/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++ L WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDTLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALA     + ER++ LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALATHVHTKVERYVGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR+     A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAMQIGSDPHAVRFVPTPHASQEIQDKIRDICLSLDPHAYFDLC 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKHPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHTR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|71899887|ref|ZP_00682035.1| SNF2-related [Xylella fastidiosa Ann-1]
 gi|71730327|gb|EAO32410.1| SNF2-related [Xylella fastidiosa Ann-1]
          Length = 472

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 236/457 (51%), Positives = 321/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++ L WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDTLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALA     + ER++ LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALATHVHTKVERYVGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR+     A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGAHFKAFIDRWFRAVQIGSDPHAVRFVPTPHASQEIQDKIRDICLSLDPHAYFDLC 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKHPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHTR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|71901494|ref|ZP_00683581.1| SNF2-related [Xylella fastidiosa Ann-1]
 gi|71728750|gb|EAO30894.1| SNF2-related [Xylella fastidiosa Ann-1]
          Length = 464

 Score =  488 bits (1256), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 237/458 (51%), Positives = 321/458 (70%), Gaps = 4/458 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++NL WLV+  K  W F 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDNLKWLVEFYKDRWSFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALA     + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALATHVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F  RWF   QIGS   AVR      A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFSDRWFRAMQIGSDPHAVRLVPTPHASQEIQDKIRDICLSLDPHAYFDLC 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKHPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LFAHPAS GHGLNLQ GGNILVFF  WWDLE++QQ+IERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILVFFGHWWDLEQYQQIIERIGPTRQAQAGHTR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
            VF+++++A  T+DELV+ R  +K  +QDLLL A++++
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVRRK 458


>gi|331648305|ref|ZP_08349394.1| putative protein p41 [Escherichia coli M605]
 gi|331042854|gb|EGI14995.1| putative protein p41 [Escherichia coli M605]
          Length = 464

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/456 (51%), Positives = 324/456 (71%), Gaps = 5/456 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVW 62
           P+Q  I++  +D  RC IWA MG GKTV+ LT L  + + G ++   LV+APLRVA S W
Sbjct: 9   PYQDLIINHEIDIHRCNIWAGMGMGKTVATLTTLEDLFMAGSETQPALVLAPLRVAASTW 68

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +W +  ++ +  I G  K R+  L  + A ++ IN++NL WLV+EL   WPF T+
Sbjct: 69  PDEALKWGHLRNIEVQPIVGNAKARSAALANSNASVFTINYDNLVWLVEELGERWPFGTV 128

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR G K A AL K A +  +R+I LTGTP+PNGL+DLWGQ+WF+D+G+
Sbjct: 129 IPDESTRLKSFRLRGGGKRAAALGKVAHKYVQRWINLTGTPAPNGLVDLWGQLWFVDQGQ 188

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWFN+ Q        +      +Q EI+  L+D  LSLD AD+ +I  P
Sbjct: 189 RLGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFAHSQAEIQRALADVTLSLDAADWFDIKDP 247

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I    +V +P    +QY + ++E++ +L GE IEA N+A+KT+KCLQ+A+GAVY D+   
Sbjct: 248 IHNVIRVDMPPKARQQYREMEKEMFLELNGEGIEAPNAAAKTLKCLQIASGAVYTDDTGS 307

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD K++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN G
Sbjct: 308 WSELHDTKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSG 367

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIP+LFAHPAS  HGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 368 KIPVLFAHPASASHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFI 427

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           +++IA +T+DE+V++R  +K T+QD+LLNA+KK  I
Sbjct: 428 HHIIAADTMDEMVMERRNSKRTVQDILLNAMKKRGI 463


>gi|260845245|ref|YP_003223023.1| putative phage-related DNA helicase [Escherichia coli O103:H2 str.
           12009]
 gi|257760392|dbj|BAI31889.1| predicted phage-related DNA helicase [Escherichia coli O103:H2 str.
           12009]
          Length = 464

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/456 (51%), Positives = 323/456 (70%), Gaps = 5/456 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVW 62
           P+Q  I++  +D  RC IWA MG GKTV+ LT L  + + G ++   LV+APLRVA S W
Sbjct: 9   PYQDLIINHEIDIMRCNIWAGMGMGKTVATLTTLEDLFMAGAETRPALVLAPLRVAASTW 68

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +W +  ++ +  I G  K R+  L  + A ++ IN++NL WLV+EL   WPF T+
Sbjct: 69  PDEAVKWGHLRNIEVQSIVGNAKARSAALANSNASVFTINYDNLVWLVEELGERWPFGTV 128

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR G K A AL K A +   R+I LTGTP+PNGL+DLWGQ WF+D+G+
Sbjct: 129 IPDESTRLKSFRLRGGGKRAAALGKVAHKYVRRWINLTGTPAPNGLVDLWGQAWFVDQGQ 188

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWFN+ Q        +      +Q EI+  L+D  LSLD AD+ +I  P
Sbjct: 189 RLGRTYGAFTSRWFNSMQFPGQ-SWTKLEPFAHSQGEIQRALADVTLSLDAADWFDIKDP 247

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I    +V +P    +QY + ++E++ +L GE IEA N+A+KT+KCLQ+A+GAVY D+   
Sbjct: 248 IHNVIRVDMPPKARQQYREMEKEMFLELNGEGIEAPNAAAKTLKCLQIASGAVYTDDTGS 307

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD K++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN G
Sbjct: 308 WSELHDTKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSG 367

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIP+LFAHPAS GHGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 368 KIPVLFAHPASAGHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFI 427

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           +++IA +T+DE+V++R  +K T+QD+LL+A+KK  I
Sbjct: 428 HHIIAADTMDEMVMERRNSKRTVQDILLDAMKKRGI 463


>gi|191174014|ref|ZP_03035531.1| dead box helicase [Escherichia coli F11]
 gi|190905705|gb|EDV65327.1| dead box helicase [Escherichia coli F11]
 gi|324014343|gb|EGB83562.1| SNF2 domain protein [Escherichia coli MS 60-1]
          Length = 464

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/456 (50%), Positives = 324/456 (71%), Gaps = 5/456 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVW 62
           P+Q  I++  +D  RC IWA MG GKTV+ LT L  + + G ++   LV+APLRVA S W
Sbjct: 9   PYQDLIINHEIDIHRCNIWAGMGMGKTVATLTTLEDLFMAGSETQPALVLAPLRVAASTW 68

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +W +  ++ +  I G  K R+  L  + A ++ IN++NL WLV+EL   WPF T+
Sbjct: 69  PDEALKWGHLRNIEVQPIVGNAKARSAALANSNASVFTINYDNLVWLVEELGERWPFGTV 128

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR G K A AL K A +  +R+I LTGTP+PNGL+DLWGQ+WF+D+G+
Sbjct: 129 IPDESTRLKSFRLRGGGKRAAALGKVAHKYVQRWINLTGTPAPNGLVDLWGQLWFVDQGQ 188

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWFN+ Q        +      +  EI+  L+D  LSLD AD+ +I  P
Sbjct: 189 RLGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFAHSHAEIQRALADVTLSLDAADWFDIKDP 247

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I    +V +P    +QY + ++E++ +L GE IEA N+A+KT+KCLQ+A+GAVY D+   
Sbjct: 248 IHNVIRVDMPPKARQQYREMEKEMFLELNGEGIEAPNAAAKTLKCLQIASGAVYTDDTGS 307

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD K++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN G
Sbjct: 308 WSELHDTKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSG 367

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIP+LFAHPAS GHGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 368 KIPVLFAHPASAGHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFI 427

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           +++IA +T+DE+V++R  +K T+QD+LL+A+KK  I
Sbjct: 428 HHIIAADTMDEMVMERRNSKRTVQDILLDAMKKRGI 463


>gi|331654021|ref|ZP_08355022.1| putative protein p41 [Escherichia coli M718]
 gi|331048870|gb|EGI20946.1| putative protein p41 [Escherichia coli M718]
          Length = 465

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/456 (50%), Positives = 323/456 (70%), Gaps = 5/456 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVW 62
           P+Q  I++  +D  RC IWA MG GKTV+ LTAL  + + G ++   LV+APLRVA + W
Sbjct: 10  PYQDLIINHQIDIMRCNIWAGMGMGKTVATLTALEDLFMAGAETRPALVLAPLRVAANTW 69

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +W +  ++ +  I G  K R+  L  + A ++ IN++NL WLV+EL   WPF  +
Sbjct: 70  PDEAVKWGHLRNIEVQPIVGNAKARSTALANSNASVFTINYDNLVWLVEELGERWPFGIV 129

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR G K A AL K A +   R+I LTGTP+PNGL+DLWGQ WF+D+G+
Sbjct: 130 IPDESTRLKSFRLRGGGKRAAALGKVAHKYVRRWINLTGTPAPNGLVDLWGQSWFVDQGQ 189

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWFN+ Q        +      +Q EI+  L+D  LSLD AD+ +I  P
Sbjct: 190 RLGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFAHSQGEIQRALADVTLSLDAADWFDIKDP 248

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I    +V +P    +QY + ++E++ +L GE IEA N+A+KT+KCLQ+A+GAVY D+   
Sbjct: 249 IHNVIRVDMPPKARQQYREMEKEMFLELNGEGIEAPNAAAKTLKCLQIASGAVYTDDTGS 308

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD K++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN G
Sbjct: 309 WSELHDTKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSG 368

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIP+LFAHPAS GHGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 369 KIPVLFAHPASAGHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFI 428

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           +++IA +T+DE+V++R  +K T+QD+LL+A+KK  I
Sbjct: 429 HHIIAADTMDEMVMERRNSKRTVQDILLDAMKKRGI 464


>gi|212499736|ref|YP_002308544.1| DEAD box helicase [Bacteriophage APSE-2]
 gi|238898727|ref|YP_002924408.1| APSE-2 prophage; DEAD box helicase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|75906050|gb|ABA29396.1| DEAD box helicase [Bacteriophage APSE-2]
 gi|211731705|gb|ACJ10193.1| DEAD box helicase [Bacteriophage APSE-2]
 gi|229466486|gb|ACQ68260.1| APSE-2 prophage; DEAD box helicase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 460

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/454 (51%), Positives = 316/454 (69%), Gaps = 5/454 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVW 62
           P+Q  I++ +LD KR  +WA MG GKT + LTAL  ++L G   K  LV+APLRVAQS W
Sbjct: 8   PYQNLIINHLLDIKRSNVWAGMGMGKTAATLTALENLYLSGSETKPTLVLAPLRVAQSTW 67

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLK-TPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +WS+  ++ +  I G  K R   LK T A ++ +N++NL WLV  L  TWPF TI
Sbjct: 68  PDEALKWSHLRNIEVQPIIGNSKARIAALKNTHASVFTVNYDNLVWLVDILGDTWPFGTI 127

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR+G K   A+AK A +S  R++ LTGTPSPNGL+DLWGQ WF+D+G+
Sbjct: 128 IADESTRLKSFRLRKGGKRTAAIAKIAHKSVHRWVNLTGTPSPNGLMDLWGQAWFVDQGE 187

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR   +F +RWFN  Q+     + R+     A  +I   LSD  LSL+ AD+ +I++P
Sbjct: 188 RLGRTHNAFTSRWFNRIQLPGQQWS-RFEPLGFAHLQIPLALSDVTLSLNAADWFDIEEP 246

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I     V LP      Y   ++EL+ +L    IEA N+A+KT+K LQ+A GA+Y D+  +
Sbjct: 247 IHNVINVTLPAKARAHYQAMEKELFLELGDSAIEALNAAAKTIKTLQIAAGAIYSDDNHN 306

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W  +HD KI+ALE I+ ++   P++VAYH+  DL RL KAFP+G+ LD +P T+  WN G
Sbjct: 307 WTAIHDAKIQALESIVNESGGTPVLVAYHWKHDLERLLKAFPKGKMLDANPQTLTNWNSG 366

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIPLLFAHPASCGHGLNLQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 367 KIPLLFAHPASCGHGLNLQDGGNILVFFSHWWDLEQYQQIIERIGPTRQAQAGHNRPVFI 426

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           ++++A++T+DE+V++R  +K  IQDLLL A+K++
Sbjct: 427 HHIVAKDTLDEVVMERRNSKRAIQDLLLEAMKRK 460


>gi|332160953|ref|YP_004297530.1| Dead box helicase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325665183|gb|ADZ41827.1| Dead box helicase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 432

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/431 (52%), Positives = 312/431 (72%), Gaps = 4/431 (0%)

Query: 29  GKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQ 86
           GKTV+ LT+L  + + G   K  LV+APLRVA+S W  EV +W++  ++ +  + GT ++
Sbjct: 2   GKTVATLTSLEDLFMSGSETKPALVLAPLRVARSTWPDEVDKWNHLRNIEMQPVVGTAQE 61

Query: 87  RTKVLK-TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
           R   L+ + A ++  N++NL WL++ L G WPF T++ DEST+LKSFRLR+G K A ALA
Sbjct: 62  RLAALRNSNASVFTTNYDNLVWLIETLNGEWPFGTVIADESTRLKSFRLRKGGKRAAALA 121

Query: 146 KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGA 205
           K A  S R++ L+GTP+PNGL DLWGQ WFLDKG+RLGR F +F  RWFN   IG+  G 
Sbjct: 122 KVAHRSGRWVNLSGTPAPNGLQDLWGQAWFLDKGQRLGRTFSAFTDRWFNRIPIGT-TGF 180

Query: 206 VRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELY 265
            +   +E AQ++++  L D  +SLD AD+ +ID+PI    +V L      QY + ++E++
Sbjct: 181 NKIEPRECAQQQMQDALRDVTISLDAADWFDIDEPIHSVVRVGLSPKARSQYKEMEKEMF 240

Query: 266 CDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPII 325
             +   +IEA N+ASKT+KCLQLA+GA+Y DE  +W E+HD K++ALE I+ +A+  P++
Sbjct: 241 LQIGDHDIEAMNAASKTMKCLQLASGAIYTDEAGNWTEIHDAKLQALESIVAEASGMPVL 300

Query: 326 VAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNIL 385
           VAYHF SDLARL KAFP+GR LD DP T ++WN G IP+LFAHPAS GHGLNLQ GGNIL
Sbjct: 301 VAYHFKSDLARLLKAFPKGRHLDADPQTQRDWNAGLIPVLFAHPASAGHGLNLQDGGNIL 360

Query: 386 VFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
            FFS WWDLE++QQ+IERIG TRQ QAG KR V++Y++IA++T+DELV +R  +K  +QD
Sbjct: 361 AFFSHWWDLEQYQQIIERIGPTRQAQAGHKRPVWIYHIIAEDTVDELVKERRDSKREVQD 420

Query: 446 LLLNALKKETI 456
           +LL A+KK  +
Sbjct: 421 ILLEAMKKRGL 431


>gi|15839118|ref|NP_299806.1| hypothetical protein XF2528 [Xylella fastidiosa 9a5c]
 gi|9107736|gb|AAF85326.1|AE004060_1 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 472

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/457 (51%), Positives = 323/457 (70%), Gaps = 4/457 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQ 59
           MNL P+Q  +VD+IL H RC ++  MG GKTV+ LTAL  + +  + + +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTMVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDVAPMLVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ ++V+ G+   R + L+  A +Y IN++NL WL +  +  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVAVVVGSAAARRRALEQDADIYCINYDNLKWLAEFYQDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
           T+V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 TVVADECSKLKGFRLRQGTRRARALAKYVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR      A KE++ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAVQIGSDPHAVRLVPAPNASKEMQDKIRDLCLSLDPQAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP+   + Y   ++E+   L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVVLPERARRLYKTMEQEMLIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LD+ P T+++
Sbjct: 301 TRQAWEVVHDAKLEALHEIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRVLDQHPDTLRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+LF HPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG  R
Sbjct: 361 WNAGNIPVLFVHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAGHDR 420

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 421 PVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 457


>gi|291283833|ref|YP_003500651.1| Superfamily II DNA/RNA helicases, SNF2 family [Escherichia coli
           O55:H7 str. CB9615]
 gi|290763706|gb|ADD57667.1| Superfamily II DNA/RNA helicases, SNF2 family [Escherichia coli
           O55:H7 str. CB9615]
          Length = 463

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/456 (50%), Positives = 323/456 (70%), Gaps = 5/456 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVW 62
           P+Q  I++  ++  R  IWA MG GKTV+ LT L  + + G ++   LV+APLRVA + W
Sbjct: 8   PYQDLIINHQIETLRGNIWAGMGMGKTVATLTTLEDLFMAGAETRPALVLAPLRVAANTW 67

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +W +  ++ +  I G  K R+  L  + A ++ IN++NL WLV+EL   WPF T+
Sbjct: 68  PDEAMKWGHLRNIEVQPIVGNAKARSAALANSNASVFTINYDNLVWLVEELGERWPFGTV 127

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR G K A AL+K A +   R+I LTGTP+PNGL+DLWGQ WF+D+G+
Sbjct: 128 IPDESTRLKSFRLRGGGKRAAALSKVAHKYVRRWINLTGTPAPNGLVDLWGQAWFVDQGQ 187

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWFN+ Q        +      +Q EI+  L+D  LSLD AD+ +I  P
Sbjct: 188 RLGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFAHSQAEIQRALADVTLSLDAADWFDIKAP 246

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I    +V +P    +QY + ++E++ +L GE IEA N+A+KT+KCLQ+A+GA+Y D+   
Sbjct: 247 IHNVIRVDMPPKARQQYREMEKEMFLELNGEGIEAPNAAAKTLKCLQIASGALYTDDTGS 306

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD K++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN G
Sbjct: 307 WSELHDTKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSG 366

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIP+LFAHPAS GHGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 367 KIPVLFAHPASAGHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFI 426

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           +++IA +T+DE+V++R  +K T+QD+LL+A+KK  I
Sbjct: 427 HHIIAADTMDEMVMERRNSKRTVQDILLDAMKKRGI 462


>gi|330862108|emb|CBX72272.1| putative protein p41 [Yersinia enterocolitica W22703]
          Length = 432

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/431 (52%), Positives = 311/431 (72%), Gaps = 4/431 (0%)

Query: 29  GKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQ 86
           GKTV+ LT+L  + + G   K  LV+APLRVA+S W  EV +W++  ++ +  + GT ++
Sbjct: 2   GKTVATLTSLEDLFMSGSETKPALVLAPLRVARSTWPDEVDKWNHLRNIEMQPVVGTAQE 61

Query: 87  RTKVLK-TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
           R   L+ + A ++  N++NL WL++ L G WPF T++ DEST+LKSFRLR+G K A ALA
Sbjct: 62  RLAALRNSNASVFTTNYDNLVWLIETLNGEWPFGTVIADESTRLKSFRLRKGGKRAAALA 121

Query: 146 KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGA 205
           K A  S R++ L+GTP+PNGL DLWGQ WFLDKG+RLGR F +F  RWFN   IG+  G 
Sbjct: 122 KVAHRSGRWVNLSGTPAPNGLQDLWGQAWFLDKGQRLGRTFSAFTDRWFNRIPIGT-TGF 180

Query: 206 VRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELY 265
            +   +E AQ++++  L D  +SLD AD+ +ID+PI    +V L      QY + ++E++
Sbjct: 181 NKIEPRECAQQQMQDALRDVTISLDAADWFDIDEPIHSVVRVGLSPKARSQYKEMEKEMF 240

Query: 266 CDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPII 325
             +   +IEA N+ASKT+KCLQLA+GA+Y DE  +W E+HD K++ALE I+ +A+  P++
Sbjct: 241 LQIGDHDIEAMNAASKTMKCLQLASGAIYTDEAGNWTEIHDAKLQALESIVAEASGMPVL 300

Query: 326 VAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNIL 385
           VAYHF SDL RL KAFP+GR LD DP T ++WN G IP+LFAHPAS GHGLNLQ GGNIL
Sbjct: 301 VAYHFKSDLTRLLKAFPKGRHLDADPQTQRDWNAGLIPVLFAHPASAGHGLNLQDGGNIL 360

Query: 386 VFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
            FFS WWDLE++QQ+IERIG TRQ QAG KR V++Y++IA++T+DELV +R  +K  +QD
Sbjct: 361 AFFSHWWDLEQYQQIIERIGPTRQAQAGHKRPVWIYHIIAEDTVDELVKERRDSKREVQD 420

Query: 446 LLLNALKKETI 456
           +LL A+KK  +
Sbjct: 421 ILLEAMKKRGL 431


>gi|188492213|ref|ZP_02999483.1| dead box helicase [Escherichia coli 53638]
 gi|188487412|gb|EDU62515.1| dead box helicase [Escherichia coli 53638]
 gi|332088071|gb|EGI93196.1| DEAD box helicase [Shigella boydii 5216-82]
          Length = 464

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/456 (50%), Positives = 323/456 (70%), Gaps = 5/456 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVW 62
           P+Q  I++  ++  R  IWA MG GKTV+ LT L  + + G ++   LV+APLRVA S W
Sbjct: 9   PYQDLIINHQIETLRGNIWAGMGMGKTVATLTTLEDLFMAGTETRPALVLAPLRVAASTW 68

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +W +  ++ +  I G  K R+  L  + A ++ IN++NL WLV+EL   WPF T+
Sbjct: 69  PDEALKWEHLRNIEVQPIVGNAKARSTALANSNASVFTINYDNLVWLVEELGEQWPFGTV 128

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR G K A AL K A +   R+I LTGTP+PNGL+DLWGQ WF+D+G+
Sbjct: 129 IPDESTRLKSFRLRGGGKRAAALGKVAHKYVRRWINLTGTPAPNGLVDLWGQSWFVDQGQ 188

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWFN+ Q        +      +Q EI+  L+D  LSLD AD+ ++ +P
Sbjct: 189 RLGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFAHSQAEIQRALADVTLSLDAADWFDVREP 247

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           +    +V +P    +QY + ++E++ +L GE+IEA N+A+KT KCLQ+A+GAVY D+   
Sbjct: 248 VHNVVRVDMPPKARQQYREMEKEMFLELNGESIEAPNAAAKTQKCLQIASGAVYTDDTGS 307

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD K++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN G
Sbjct: 308 WSELHDTKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSG 367

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIP+LFAHPAS GHGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 368 KIPVLFAHPASAGHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFI 427

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           +++IA +T+DE+V++R  +K T+QD+LL+A+KK  I
Sbjct: 428 HHIIAADTMDEMVMERRNSKRTVQDILLDAMKKRGI 463


>gi|218555139|ref|YP_002388052.1| hypothetical protein ECIAI1_2669 [Escherichia coli IAI1]
 gi|218361907|emb|CAQ99507.1| conserved hypothetical protein from bacteriophage origin
           [Escherichia coli IAI1]
          Length = 464

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/455 (51%), Positives = 318/455 (69%), Gaps = 12/455 (2%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVWT 63
           HQT I+       R  IWA MG GKTV+ LT L  + + G ++   LV+APLRVA S W 
Sbjct: 17  HQTNIL-------RGNIWAGMGMGKTVATLTTLEDLFMAGAETQPALVLAPLRVAASTWP 69

Query: 64  SEVQRWSNFSHMNISVITGTVKQRTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATIV 122
            E  +W +  ++ +  I G  K R+  L    A ++ IN++NL WLV+EL   WPF TI+
Sbjct: 70  DEALKWGHLRNIEVQPIVGNAKARSAALANNNASVFTINYDNLVWLVEELGERWPFGTII 129

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
            DEST+LKSFRLR G K A AL K A +   R+I LTGTP+PNGL+DLWGQ WF+D+G+R
Sbjct: 130 PDESTRLKSFRLRGGGKRAAALGKVAHKYVRRWINLTGTPAPNGLVDLWGQAWFVDQGQR 189

Query: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
           LGR + +F +RWFN+ Q        +      +Q EI+  L+D  LSLD AD+ +I  PI
Sbjct: 190 LGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFAHSQGEIQRALADVTLSLDAADWFDIKDPI 248

Query: 242 LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
               +V +P    +QY + ++E++ +L GE IEA N+A+KT+KCLQ+A+GAVY D+   W
Sbjct: 249 HNVIRVDMPPKARQQYREMEKEMFLELNGEGIEAPNAAAKTLKCLQIASGAVYTDDTGSW 308

Query: 302 KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGK 361
            E+HD K++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN GK
Sbjct: 309 SELHDTKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSGK 368

Query: 362 IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY 421
           IP+LFAHPAS GHGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF++
Sbjct: 369 IPVLFAHPASAGHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFIH 428

Query: 422 YLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           ++IA +T+DE+V++R  +K T+QD+LL+A+KK  I
Sbjct: 429 HIIAADTMDEMVMERRNSKRTVQDILLDAMKKRGI 463


>gi|194429287|ref|ZP_03061814.1| dead box helicase [Escherichia coli B171]
 gi|194412695|gb|EDX28990.1| dead box helicase [Escherichia coli B171]
          Length = 464

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 232/455 (50%), Positives = 320/455 (70%), Gaps = 12/455 (2%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVWT 63
           HQT I+       R  IWA MG GKTV+ LTAL  + + G ++   LV+APLRVA S W 
Sbjct: 17  HQTNIL-------RGNIWAGMGMGKTVATLTALEDLFMAGAETCPALVLAPLRVAASTWP 69

Query: 64  SEVQRWSNFSHMNISVITGTVKQRTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATIV 122
            E  +W +  ++ +  I G  K R+  L  + A ++ IN++NL WL++EL   WPF T++
Sbjct: 70  DEALKWGHLRNIEVQPIIGNAKARSMALTNSNASVFTINYDNLVWLIEELGERWPFGTVI 129

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
            DEST+LKSFRLR G K A AL K A +   R+I LTGTP+PNGL+DLWGQ WF+D+G+R
Sbjct: 130 PDESTRLKSFRLRGGGKRAAALGKVAHKYVRRWINLTGTPAPNGLVDLWGQSWFVDQGQR 189

Query: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
           LGR + +F +RWFN+ Q        +      +Q EI+  L+D  LSLD AD+ +I  PI
Sbjct: 190 LGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFAHSQGEIQRALADVTLSLDAADWFDIKDPI 248

Query: 242 LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
               +V +P    +QY + ++E++ +L GE IEA N+A+KT+KCLQ+A+GAVY D+   W
Sbjct: 249 HNVIRVDMPPKARQQYREMEKEMFLELNGEGIEAPNAAAKTLKCLQIASGAVYTDDTGSW 308

Query: 302 KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGK 361
            E+HD K++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN GK
Sbjct: 309 SELHDTKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSGK 368

Query: 362 IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY 421
           IP+LFAHPAS GHGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF++
Sbjct: 369 IPVLFAHPASAGHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFIH 428

Query: 422 YLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           ++IA +T+DE+V++R  +K T+QD+LL+A+KK  I
Sbjct: 429 HIIAADTMDEMVMERRNSKRTVQDILLDAMKKRGI 463


>gi|295096884|emb|CBK85974.1| Superfamily II DNA/RNA helicases, SNF2 family [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 466

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/456 (50%), Positives = 320/456 (70%), Gaps = 5/456 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVW 62
           P+Q  I++  LD  RC IWA MG GKTV+ LT L  + + G ++   LV+APLRVA S W
Sbjct: 11  PYQNLIINHELDTLRCNIWAGMGMGKTVATLTTLEDLFMAGAETQPALVLAPLRVAASTW 70

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATI 121
             E  +W +  ++ +  I G  K R   L      ++ IN++NL WLV+EL G WPF T+
Sbjct: 71  PDEAVKWGHLRNIEVQPIVGNSKARAAALANSNASVFTINYDNLVWLVEELGGRWPFGTV 130

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR G K A AL K A +   R++ LTGTP+PNGL+DLWGQ WF+D+G+
Sbjct: 131 IPDESTRLKSFRLRGGGKRAAALGKVAHKHVRRWMNLTGTPAPNGLVDLWGQAWFVDQGQ 190

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWFN+ Q        +      +Q EI+  L+D  +SLD AD+ +I +P
Sbjct: 191 RLGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFAHSQDEIQRALADVTISLDAADWFDIKEP 249

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I    +V +P    + Y + ++E++ +L G+ IEA N+A+KTVKCLQ+A+GAVY D+   
Sbjct: 250 IHNVIRVDMPPKARQHYREMEKEMFLELNGKGIEAPNAAAKTVKCLQIASGAVYTDDAGS 309

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD K++AL+ I+ +A  AP++VAYH+  DL RL+KAFP+GR LD+DP T+++WN G
Sbjct: 310 WSELHDAKLQALDSILTEAAGAPVLVAYHWKHDLERLRKAFPKGRHLDQDPQTLRDWNAG 369

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIP+LFAHPAS GHGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 370 KIPVLFAHPASAGHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFI 429

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           +++IA  T+DE+V++R  +K  +QD+LL+A+KK  I
Sbjct: 430 HHIIATGTMDEMVMERRNSKRKVQDILLDAMKKRGI 465


>gi|211731857|gb|ACJ10155.1| DEAD box helicase [Bacteriophage APSE-3]
          Length = 440

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 228/434 (52%), Positives = 307/434 (70%), Gaps = 5/434 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVW 62
           P+Q  I++ +LD KR  +WA MG GKT + LTAL  ++L G   K  LV+APLRVAQS W
Sbjct: 8   PYQHLIINHLLDIKRSNVWAGMGMGKTAATLTALENLYLSGSETKPTLVLAPLRVAQSTW 67

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLK-TPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +WS+  ++ +  I G+ K R   LK T A ++ +N++NL WLV  L  TWPF TI
Sbjct: 68  PDEALKWSHLRNIEVQPIIGSAKARIAALKNTHASVFTVNYDNLVWLVDILGDTWPFGTI 127

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR+G K   ALAK A +S  R++ LTGTPSPNGL+DLWGQ WF+D+G+
Sbjct: 128 IADESTRLKSFRLRKGGKRTAALAKIAHKSVHRWVNLTGTPSPNGLMDLWGQAWFVDQGE 187

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR + +F +RWF   Q+     + R+     A  +I   LSD  LSLD AD+ +ID+P
Sbjct: 188 RLGRTYNAFTSRWFKRIQLPGQQWS-RFEPLGFAHLQIPLALSDVTLSLDAADWFDIDEP 246

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I     V LP      YH  ++EL+ +L    IEA N+A+KT+K LQ+A+GA+Y D+ ++
Sbjct: 247 IHNVINVELPAKARAHYHAMEKELFLELGESAIEALNAAAKTIKILQIASGAIYSDDNRN 306

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W E+HD KI+ALE I+ ++   P++VAYH+  DL RL KAFP+G+ LD +P T+ +WN G
Sbjct: 307 WTEIHDAKIQALESIVNESGGTPVLVAYHWKHDLERLLKAFPKGKNLDANPRTLTDWNNG 366

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIPLLFAHPASCGHGLNLQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 367 KIPLLFAHPASCGHGLNLQDGGNILVFFSHWWDLEQYQQIIERIGPTRQAQAGHNRPVFI 426

Query: 421 YYLIAQNTIDELVL 434
           ++++A++T+DE+V+
Sbjct: 427 HHIVAKDTLDEVVM 440


>gi|204927042|ref|ZP_03218244.1| dead box helicase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|204323707|gb|EDZ08902.1| dead box helicase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
          Length = 463

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/455 (50%), Positives = 318/455 (69%), Gaps = 5/455 (1%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVWT 63
           +Q  I++  +D  RC IWA MG GKTV+ LT L  + + G ++   LV+APLRVA S W 
Sbjct: 9   YQDLIINHEIDILRCNIWAGMGMGKTVATLTTLEDLFMAGAETQPALVLAPLRVAASTWP 68

Query: 64  SEVQRWSNFSHMNISVITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIV 122
            E  +W +  ++ +  I G  K R   L      ++ IN++NL WLV+EL G WPF T++
Sbjct: 69  DEAVKWGHLRNIEVQPILGNAKARAAALANSNASVFTINYDNLVWLVEELGGRWPFGTVI 128

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
            DEST+LKSFRLR G K A AL K A +   R++ LTGTP+PNGL+DLWGQ WF+D+G+R
Sbjct: 129 SDESTRLKSFRLRGGGKRAAALGKVAHKHVRRWMNLTGTPAPNGLVDLWGQAWFVDQGQR 188

Query: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
           LGR + +F +RWFN+ Q        +      +Q EI+  L+D  +SLD AD+ +I  PI
Sbjct: 189 LGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFAHSQDEIQRALADVTISLDAADWFDIKDPI 247

Query: 242 LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
               +V +P    +QY + ++E++ +L GE IEA N+A+KTVKCLQ+A+GAVY D+   W
Sbjct: 248 HNVIRVDMPPKARQQYREMEKEMFLELNGEGIEAPNAAAKTVKCLQIASGAVYTDDAGSW 307

Query: 302 KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGK 361
            E+HD K++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+ P T+++WN GK
Sbjct: 308 SELHDAKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQGPQTLRDWNAGK 367

Query: 362 IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY 421
           IP+LFAHPAS GHGLN+Q GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF++
Sbjct: 368 IPVLFAHPASAGHGLNMQDGGNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFIH 427

Query: 422 YLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
           ++I  +T+DE+V++R  +K T+QD+LL+A+KK  I
Sbjct: 428 HIITADTMDEMVMERRNSKRTVQDILLDAMKKRGI 462


>gi|323159216|gb|EFZ45206.1| DEAD box helicase [Escherichia coli E128010]
          Length = 435

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/435 (51%), Positives = 311/435 (71%), Gaps = 5/435 (1%)

Query: 26  MGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
           MG GKTV+ LTAL  + + G ++   LV+APLRVA S W  E  +W +  ++ +  I G 
Sbjct: 1   MGMGKTVATLTALEDLFMAGAETCPALVLAPLRVAASTWPDEALKWGHLRNIEVQPIIGN 60

Query: 84  VKQRTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTAR 142
            K R+  L  + A ++ IN++NL WL++EL   WPF T++ DEST+LKSFRLR G K A 
Sbjct: 61  AKARSMALTNSNASVFTINYDNLVWLIEELGERWPFGTVIPDESTRLKSFRLRGGGKRAA 120

Query: 143 ALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGS 201
           AL K A +   R+I LTGTP+PNGL+DLWGQ WF+D+G+RLGR + +F +RWFN+ Q   
Sbjct: 121 ALGKVAHKYVRRWINLTGTPAPNGLVDLWGQSWFVDQGQRLGRTYGAFTSRWFNSIQFPG 180

Query: 202 HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQ 261
                +      +Q EI+  L+D  LSLD AD+ +I  PI    +V +P    +QY + +
Sbjct: 181 Q-SWTKLEPFAHSQGEIQRALADVTLSLDAADWFDIKDPIHNVIRVDMPPKARQQYREME 239

Query: 262 RELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANA 321
           +E++ +L GE IEA N+A+KT+KCLQ+A+GAVY D+   W E+HD K++AL+ I+ +A  
Sbjct: 240 KEMFLELNGEGIEAPNAAAKTLKCLQIASGAVYTDDTGSWSELHDTKLQALDSILTEAAG 299

Query: 322 APIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYG 381
           AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN GKIP+LFAHPAS GHGLN+Q G
Sbjct: 300 APVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSGKIPVLFAHPASAGHGLNMQDG 359

Query: 382 GNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKS 441
           GNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF++++IA +T+DE+V++R  +K 
Sbjct: 360 GNILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFIHHIIAADTMDEMVMERRNSKR 419

Query: 442 TIQDLLLNALKKETI 456
           T+QD+LL+A+KK  I
Sbjct: 420 TVQDILLDAMKKRGI 434


>gi|211731851|gb|ACJ10150.1| DEAD box helicase [Bacteriophage APSE-4]
          Length = 442

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 226/436 (51%), Positives = 305/436 (69%), Gaps = 5/436 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVW 62
           P+Q  I++ +LD KR  +WA MG GKT + LTAL  ++L G   K  LV+APLRVAQS W
Sbjct: 8   PYQHLIINHLLDIKRSNVWAGMGMGKTAATLTALENLYLSGSETKPTLVLAPLRVAQSTW 67

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLK-TPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +WS+  ++ +  I G+ K R   LK T A ++ +N++NL WLV  L  TWPF TI
Sbjct: 68  PDEALKWSHLRNIEVQPIIGSAKARIAALKNTHASVFTVNYDNLVWLVDILGDTWPFGTI 127

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR+G K   ALAK A +   R++ LTGTPSPNGL+DLWGQ WF+D+G+
Sbjct: 128 IADESTRLKSFRLRKGGKRTTALAKIAHKCVHRWVNLTGTPSPNGLMDLWGQAWFVDQGE 187

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR   +F +RWFN  Q+     + R+     A  +I   LSD  LSLD AD+ +I++P
Sbjct: 188 RLGRTHNAFTSRWFNRIQLPGQQWS-RFEPLGFAHLQIPLALSDVTLSLDAADWFDIEEP 246

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I     V LP      YH  ++EL+ +L    IEA N+A+KT+K LQ+A+GA+Y D+  +
Sbjct: 247 IHNVINVELPAKARAHYHAMEKELFLELGESAIEALNAAAKTIKILQIASGAIYSDDNHN 306

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W  +HD KI+ALE I+ ++   P++VAYH+  DL RL KAFP+G+ LD +P T+  WN G
Sbjct: 307 WTAIHDAKIQALESIVNESGGTPVLVAYHWKHDLERLLKAFPKGKMLDTNPQTLTNWNSG 366

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           K+PLLFAHPASCGHGLNLQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 367 KVPLLFAHPASCGHGLNLQDGGNILVFFSHWWDLEQYQQIIERIGPTRQAQAGHNRPVFI 426

Query: 421 YYLIAQNTIDELVLQR 436
           ++++A++T+DE+V++R
Sbjct: 427 HHIVAKDTLDEVVMER 442


>gi|211731841|gb|ACJ10144.1| DEAD box helicase [Bacteriophage APSE-5]
          Length = 440

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/434 (51%), Positives = 304/434 (70%), Gaps = 5/434 (1%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVW 62
           P+Q  I++ +LD KR  +WA MG GKT + LTAL  ++L G   K  LV+APLRVAQS W
Sbjct: 8   PYQHLIINHLLDIKRSNVWAGMGMGKTAATLTALENLYLSGSETKPTLVLAPLRVAQSTW 67

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLK-TPAVLYVINFENLGWLVQELKGTWPFATI 121
             E  +W++  ++ +  I G+ K R   LK T A ++ +N++NL WLV  L  TWPF TI
Sbjct: 68  PDEALKWNHLRNIEVQPIIGSAKARIAALKNTHASVFTVNYDNLVWLVDILGDTWPFGTI 127

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           + DEST+LKSFRLR+G K   ALAK A +S  R++ LTGTPSPNGL+DLWGQ WF+D+G+
Sbjct: 128 IADESTRLKSFRLRKGGKRTAALAKIAHKSVHRWVNLTGTPSPNGLMDLWGQAWFVDQGE 187

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR   +F +RWFN  Q+     + R+     A  +I+  LSD  LSL+ AD+ +I++P
Sbjct: 188 RLGRTHNAFTSRWFNRIQLPGQQWS-RFEPLGFAHLQIQLALSDVTLSLNAADWFDIEEP 246

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           I     V LP      Y   ++EL+ +L    IEA N+A+KT+K LQ+A+GA+Y D+  +
Sbjct: 247 IHNVINVELPAKARAHYQAMEKELFLELGDSAIEALNAAAKTIKNLQIASGAIYSDDNHN 306

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
           W  +HD KI+ALE I+ ++   P++VAYH+  DL RL KAFP+G+ LD +P T+  WN G
Sbjct: 307 WTAIHDAKIQALESIVNESGGTPVLVAYHWKHDLERLLKAFPKGKMLDANPQTLTNWNSG 366

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIPLLFAHPASCGHGLNLQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+
Sbjct: 367 KIPLLFAHPASCGHGLNLQDGGNILVFFSHWWDLEQYQQIIERIGPTRQAQAGHNRPVFI 426

Query: 421 YYLIAQNTIDELVL 434
           ++++A++T+DE+V+
Sbjct: 427 HHIVAKDTLDEVVM 440


>gi|323173123|gb|EFZ58754.1| DEAD box helicase [Escherichia coli LT-68]
          Length = 433

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 221/432 (51%), Positives = 307/432 (71%), Gaps = 5/432 (1%)

Query: 29  GKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQ 86
           GKTV+ LT L  + + G ++   LV+APLRVA S W  E  +W +  ++ +  I G  K 
Sbjct: 2   GKTVATLTTLEDLFMAGAETRPALVLAPLRVAASTWPDEALKWEHLRNIEVQPIVGNAKA 61

Query: 87  RTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
           R+  L  + A ++ IN++NL WLV+EL   WPF T++ DEST+LKSFRLR G K A AL 
Sbjct: 62  RSTALANSNASVFTINYDNLVWLVEELGERWPFGTVIPDESTRLKSFRLRGGGKRAAALG 121

Query: 146 KPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIG 204
           K A +   R+I LTGTP+PNGL+DLWGQ WF+D+G+RLGR + +F +RWFN+ Q      
Sbjct: 122 KVAHKYVRRWINLTGTPAPNGLVDLWGQAWFVDQGQRLGRTYGAFTSRWFNSIQFPGQ-S 180

Query: 205 AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQREL 264
             +      +Q EI+  L+D  LSLD AD+ +I  PI    +V +P    +QY + ++E+
Sbjct: 181 WTKLEPFAHSQAEIQRALADVTLSLDAADWFDIKAPIHNVIRVDMPPKARQQYREMEKEM 240

Query: 265 YCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPI 324
           + +L GE IEA N+A+KT+KCLQ+A+GAVY D+   W E+HD K++AL+ I+ +A  AP+
Sbjct: 241 FLELNGEGIEAPNAAAKTLKCLQIASGAVYTDDAGSWSELHDTKLQALDSILTEAAGAPV 300

Query: 325 IVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNI 384
           +VAYH+  DL RL KAFP+GR LD+DP T+++WN GKIP+LFAHPAS GHGLN+Q GG I
Sbjct: 301 LVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSGKIPVLFAHPASAGHGLNMQDGGYI 360

Query: 385 LVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQ 444
           LVFFS WWDLE++QQ+IERIG TRQ QAG  R VF++++IA +T+DE+V++R  +K T+Q
Sbjct: 361 LVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFIHHIIAADTMDEMVMERRNSKRTVQ 420

Query: 445 DLLLNALKKETI 456
           D+LL+A+KK  I
Sbjct: 421 DILLDAMKKRGI 432


>gi|238920126|ref|YP_002933641.1| hypothetical protein NT01EI_2232 [Edwardsiella ictaluri 93-146]
 gi|238869695|gb|ACR69406.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 433

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 221/432 (51%), Positives = 306/432 (70%), Gaps = 5/432 (1%)

Query: 29  GKTVSVLTALSYIHLWG--EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQ 86
           GKTV+ LT L  + + G   +  LV+APLRVA S W  E  +W +  ++ +  I G  K 
Sbjct: 2   GKTVATLTTLEDLFMAGVETQPALVLAPLRVAASTWPDEAVKWGHLRNIEMQPIVGNAKA 61

Query: 87  RTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
           R   L      ++ IN++NL WLV+E+ G WPF T++ DEST+LKSFRLR G K A AL 
Sbjct: 62  RAAALANSNASVFTINYDNLVWLVEEVGGRWPFGTVIPDESTRLKSFRLRGGGKRAAALG 121

Query: 146 KPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIG 204
           K A +   R++ LTGTP+PNGL+DLWGQ WF+D+G+RLGR + +F +RWFN+ Q      
Sbjct: 122 KVAHKHVRRWMNLTGTPAPNGLVDLWGQAWFVDQGQRLGRTYGAFTSRWFNSIQFPGQ-S 180

Query: 205 AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQREL 264
             +      +Q EI+  L+D  +SLD AD+ +I +PI    +V +P    +QY + ++E+
Sbjct: 181 WTKLEPFAHSQDEIQRALADVTISLDAADWFDIKEPIHNVIRVDMPPKARQQYREMEKEM 240

Query: 265 YCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPI 324
           + +L GE IEA N+A+KTVKCLQ+A+GAVY D+   W E+HD K++AL+ I+ +A  AP+
Sbjct: 241 FLELNGEGIEAPNAAAKTVKCLQIASGAVYTDDTGSWSELHDAKLQALDSILTEAAGAPV 300

Query: 325 IVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNI 384
           +VAYH+  DL RL KAFP+GR LD+DP T+++WN GKIP+LFAHPAS GHGLN+Q GGNI
Sbjct: 301 LVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNAGKIPVLFAHPASAGHGLNMQDGGNI 360

Query: 385 LVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQ 444
           LVFFS WWDLE++QQ+IERIG TRQ QAG  R VF++++IA +T+DE+V++R  +K T+Q
Sbjct: 361 LVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFIHHIIAADTMDEMVMERRNSKRTVQ 420

Query: 445 DLLLNALKKETI 456
           DLLL+A+KK  I
Sbjct: 421 DLLLDAMKKRGI 432


>gi|48697218|ref|YP_024948.1| putative helicase protein [Burkholderia phage BcepC6B]
 gi|47779024|gb|AAT38387.1| gp28 [Burkholderia phage BcepC6B]
          Length = 459

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 226/457 (49%), Positives = 303/457 (66%), Gaps = 27/457 (5%)

Query: 22  IWASMGSGKTVSVLTALSYIHLWGEKSV--LVIAPLRVAQSVWTSEVQRWSNFSHMNISV 79
           +WA MG GKTVS L+AL   + +G +++  LV APLRVAQS W  E ++W + S M +  
Sbjct: 1   MWAGMGLGKTVSTLSALETNYHFGIETMPTLVCAPLRVAQSTWPDECEKWEHLSGMEVVP 60

Query: 80  ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT---WPFATIVVDESTKLKSFRLRQ 136
           I G   +R   L+  A ++ IN+ENL WL+   K     WPF  ++ DESTKLKS R+  
Sbjct: 61  IIGDAGRRAMQLRRDAPVFSINYENLPWLIDWFKHNPRPWPFGRVIADESTKLKSTRVSN 120

Query: 137 --------------GSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
                         GS   RALA+ A  +   ++ LTGTPSPNGL DLWGQ WF+D G+R
Sbjct: 121 QRSKRGTEFVKKSGGSVRGRALAEVAHTKVHGWVNLTGTPSPNGLQDLWGQQWFVDGGQR 180

Query: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
           LGR F +F  RWF +   G+     R  A   AQ EI+  L+DC +SLD AD+ ++D+PI
Sbjct: 181 LGRSFSAFEERWFQSVPGGNGYRQTRPLAH--AQDEIQKALADCTISLDPADWFDLDEPI 238

Query: 242 LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH- 300
           +    V LP    + Y   +R+++ ++    IEA N+ASKT+KCLQLANGAVY  E+   
Sbjct: 239 VRPVYVELPAAARRLYRDMERQMFMEIDDSPIEAMNAASKTMKCLQLANGAVYKQEDDGS 298

Query: 301 ----WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
               W EVHD K++ALE I+E+A   P++VAYHF SDLARLQ+AFP+GR LD++P TI++
Sbjct: 299 DTAPWHEVHDLKLQALEEIVEEAAGMPVLVAYHFKSDLARLQRAFPRGRQLDQNPQTIRD 358

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN GKIP++FAHPAS GHGLNLQ GGNIL  F  WW+LEE+ Q++ERIG  RQ QAG +R
Sbjct: 359 WNAGKIPVMFAHPASAGHGLNLQDGGNILAVFGHWWNLEEYLQIVERIGPVRQLQAGHRR 418

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            VF+Y +IA++TIDE V++R  TK  +QD+LL+A+K+
Sbjct: 419 PVFIYPIIARDTIDEDVVERRETKRAVQDILLDAMKR 455


>gi|254780130|ref|YP_003064543.1| hypothetical protein CLIBASIA_00045 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039807|gb|ACT56603.1| hypothetical protein CLIBASIA_00045 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 205

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 254 MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE 313
           MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE
Sbjct: 1   MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALE 60

Query: 314 VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG 373
           VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG
Sbjct: 61  VIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG 120

Query: 374 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 433
           HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV
Sbjct: 121 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 180

Query: 434 LQRLRTKSTIQDLLLNALKKETIHV 458
           LQRLRTKSTIQDLLLNALKKETIHV
Sbjct: 181 LQRLRTKSTIQDLLLNALKKETIHV 205


>gi|71276170|ref|ZP_00652450.1| SNF2-related [Xylella fastidiosa Dixon]
 gi|71898329|ref|ZP_00680502.1| SNF2-related [Xylella fastidiosa Ann-1]
 gi|170730598|ref|YP_001776031.1| hypothetical protein Xfasm12_1485 [Xylella fastidiosa M12]
 gi|71163088|gb|EAO12810.1| SNF2-related [Xylella fastidiosa Dixon]
 gi|71731852|gb|EAO33910.1| SNF2-related [Xylella fastidiosa Ann-1]
 gi|167965391|gb|ACA12401.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 470

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 296/453 (65%), Gaps = 15/453 (3%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++NL WLV+  +  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQDADIYCINYDNLKWLVEFYQDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALAKHVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR      A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAVQIGSDPHAVRLVPAPNASQEIQDKIRDLCLSLDPHAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP+   + Y   +++++  L+ G  +EAFN+ SKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPEHAQRLYKAMEQDMFIALECGTEVEAFNATSKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK+P TI++
Sbjct: 301 TRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKNPDTIRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVT--------- 407
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WW    +  ++    V          
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWAQVRNGVLMRTCTVCGGSGTVPIS 420

Query: 408 -RQRQAGFKRAVFVYYLIAQNTIDELVLQRLRT 439
            R+R A   R V  Y +  +  + E +L++LR 
Sbjct: 421 DRKRAAALGRDVSTYCMRWRG-LYEWLLEKLRA 452


>gi|273810587|ref|YP_003344968.1| gp33 [Sodalis phage SO-1]
 gi|258619872|gb|ACV84125.1| gp33 [Sodalis phage SO-1]
          Length = 474

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 214/461 (46%), Positives = 294/461 (63%), Gaps = 15/461 (3%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG-----EKSVLVIAPLRVAQS 60
           +Q  I  +IL HKRC IWA+MGSGKT + + AL+ +   G     E  VLV+APLRVA  
Sbjct: 9   YQKLITAFILKHKRCNIWATMGSGKTGATMWALNKMFQTGVLSHHEDRVLVLAPLRVASG 68

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            W  E ++W  FS + +   TG  K R   L++ A +  +N++ + WLV      WPF  
Sbjct: 69  TWPPEQEKW-RFSSLLVVDGTGPEKDRIAALESDANVVCVNYDVVEWLVDYYGDAWPFTV 127

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKG 179
           +V DESTKLK +R +QGSK ARALA  A +  +R+I LTGTP+PNGL DLWGQ WF+D G
Sbjct: 128 VVADESTKLKGYRSKQGSKRARALAAIAHKHVKRWINLTGTPAPNGLKDLWGQTWFVDGG 187

Query: 180 KRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK 239
           +RLG  +++F  RWF +  +      +++   + ++KEI+ +LSD  L++D A+Y   DK
Sbjct: 188 ERLGSSYKAFTDRWFISKPVKPGSFTMQHAPLKNSEKEIQQRLSDVSLTVDAAEYFGCDK 247

Query: 240 PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEE- 298
           PI     V LP+   K Y +F+ EL+ +L+   +EA N+ASKT+KCLQLA+GAVY  +E 
Sbjct: 248 PIYTPVVVDLPKKARKIYDQFESELFAELESGTVEAANAASKTIKCLQLASGAVYKVDED 307

Query: 299 ----KHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP--- 351
                 W ++HD K+ ALE I+E+ N AP++VAY +  DLARL+K FP G  L K     
Sbjct: 308 GERTDEWVKIHDAKLDALESIVEELNGAPLLVAYQYKHDLARLKKKFPHGVALGKGKQGN 367

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             ++ WN G+IP++FAHPAS GHGLNLQ GG+ L  FS  W+ E   Q++ERIG  RQ Q
Sbjct: 368 KDMEAWNRGEIPIMFAHPASAGHGLNLQDGGHHLAIFSDTWNFEHFSQIVERIGPVRQMQ 427

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           AG  R VFVY + A+ T+DELV +R  +K  IQD L+  +K
Sbjct: 428 AGHPRPVFVYIIQARGTLDELVAERRDSKRDIQDDLMEYMK 468


>gi|15838886|ref|NP_299574.1| hypothetical protein XF2295 [Xylella fastidiosa 9a5c]
 gi|9107459|gb|AAF85094.1|AE004041_6 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 470

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 209/435 (48%), Positives = 286/435 (65%), Gaps = 14/435 (3%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQ 59
           MNL P+Q  +VD+IL H RC ++  MG GKTV+ LTAL  + +  + + +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTMVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDVAPMLVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ ++V+ G+   R + L+  A +Y IN++NL WL +  +  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVAVVVGSAAARRRALEQDADIYCINYDNLKWLAEFYQDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
           T+V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 TVVADECSKLKGFRLRQGTRRARALAKYVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR      A KEI+  + D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAVQIGSDPHAVRLVPAPNASKEIQDTIRDLCLSLDPHAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   ++E++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVVLPAHAQRLYKAMEQEMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LD+ P T+++
Sbjct: 301 TRQAWEVVHDAKLEALHEIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRVLDQHPDTLRD 360

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVT--------- 407
           WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WW    +  ++    V          
Sbjct: 361 WNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWAQVRNGVLMRTCTVCGGSGTVPIS 420

Query: 408 -RQRQAGFKRAVFVY 421
            R+R A   R V  Y
Sbjct: 421 ERKRAAALGRDVSTY 435


>gi|225220074|ref|YP_002720041.1| helicase [Enterobacteria phage SSL-2009a]
 gi|224986015|gb|ACN74579.1| helicase [Enterobacteria phage SSL-2009a]
          Length = 474

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 212/461 (45%), Positives = 295/461 (63%), Gaps = 15/461 (3%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG-----EKSVLVIAPLRVAQS 60
           +Q  I  +IL HKRC IWA+MGSGKT + + AL+ +   G     E  VLV+APLRVA  
Sbjct: 9   YQKLITAFILKHKRCNIWATMGSGKTGATMWALNKMFQTGILSNQEDRVLVLAPLRVASG 68

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            W  E ++W  F  + +   TG+ K R   L++ A +  +N++ + WLV+     WPF  
Sbjct: 69  TWPPEQEKW-RFPALLVVDGTGSEKDRIAALESDANVVCVNYDVVEWLVEYCGDEWPFTV 127

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKG 179
           +V DESTKLK +R +QGSK ARALA  A +  +R+I LTGTP+PNGL DLWGQ WF+D G
Sbjct: 128 VVADESTKLKGYRSKQGSKRARALAAIAHKHVKRWINLTGTPAPNGLKDLWGQTWFVDGG 187

Query: 180 KRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK 239
           +RLG  +++F  RWF +  +      +++   + ++KEI+ +LSD  L++D A+Y   DK
Sbjct: 188 ERLGSSYKAFTDRWFISKPVKPGSFTMQHAPLKNSEKEIQQRLSDVSLTVDAAEYFGCDK 247

Query: 240 PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEE- 298
           PI     V LP+   K Y +F+ EL+ +L+   +EA N+ASKT+KCLQLA+GAVY  +E 
Sbjct: 248 PIYTPVVVDLPKKARKIYDQFEAELFAELESGTVEAANAASKTIKCLQLASGAVYKVDED 307

Query: 299 ----KHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP--- 351
                 W ++HD K+ ALE I+E+ N AP++VAY +  DLARL+K FP G  + K     
Sbjct: 308 GERTDEWVKIHDAKLDALESIVEELNGAPLLVAYQYKHDLARLKKKFPHGVAMGKGKQGN 367

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             ++ WN G+IP++FAHPAS GHGLNLQ GG+ L  FS  W+ E   Q++ERIG  RQ Q
Sbjct: 368 KDMEAWNRGEIPIMFAHPASAGHGLNLQDGGHHLAIFSDTWNYEHFAQIVERIGPIRQMQ 427

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           AG  R VFVY + A+ T+DELV +R  +K  IQD L+  +K
Sbjct: 428 AGHPRPVFVYIIQARGTLDELVAERRDSKRDIQDDLMEYMK 468


>gi|318064550|gb|ADV36504.1| helicase [Edwardsiella phage eiMSLS]
          Length = 449

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/446 (44%), Positives = 282/446 (63%), Gaps = 14/446 (3%)

Query: 22  IWASMGSGKTVSVLTALSYIHLWG----EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI 77
           +WA+MGSGKT + + AL  +   G       VL++APLRVA   W  E ++W  F  + +
Sbjct: 1   VWATMGSGKTGATMWALDAMFSTGILDESDRVLILAPLRVASGTWPEEQRKW-KFPALRV 59

Query: 78  SVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
              TG  + R + L T A +  +N++ L WLV+     WPF  +V DEST+LKS+R R G
Sbjct: 60  IDATGNAEHRIEALATSANVVCLNYDVLEWLVEYYGNDWPFTVVVADESTRLKSYRSRGG 119

Query: 138 SKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNT 196
           SK ARALAK A +   RFI LTGTP+PNGL D+WGQ+WFLD G+RLG  +QSF  RWF +
Sbjct: 120 SKRARALAKVAHKKIRRFINLTGTPAPNGLKDVWGQMWFLDAGERLGTSYQSFSDRWFVS 179

Query: 197 TQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ 256
            Q+GS   A + + +  A+ EI  + +D  +++D A+Y   DKP+++   V LP+   K 
Sbjct: 180 KQVGSSPLARQISPRTGAETEIHQKCADLSITIDAAEYFGCDKPVVVPIVVELPKKARKI 239

Query: 257 YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY-----DEEKHWKEVHDEKIKA 311
           Y   +  L+ +L+   IEA N+A+KT KCLQ+A GA Y      +  K W E+H  K+ A
Sbjct: 240 YDDMENALFAELESGEIEASNAAAKTAKCLQIAGGACYITTDDGEASKEWTEIHKAKLDA 299

Query: 312 LEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLD---KDPCTIQEWNEGKIPLLFAH 368
           LE IIE+ N +P++VAY +  DL RL K FPQGR +    K    + +WN GK+P++F H
Sbjct: 300 LESIIEELNGSPLLVAYQYKHDLVRLLKRFPQGRAMRKGLKGNNDMADWNAGKVPIMFVH 359

Query: 369 PASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNT 428
           PAS GHGLNLQ GG  L FF+  W+ E++ Q++ERIG  RQ QAG  R V++Y + A+ T
Sbjct: 360 PASAGHGLNLQDGGCHLAFFNDTWNYEQYAQIVERIGPVRQHQAGHPRTVYIYIIQARGT 419

Query: 429 IDELVLQRLRTKSTIQDLLLNALKKE 454
           +DE+V  R   K+ +QDLL++ +K++
Sbjct: 420 LDEVVALRRDDKAEVQDLLMDYMKRK 445


>gi|318064442|gb|ADV36452.1| helicase [Edwardsiella phage eiDWF]
          Length = 449

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/446 (44%), Positives = 282/446 (63%), Gaps = 14/446 (3%)

Query: 22  IWASMGSGKTVSVLTALSYIHLWG----EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI 77
           +WA+MGSGKT + + AL  +   G       VL++APLRVA   W  E ++W  F  + +
Sbjct: 1   MWATMGSGKTGATMWALDAMFSTGILDESDRVLILAPLRVASGTWPEEQRKW-KFPALRV 59

Query: 78  SVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
              TG  + R + L T A +  +N++ L WLV+     WPF  +V DEST+LKS+R R G
Sbjct: 60  IDATGNAEHRIEALATSANVVCLNYDVLEWLVEYYGNDWPFTVVVADESTRLKSYRSRGG 119

Query: 138 SKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNT 196
           SK ARALAK A +   RFI LTGTP+PNGL D+WGQ+WFLD G+RLG  +QSF  RWF +
Sbjct: 120 SKRARALAKVAHKKIRRFINLTGTPAPNGLKDVWGQMWFLDAGERLGTSYQSFSDRWFVS 179

Query: 197 TQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ 256
            Q+GS   A + + +  A+ EI  + +D  +++D A+Y   DKP+++   V LP+   K 
Sbjct: 180 KQVGSSPLARQISPRTGAETEIHQKCADLSITIDAAEYFGCDKPVVVPIVVELPKKARKI 239

Query: 257 YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY-----DEEKHWKEVHDEKIKA 311
           Y   +  L+ +L+   IEA N+A+KT KCLQ+A GA Y      +  K W E+H  K+ A
Sbjct: 240 YDDMENALFAELESGEIEASNAAAKTAKCLQIAGGACYITTDDGEASKEWTEIHKAKLDA 299

Query: 312 LEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLD---KDPCTIQEWNEGKIPLLFAH 368
           LE IIE+ N +P++VAY +  DL RL K FPQGR +    K    + +WN GK+P++F H
Sbjct: 300 LESIIEELNGSPLLVAYQYKHDLVRLLKRFPQGRAMRKGLKGNNDMADWNAGKVPIMFXH 359

Query: 369 PASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNT 428
           PAS GHGLNLQ GG  L FF+  W+ E++ Q++ERIG  RQ QAG  R V++Y + A+ T
Sbjct: 360 PASAGHGLNLQDGGCHLAFFNDTWNYEQYAQIVERIGPVRQHQAGHPRTVYIYIIQARGT 419

Query: 429 IDELVLQRLRTKSTIQDLLLNALKKE 454
           +DE+V  R   K+ +QDLL++ +K++
Sbjct: 420 LDEVVALRRDDKAEVQDLLMDYMKRK 445


>gi|282535269|gb|ADA82475.1| putative helicase [Escherichia phage K1ind3]
 gi|282547318|gb|ADA82375.1| putative helicase [Escherichia phage K1ind1]
 gi|282547370|gb|ADA82426.1| putative helicase [Escherichia phage K1ind2]
          Length = 474

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/463 (44%), Positives = 296/463 (63%), Gaps = 16/463 (3%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG----EKSVLVIAPLRVAQSV 61
           +Q  +  ++L H RC IWASMGSGK+ S L  L+ +   G    +  VL++APLRVA   
Sbjct: 9   YQKLMTSFMLRHHRCNIWASMGSGKSGSTLWVLNRLFRNGQLNDDDRVLILAPLRVASGT 68

Query: 62  WTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFAT 120
           W +E  RW NF  +++   TG+ K+R   L++ A +   N+E + WL+    K  WPF  
Sbjct: 69  WPAEQARW-NFPCLSVVDATGSEKRRIAALESDANVVCTNYEVIEWLIDYYGKDDWPFTV 127

Query: 121 IVVDESTKLKSFRLRQG-SKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
           IV DESTKLKSFR R G SK A+AL+K A+ + +RFI LTGTPSPNGL DLWGQ WF+D 
Sbjct: 128 IVADESTKLKSFRSRSGGSKRAKALSKVAFGKVKRFINLTGTPSPNGLKDLWGQNWFIDA 187

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G+RLG  + +F  RWFN+ Q G    A  Y A+  A  EI  ++ D  L++D A++   +
Sbjct: 188 GERLGSSYTAFTDRWFNSVQKGKSAMAREYHARPGADNEIHQKMKDISLTIDAAEWFGCE 247

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY--- 295
            PI++  ++ LP+   + Y   + +L+ +L+   +EA N+A+KT KCLQ+A+GAVY    
Sbjct: 248 APIIVPVEIDLPKKARQAYIDMEEKLFAELESGEVEAANAAAKTSKCLQIASGAVYVSGP 307

Query: 296 --DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP-- 351
             +  K W++VHD K+ ALE I+E+   AP++VAY F  +L R+ K FPQ +   K    
Sbjct: 308 DGEATKDWEKVHDTKLDALESIVEELQGAPLLVAYQFKHELERILKRFPQAQAFAKGAKG 367

Query: 352 -CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 410
              ++ WN G+I +L  HPAS GHGLNLQ GG+ L F S  W+LE + Q++ERIG  RQ+
Sbjct: 368 NKQMEAWNRGEIEILCVHPASAGHGLNLQDGGHHLAFISQGWNLEHYLQVVERIGPVRQK 427

Query: 411 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           QAG +R VF+Y+++A++T+DE+V  R   K ++Q+ LLN +K+
Sbjct: 428 QAGHERPVFLYHIVAKDTLDEVVAARTDEKKSVQEELLNYMKR 470


>gi|282533166|gb|ADA82275.1| putative helicase [Escherichia phage K1G]
          Length = 474

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 203/463 (43%), Positives = 295/463 (63%), Gaps = 16/463 (3%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI----HLWGEKSVLVIAPLRVAQSV 61
           +Q  +  ++L H RC IWASMG+GKT SVL  L+ +     L  +  VL++APLRVA   
Sbjct: 9   YQKLMTSFMLQHHRCNIWASMGAGKTGSVLWTLNRLFRNGQLTDDDRVLILAPLRVASGT 68

Query: 62  WTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFAT 120
           W +E ++W  F  + +   TG+ K+R   L++   +   N+E + WL+    K  WPF  
Sbjct: 69  WPAEQEKW-RFPCLRVVDATGSEKRRIAALESDVNVVCTNYEVIEWLIDYYGKDDWPFTV 127

Query: 121 IVVDESTKLKSFRLRQG-SKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
           IV DESTKLKSFR R G SK A+AL+K A+ + +RFI LTGTPSPNGL DLWGQ WF+D 
Sbjct: 128 IVADESTKLKSFRSRSGGSKRAKALSKVAFGKVKRFINLTGTPSPNGLKDLWGQNWFIDA 187

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G+RLG  + +F  RWFN+ Q G    A  Y A+  A  EI  ++ D  L++D A++   +
Sbjct: 188 GERLGSSYTAFTDRWFNSVQKGKSAMAREYHARPGADNEIHQKMKDISLTIDAAEWFGCE 247

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY--- 295
            PI++  ++ LP+   + Y   + +L+ +L+   +EA N+A+KT KCLQ+A+GAVY    
Sbjct: 248 APIIVPVEIDLPKKARQAYIDMEEKLFAELESGEVEAANAAAKTSKCLQIASGAVYVSGP 307

Query: 296 --DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP-- 351
             +  K W++VHD K+ ALE I+E+   AP++VAY F  +L R+ K FPQ +   K    
Sbjct: 308 DGEATKDWEKVHDMKLDALESIVEELQGAPLLVAYQFKHELERILKRFPQAQAFAKGAKG 367

Query: 352 -CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 410
              ++ WN G+I +L  HPAS GHGLNLQ GG+ L F S  W+LE + Q++ERIG  RQ+
Sbjct: 368 NKQMEAWNRGEIEILCVHPASAGHGLNLQDGGHHLAFISQGWNLEHYLQVVERIGPVRQK 427

Query: 411 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           QAG +R VF+Y+++A++T+DE+V  R   K ++Q+ LLN +K+
Sbjct: 428 QAGHERPVFLYHIVAKDTLDEVVAARTDEKKSVQEELLNYMKR 470


>gi|62327356|ref|YP_224069.1| hypothetical protein BPKS7gp47 [Salmonella phage SS3e]
 gi|57472390|gb|AAW51252.1| hypothetical protein [Salmonella phage SS3e]
          Length = 474

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/463 (43%), Positives = 294/463 (63%), Gaps = 16/463 (3%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG----EKSVLVIAPLRVAQSV 61
           +Q  +  ++L H RC IW  MG GKT S +  LS +   G    +  VL++APLRVA   
Sbjct: 9   YQKIMTSFMLQHPRCNIWCGMGGGKTSSTMWVLSRLFRNGQLNDDDRVLILAPLRVASGT 68

Query: 62  WTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFAT 120
           W +E ++W NF  +++   TG+ K+R   L++ A +   N+E + WL+    K  WPF  
Sbjct: 69  WPAEQEKW-NFPCLSVVDATGSEKRRIAALESDANVVCTNYEVIEWLIDYYGKDDWPFTV 127

Query: 121 IVVDESTKLKSFRLRQG-SKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
           IV DESTKLKSFR R G SK A+AL+K A+ + +RFI LTGTPSPNGL DLWGQ WF+D 
Sbjct: 128 IVADESTKLKSFRSRSGGSKRAKALSKVAFGKVKRFINLTGTPSPNGLKDLWGQNWFIDA 187

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G+RLG  + +F  RWFN+ Q G    A  Y ++  A  EI  ++ D  L++D A++   +
Sbjct: 188 GERLGSSYTAFTDRWFNSVQKGKSAMAREYHSRPGADNEIHQKMKDISLTIDAAEWFGCE 247

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY--- 295
            P+++  ++ LP+   + Y   + +L+ +L+   +EA N+A+KT KCLQ+A+GAVY    
Sbjct: 248 APVIVPVEIDLPKKARQAYIDMEEKLFAELESGEVEAANAAAKTSKCLQIASGAVYVSGP 307

Query: 296 --DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP-- 351
             +  K W++VHD K+ ALE I+E+   AP++VAY F  +L R+ K FPQ +   K    
Sbjct: 308 DGEATKEWEKVHDTKLDALESIVEELQGAPLLVAYQFKHELERILKRFPQAQAFSKGAKG 367

Query: 352 -CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 410
              ++ WN G+I +L  HPAS GHGLNLQ GG+ L F S  W+LE + Q++ERIG  RQ+
Sbjct: 368 NKQMESWNRGEIEILCVHPASAGHGLNLQDGGHHLAFISQGWNLEHYLQVVERIGPVRQK 427

Query: 411 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           QAG +R VF+Y+++A++T+DE+V  R   K ++Q+ LLN +K+
Sbjct: 428 QAGHERPVFLYHIVAKDTLDEVVAARTDEKKSVQEELLNYMKR 470


>gi|318064334|gb|ADV36398.1| helicase [Edwardsiella phage eiAU]
          Length = 449

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/446 (44%), Positives = 281/446 (63%), Gaps = 14/446 (3%)

Query: 22  IWASMGSGKTVSVLTALSYIHLWG----EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNI 77
           +WA+MGSGKT + + AL  +   G       VL++APLRVA   W  E ++W  F  + +
Sbjct: 1   VWATMGSGKTGATMWALDAMFSTGILDESDRVLILAPLRVASGTWPEEQRKW-KFPALRV 59

Query: 78  SVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
              TG  + R + L T A +  +N++ L WLV+     WPF  +V DEST+LKS+R R G
Sbjct: 60  IDATGNAEHRIEALATSANVVCLNYDVLEWLVEYYGNDWPFTVVVADESTRLKSYRSRGG 119

Query: 138 SKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNT 196
           SK ARALAK A +   RFI LTGTP+ NGL D+WGQ+WFLD G+RLG  +QSF  RWF +
Sbjct: 120 SKRARALAKVAHKKIRRFINLTGTPARNGLKDVWGQMWFLDAGERLGTSYQSFSDRWFVS 179

Query: 197 TQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ 256
            Q+GS   A + + +  A+ EI  + +D  +++D A+Y   DKP+++   V LP+   K 
Sbjct: 180 KQVGSSPLARQISPRTGAETEIHQKCADLSITIDAAEYFGCDKPVVVPIVVELPKKARKI 239

Query: 257 YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY-----DEEKHWKEVHDEKIKA 311
           Y   +  L+ +L+   IEA N+A+KT KCLQ+A GA Y      +  K W E+H  K+ A
Sbjct: 240 YDDMENALFAELESGEIEASNAAAKTAKCLQIAGGACYITTDDGEASKEWTEIHKAKLDA 299

Query: 312 LEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLD---KDPCTIQEWNEGKIPLLFAH 368
           LE IIE+ N +P++VAY +  DL RL K FPQGR +    K    + +WN GK+P++F H
Sbjct: 300 LESIIEELNGSPLLVAYQYKHDLVRLLKRFPQGRAMRKGLKGNNDMADWNAGKVPIMFVH 359

Query: 369 PASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNT 428
           PAS GHGLNLQ GG  L FF+  W+ E++ Q++ERIG  RQ QAG  R V++Y + A+ T
Sbjct: 360 PASAGHGLNLQDGGCHLAFFNDTWNYEQYAQIVERIGPVRQHQAGHPRTVYIYIIQARGT 419

Query: 429 IDELVLQRLRTKSTIQDLLLNALKKE 454
           +DE+V  R   K+ +QDLL++ +K++
Sbjct: 420 LDEVVALRRDDKAEVQDLLMDYMKRK 445


>gi|282534217|gb|ADA82325.1| putative helicase [Escherichia phage K1H]
          Length = 477

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 206/466 (44%), Positives = 297/466 (63%), Gaps = 19/466 (4%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWG----EKSVLVIAPLRVAQSV 61
           +Q  +  ++L H RC IWASMGSGK+ S L  L+ +   G    +  VL++APLRVA   
Sbjct: 9   YQKLMTSFMLRHHRCNIWASMGSGKSGSTLWVLNRLFRNGQLNDDDRVLILAPLRVASGT 68

Query: 62  WTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQEL-KGTWPFAT 120
           W +E  RW NF  +++   TG+ K+R   L++ A +   N+E + WL+    K  WPF  
Sbjct: 69  WPAEQARW-NFPCLSVVDATGSEKRRIAALESDANVVCTNYEVIEWLIDYYGKDDWPFTV 127

Query: 121 IVVDESTKLKSFRLRQG-SKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
           IV DESTKLKSFR R G SK A+AL+K A+ + +RFI LTGTPSPNGL DLWGQ WF+D 
Sbjct: 128 IVADESTKLKSFRSRSGGSKRAKALSKVAFGKVKRFINLTGTPSPNGLKDLWGQNWFIDA 187

Query: 179 GKRLGRVFQSFVA---RWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           G+RLG +  S+ A   RWFN+ Q G    A  Y A+  A  EI  ++ D  L++D A++ 
Sbjct: 188 GERLGCLGSSYTAFTDRWFNSVQKGKSAMAREYHARPGADNEIHQKMKDISLTIDAAEWF 247

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
             + PI++  ++ LP+   + Y   + +L+ +L+   +EA N+A+KT KCLQ+A+GAVY 
Sbjct: 248 GCEAPIIVPVEIDLPKKARQAYIDMEEKLFAELESGEVEAANAAAKTSKCLQIASGAVYV 307

Query: 296 -----DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKD 350
                +  K W++VHD K+ ALE I+E+   AP++VAY F  +L R+ K FPQ +   K 
Sbjct: 308 SGPDGEATKDWEKVHDTKLDALESIVEELQGAPLLVAYQFKHELERILKRFPQAQAFAKG 367

Query: 351 PC---TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVT 407
                 ++ WN G+I +L  HPAS GHGLNLQ GG+ L F S  W+LE + Q++ERIG  
Sbjct: 368 AKGNKQMEAWNRGEIEILCVHPASAGHGLNLQDGGHHLAFISQGWNLEHYLQVVERIGPV 427

Query: 408 RQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           RQ+QAG +R VF+Y+++A++T+DE+V  R   K ++Q+ LLN +K+
Sbjct: 428 RQKQAGHERPVFLYHIVAKDTLDEVVAARTDEKKSVQEELLNYMKR 473


>gi|134288567|ref|YP_001110806.1| putative helicase [Salmonella phage SETP3]
 gi|125631932|gb|ABN47335.1| putative helicase [Salmonella phage SETP3]
          Length = 821

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 185/419 (44%), Positives = 270/419 (64%), Gaps = 12/419 (2%)

Query: 46  EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENL 105
           +  VL++APLRVA   W +E  RW NF  + +   TG+ K+R   L++ A +   N+E +
Sbjct: 400 DDRVLILAPLRVASGTWPAEQARW-NFPCLRVVDATGSEKRRIAALESDANVVCTNYEVI 458

Query: 106 GWLVQEL-KGTWPFATIVVDESTKLKSFRLRQG-SKTARALAKPAW-ESERFIELTGTPS 162
            WL+    K  WPF  IV DESTKLKSFR R G SK A+AL+K A+ + +RFI LTGTPS
Sbjct: 459 EWLIDYYGKDDWPFTVIVADESTKLKSFRSRSGGSKRAKALSKVAFGKVKRFINLTGTPS 518

Query: 163 PNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQL 222
           PNGL DLWGQ WF+D G+RLG  + +F  RWFN+ Q G    A  Y A+  A  EI  ++
Sbjct: 519 PNGLKDLWGQNWFIDAGERLGSSYTAFTDRWFNSVQKGKSAMAREYHARPGADNEIHQKM 578

Query: 223 SDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKT 282
            D  L++D A++   + P+++  ++ LP+   + Y   + +L+ +L+   +EA N+A+KT
Sbjct: 579 KDISLTIDAAEWFGCEAPVIVPVEIDLPKKARQAYIDMEEKLFAELESGEVEAANAAAKT 638

Query: 283 VKCLQLANGAVYY-----DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARL 337
            KCLQ+A+GAVY      +  K W++VHD K+ ALE I+E+   AP++VAY F  +L R+
Sbjct: 639 SKCLQIASGAVYVSGPDGEATKDWEKVHDTKLDALESIVEELQGAPLLVAYQFKHELERI 698

Query: 338 QKAFPQGRTLDKDPCT---IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDL 394
            + FPQ +   K       ++ WN G+I +L  HPAS GHGLNLQ GG+ L F S  W+L
Sbjct: 699 LRRFPQAQAFAKGAKGNKQMESWNRGEIEILCVHPASAGHGLNLQDGGHHLAFISQGWNL 758

Query: 395 EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           E + Q++ERIG  RQ+QAG +R VF+Y+++A++T+DE+V  R   K ++Q+ LLN +K+
Sbjct: 759 EHYLQVVERIGPVRQKQAGHERPVFLYHIVAKDTLDEVVAARTDEKKSVQEELLNYMKR 817



 Score = 38.5 bits (88), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 5  PHQTKIVDWILDHKRCAIWASMGSGKTV 32
          P+Q  +  ++L H RC IWASMGSGK +
Sbjct: 8  PYQKLMTSFMLRHPRCNIWASMGSGKCL 35


>gi|82777983|ref|YP_404332.1| hypothetical protein SDY_2798 [Shigella dysenteriae Sd197]
 gi|309784630|ref|ZP_07679265.1| DEAD box helicase [Shigella dysenteriae 1617]
 gi|81242131|gb|ABB62841.1| hypothetical bacteriophage protein [Shigella dysenteriae Sd197]
 gi|308927527|gb|EFP72999.1| DEAD box helicase [Shigella dysenteriae 1617]
          Length = 311

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 164/304 (53%), Positives = 229/304 (75%), Gaps = 1/304 (0%)

Query: 153 RFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKE 212
           R+I LTGTP+PNGL+DLWGQ WF+D+G+RLGR + +F +RWFN+ Q        +     
Sbjct: 8   RWINLTGTPAPNGLVDLWGQAWFVDQGQRLGRTYGAFTSRWFNSIQFPGQ-SWTKLEPFA 66

Query: 213 TAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGEN 272
            +Q EI+  L+D  LSLD AD+ +I  PI    +V +P    +QY + ++E++ +L GE 
Sbjct: 67  HSQAEIQRALADVTLSLDTADWFDIKAPIHNVIRVDMPPKAHQQYREMEKEMFLELNGEG 126

Query: 273 IEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNS 332
           IEA N+A+KT+KCLQ+A+GAVY D+   W E+HD K++AL+ I+ +A  AP++VAYH+  
Sbjct: 127 IEAPNAAAKTLKCLQIASGAVYTDDAGSWSELHDTKLQALDSILTEAAGAPVLVAYHWKH 186

Query: 333 DLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWW 392
           DL RL KAFP+GR LD+DP T+++WN GKIP+LFAHPAS GHGLN+Q GGNILVFFS WW
Sbjct: 187 DLERLLKAFPRGRHLDQDPQTLRDWNSGKIPVLFAHPASAGHGLNMQDGGNILVFFSHWW 246

Query: 393 DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           DLE++QQ+IERIG TRQ QAG  R VF++++IA +T+DE+V+++  +K T+QD+LL+A+K
Sbjct: 247 DLEQYQQIIERIGPTRQIQAGHNRPVFIHHIIAADTMDEMVMEQRNSKRTVQDILLDAMK 306

Query: 453 KETI 456
           K  I
Sbjct: 307 KRGI 310


>gi|160898846|ref|YP_001564428.1| helicase-like protein [Delftia acidovorans SPH-1]
 gi|160364430|gb|ABX36043.1| helicase-like protein [Delftia acidovorans SPH-1]
          Length = 477

 Score =  342 bits (878), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 188/467 (40%), Positives = 276/467 (59%), Gaps = 20/467 (4%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWT 63
           P Q ++ + +L   R  ++A MGSGKT + L AL+ + L+G  + +L+I P RVA+  W 
Sbjct: 9   PWQPQMTEHMLRVPRSNVFAGMGSGKTAATLEALAILLLFGVVRRILIIGPKRVARDTWR 68

Query: 64  SEVQRWS-NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
             +  +  +F  M I+V  G  K+R   ++    +  INF+NL WLV      WPF  +V
Sbjct: 69  DAICSFGQSFGWMTIAVAIGDEKKRRAAIQAGCHITAINFDNLDWLVDNYGPDWPFDMVV 128

Query: 123 VDESTKLKSFRLR--------------QGSKTARALAKPAWES-ERFIELTGTPSPNGLI 167
           VDESTKL+  R+               QG+  A+ALA+ A    +R++ LTGTP+  GL 
Sbjct: 129 VDESTKLRGLRVSIQAHKKSGKKWLAGQGASRAKALARVAHTRVQRWVNLTGTPALAGLE 188

Query: 168 DLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCL 227
            LWG  WFLD G RLG  F +F  RWF +   GS            A+++I   + D  L
Sbjct: 189 ALWGPTWFLDAGHRLGNSFTAFSHRWFRSVP-GSDPQKQVIEPMPFAEEQIRNAIRDITL 247

Query: 228 SLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQ 287
            +DI DY ++  P      V LP P  +QY +  REL  ++ G+ IEAF++ +K+ K LQ
Sbjct: 248 VVDIKDYVDVGAPQENVIYVDLPAPAQRQYDEMARELATEIDGQVIEAFSAGTKSQKLLQ 307

Query: 288 LANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTL 347
           +A+GA Y D++  W  VHDEKI+AL+ ++E+A   P++V YHF SDLAR++KAFP+ RTL
Sbjct: 308 IASGAAYTDDQGAWALVHDEKIEALKSVVEEALGMPLLVFYHFKSDLARIRKAFPKARTL 367

Query: 348 DKDPCTIQEWNEGKIPLLFAHPASCGHGLN-LQYGGNILVFFSLWWDLEEHQQMIERIGV 406
           D D    +++  G++ +L  HPAS GHG++ LQ+G    VFFS  W  E   Q IERIG 
Sbjct: 368 D-DKGAKEDFEAGRLQMLVVHPASAGHGVDGLQHGTCQCVFFSTNWSAENDAQAIERIGP 426

Query: 407 TRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           TRQ Q+G+ R V V+ L+A++T++E  + RLR++ ++ + L   LKK
Sbjct: 427 TRQMQSGYDRPVTVHRLVARDTVEESAMYRLRSRVSVDEALRQGLKK 473


>gi|159146252|gb|ABW90589.1| DEAD box helicase [Bacteriophage APSE-2]
 gi|159146254|gb|ABW90590.1| DEAD box helicase [Bacteriophage APSE-2]
 gi|159146256|gb|ABW90591.1| DEAD box helicase [Bacteriophage APSE-2]
          Length = 295

 Score =  338 bits (868), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 160/296 (54%), Positives = 215/296 (72%), Gaps = 2/296 (0%)

Query: 139 KTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTT 197
           K   ALAK A +S  R++ LTGTPSPNGL+DLWGQ WF+D+G+RLGR + +F +RWF   
Sbjct: 1   KRTAALAKIAHKSVHRWVNLTGTPSPNGLMDLWGQAWFVDQGERLGRTYNAFTSRWFKRI 60

Query: 198 QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQY 257
           Q+     + R+     A  +I   LSD  LSLD AD+ +ID+PI     V LP      Y
Sbjct: 61  QLPGQQWS-RFEPLGFAHLQIPLALSDVTLSLDAADWFDIDEPIHNVINVELPAKARAHY 119

Query: 258 HKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE 317
           H  ++EL+ +L    IEA N+A+KT+K LQ+A+GA+Y D+ ++W E+HD KI+ALE I+ 
Sbjct: 120 HAMEKELFLELGESAIEALNAAAKTIKILQIASGAIYSDDNRNWTEIHDAKIQALESIVN 179

Query: 318 KANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN 377
           ++   P++VAYH+  DL RL KAFP+G+ LD +P T+ +WN GKIPLLFAHPASCGHGLN
Sbjct: 180 ESGGTPVLVAYHWKHDLERLLKAFPKGKNLDANPRTLTDWNNGKIPLLFAHPASCGHGLN 239

Query: 378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 433
           LQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+++++A++T+DE+V
Sbjct: 240 LQDGGNILVFFSHWWDLEQYQQIIERIGPTRQAQAGHNRPVFIHHIVAKDTLDEVV 295


>gi|226949727|ref|YP_002804818.1| SNF2 domain protein [Clostridium botulinum A2 str. Kyoto]
 gi|226843727|gb|ACO86393.1| SNF2 domain protein [Clostridium botulinum A2 str. Kyoto]
          Length = 456

 Score =  338 bits (868), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 188/459 (40%), Positives = 283/459 (61%), Gaps = 19/459 (4%)

Query: 1   MNLAP--HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRV 57
           MN  P  +Q   ++ I+DH    ++  MG GKTVS LTA+  +   GE + +LVIAPLRV
Sbjct: 1   MNFKPWNYQQYSINHIIDHSASGLFLDMGMGKTVSTLTAIDDLLFLGESEKILVIAPLRV 60

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           A+  W++EV +W + +H+ IS I GT KQR + ++  A +YV N EN+ WLV      W 
Sbjct: 61  AEDTWSTEVDKWDHINHLKISKILGTPKQRKEAVEKDADIYVTNRENVVWLVDNYFKQWK 120

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           + T +VDE +  KS +    +K  RAL K     +R + LTGTP+PN LIDLW QI+ LD
Sbjct: 121 WDTCIVDELSSFKSSK----AKRFRALKKVRPYFKRMVGLTGTPAPNSLIDLWPQIYLLD 176

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
            GKRLGR   S+  ++FN  +   +I    +  K+ A+++I  ++ D C+S+   DY +I
Sbjct: 177 GGKRLGRTITSYRQQYFNPGKRNQYI-VYNWELKDGAEEQIHKKIGDICISMMAKDYLDI 235

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
            + I     + LP+  + +Y + +++L  +L  ++I A N+A  T K LQ++NGA+ Y E
Sbjct: 236 PERIDNIIDINLPKNAINKYKQLEKDLVLELGEDDITAANAAVLTNKLLQMSNGAI-YSE 294

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDK----DPCT 353
           +K   E+HDEK+KAL  IIE AN  P+++ Y F  D  R+   F + + L+     D   
Sbjct: 295 DKQVIEIHDEKLKALLDIIESANGKPVLIFYSFKHDFDRIVNFF-KSKKLNAIGLGDSKD 353

Query: 354 IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 413
           I++WN G+IP+L  HPAS GHGLNLQYGGNI+V+F L W LE +QQ   R+     RQ G
Sbjct: 354 IKKWNNGEIPILLVHPASAGHGLNLQYGGNIIVWFGLTWSLELYQQANARL----HRQ-G 408

Query: 414 FKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            K +V +++L++++T+DE V++ L +K   Q++LL A+K
Sbjct: 409 QKESVIIHHLVSKDTVDEDVIKTLGSKEVNQNVLLEAVK 447


>gi|331007741|ref|ZP_08330867.1| hypothetical protein IMCC1989_1942 [gamma proteobacterium IMCC1989]
 gi|330418449|gb|EGG92989.1| hypothetical protein IMCC1989_1942 [gamma proteobacterium IMCC1989]
          Length = 479

 Score =  338 bits (868), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 190/456 (41%), Positives = 279/456 (61%), Gaps = 19/456 (4%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIAPLRVAQS 60
           NL  +Q   V +I +   CA+W  MG GKTVS LTA++  +  +    VLVIAPLRVA  
Sbjct: 16  NLHGYQVNAVSFIKNTPSCALWVDMGLGKTVSTLTAVADLLDSFEVGRVLVIAPLRVALH 75

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            W +E+  W +  H+   VI G  KQR  +L + + +++IN E + WLV+ L   WP+  
Sbjct: 76  TWPNEIVNWEHTKHLTYDVIHGNPKQRKAILNSQSDIHIINRELVTWLVKTLGKGWPYDM 135

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           +V+DES+  KS + ++     +AL K     ER +ELTGTP+ NGL+D+W Q++ LDKG+
Sbjct: 136 VVIDESSSFKSSKSQR----FKALKKILPNVERMVELTGTPTSNGLLDIWSQVFLLDKGQ 191

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR F  F  R+F    +G + G   +  +   ++ I ++L D CL+L   DY  +  P
Sbjct: 192 RLGRTFTGFRDRYF----MGDYRG-YNFEPRPDTEEIIYSKLQDVCLTLSAEDYLTL--P 244

Query: 241 ILITKKVPLPQPV--MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEE 298
             I   +PL  P     QY + +RE   +++ E IE  N+A+ + K LQ +NGA+Y +++
Sbjct: 245 ERIDNVIPLEMPTKARNQYEELEREFLLEMEQETIEVLNAAALSNKLLQFSNGAIYTNDQ 304

Query: 299 KHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWN 358
            HW+ VHD K+ ALE II++A   P++VAY++ SDLAR+++ FPQ   +     +I  WN
Sbjct: 305 GHWEAVHDLKLSALEEIIQEAAGQPVLVAYNYKSDLARIKEHFPQAECITDSEDSIDRWN 364

Query: 359 EGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAV 418
            GKI LL AHPAS GHGLNLQ+GGN +V+F L W LE +QQ   R+     RQ G  + V
Sbjct: 365 AGKISLLLAHPASAGHGLNLQHGGNTIVWFGLNWSLELYQQFNARL----HRQ-GQTKPV 419

Query: 419 FVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
            +++L+   +IDE V++ L++K T Q  LLNALKK+
Sbjct: 420 IIHHLVVNGSIDETVIEALKSKKTTQKALLNALKKD 455


>gi|159146260|gb|ABW90593.1| DEAD box helicase [Bacteriophage APSE-2]
          Length = 295

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 157/296 (53%), Positives = 215/296 (72%), Gaps = 2/296 (0%)

Query: 139 KTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTT 197
           K   ALAK A +S  R++ LTGTPSPNGL+DLWGQ WF+D+G+RLGR+  +F +RWFN  
Sbjct: 1   KRTAALAKIAHKSVHRWVNLTGTPSPNGLMDLWGQAWFVDQGERLGRIHNAFTSRWFNRI 60

Query: 198 QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQY 257
           Q      + R+     A  +I++ LSD  LSL+ AD+ +ID+P+     + LP    + Y
Sbjct: 61  QFPGQQWS-RFEPLPFAHLQIQSALSDVTLSLNAADWFDIDEPVHNVINIELPTKAREHY 119

Query: 258 HKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE 317
              ++EL+ +L    IEA N+A+KT+K LQ+A+GA+Y D+ ++W E+HD KI+ LE I+ 
Sbjct: 120 QAMEKELFLELGESAIEALNAAAKTIKILQIASGAIYSDDNRNWTEIHDAKIQVLESIVN 179

Query: 318 KANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN 377
           +A   P++VAYH+  DL RL KAFP+G+ LD +P T+  WN GKIPLLFAHPASCGHGLN
Sbjct: 180 EAGGMPVLVAYHWKHDLERLLKAFPKGKMLDANPQTLTNWNSGKIPLLFAHPASCGHGLN 239

Query: 378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 433
           LQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+++++A++T+DE+V
Sbjct: 240 LQDGGNILVFFSHWWDLEQYQQIIERIGPTRQAQAGHNRPVFIHHIVAKDTLDEVV 295


>gi|153938777|ref|YP_001391667.1| SNF2 domain-containing protein [Clostridium botulinum F str.
           Langeland]
 gi|152934673|gb|ABS40171.1| SNF2 domain protein [Clostridium botulinum F str. Langeland]
 gi|295319699|gb|ADG00077.1| SNF2 domain protein [Clostridium botulinum F str. 230613]
          Length = 454

 Score =  332 bits (852), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 183/459 (39%), Positives = 282/459 (61%), Gaps = 19/459 (4%)

Query: 1   MNLAP--HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRV 57
           M+  P  +Q   +  I+++    ++  MG GKT+S LTA+  +   G+   +LVIAPLRV
Sbjct: 1   MDFKPWSYQEYAIKHIINNPAAGLFLDMGMGKTISTLTAIDNLLFLGDINKILVIAPLRV 60

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           A+  W++EV +W + SH+ +S I GT KQR + L   A +YV N EN+ WLV E   +W 
Sbjct: 61  AEDTWSTEVDKWDHISHLRVSKILGTKKQRREALMKDADIYVTNRENIDWLVNECFSSWL 120

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           +  +V+DE +  KS +    +K  RAL K     +R + LTGTP+PN LIDLW QI+ LD
Sbjct: 121 WDMVVIDELSSFKSSK----AKRFRALKKVRPYFKRIVGLTGTPAPNSLIDLWPQIYLLD 176

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
            GKRLG+   S+  ++FN  +   ++    +  KE A+++I  ++ D C+S+   DY +I
Sbjct: 177 GGKRLGKTITSYRQQYFNPGRRNQYV-VYNWELKEGAEEQIHKKIGDICISMMAKDYLDI 235

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
              I     + LP+  M +Y + +++L  +L  ++I A N+A  T K LQ++NGA+ Y E
Sbjct: 236 PARIDNVININLPKQSMDKYKQLEKDLVIELGEDDITATNAAVLTNKLLQMSNGAI-YSE 294

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLD----KDPCT 353
           +K   E+H+EK+KAL  IIE AN  P+++ Y F  D  R+   F + + L+    +D   
Sbjct: 295 DKSVLEIHEEKLKALLDIIEAANGKPVLIFYSFKHDFDRIVN-FLKTKKLNAIGLEDSKD 353

Query: 354 IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 413
           I++WN G+IP+L  HPAS GHGLNLQYGGNI+V+F L W LE +QQ   R+     RQ G
Sbjct: 354 IKKWNNGEIPILLVHPASAGHGLNLQYGGNIIVWFGLTWSLELYQQANARL----HRQ-G 408

Query: 414 FKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            K +V +++L++++T+DE V++ L +K   Q++LL A+K
Sbjct: 409 QKESVIIHHLVSKDTVDEDVIKALDSKEVNQNVLLEAVK 447


>gi|159146264|gb|ABW90595.1| DEAD box helicase [Bacteriophage APSE-2]
          Length = 295

 Score =  332 bits (851), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 211/296 (71%), Gaps = 2/296 (0%)

Query: 139 KTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTT 197
           K   ALAK A +   R++ LTGTPSPNGL+DLWGQ WF+D+G+RLGR   +F +RWFN  
Sbjct: 1   KRTTALAKIAHKCVHRWVNLTGTPSPNGLMDLWGQAWFVDQGERLGRTHNAFTSRWFNRI 60

Query: 198 QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQY 257
           Q+     + R+     A  +I   LSD  LSLD AD+ +I++PI     V LP      Y
Sbjct: 61  QLPGQQWS-RFEPLGFAHLQIPLALSDVTLSLDAADWFDIEEPIHNVINVELPAKARAHY 119

Query: 258 HKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE 317
           H  ++EL+ +L    IEA N+A+KT+K LQ+A+GA+Y D+  +W  +HD KI+ALE I+ 
Sbjct: 120 HAMEKELFLELSDSAIEALNAAAKTIKNLQIASGAIYSDDNHNWTAIHDAKIQALESIVN 179

Query: 318 KANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN 377
           ++   P++VAYH+  DL RL KAFP+G+ LD +P T+  WN GKIPLLFAHPASCGHGLN
Sbjct: 180 ESGGTPVLVAYHWKHDLERLLKAFPKGKMLDANPQTLTNWNSGKIPLLFAHPASCGHGLN 239

Query: 378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 433
           LQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+++++A++T+DE+V
Sbjct: 240 LQDGGNILVFFSHWWDLEQYQQIIERIGPTRQAQAGHNRPVFIHHIVAKDTLDEVV 295


>gi|281416462|ref|YP_003347382.1| DNA helicase [Enterococcus phage phiFL4A]
 gi|270209638|gb|ACZ64177.1| DNA helicase [Enterococcus phage phiFL4A]
 gi|315160593|gb|EFU04610.1| protein, SNF2 family [Enterococcus faecalis TX0645]
 gi|315579439|gb|EFU91630.1| protein, SNF2 family [Enterococcus faecalis TX0630]
          Length = 459

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 184/452 (40%), Positives = 269/452 (59%), Gaps = 13/452 (2%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQS 60
           L P+Q    ++ILDH  CA+   MG GKT+S LTA+  +    E  ++VLVIAPL VA+ 
Sbjct: 7   LHPYQEYSKNFILDHPYCALLLDMGLGKTLSSLTAIDELLHTFEIIENVLVIAPLSVAEK 66

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            WT E+++W +  H+  S + G  KQR + L   A +Y+IN EN+ WLV   +  WPF T
Sbjct: 67  TWTDEIEKWDHLQHLTFSKVLGNPKQREEALFKKADVYLINRENVEWLVNYYQRNWPFKT 126

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           +++DE +  KS      +K  +AL K   + ER I LTGTPSPN L+DLW Q++ LD+G+
Sbjct: 127 VIIDELSSFKS----SSAKRFKALRKVRPKMERVIGLTGTPSPNSLMDLWAQMYLLDQGE 182

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLG+    +  ++F   Q   HI    +     A++ I  ++SD C+S+   DY  +   
Sbjct: 183 RLGKTITQYRNKYFVPAQKNGHI-VYSWQLIPGAEEAIYNKISDICVSMKAKDYLRLPPR 241

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
                ++ L     KQY + +RE   +L+G ++ A N+A+ + K LQL+NGAVY DE   
Sbjct: 242 TENIIELDLNPTSWKQYKELEREYVLELEGTDVVASNAATLSNKLLQLSNGAVY-DENGD 300

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
            +E+H EK+ ALE +IE A    ++V Y +  DL R+Q  F Q + L+     I++WNEG
Sbjct: 301 GREIHQEKLNALERVIEDAQGQSVLVFYQYQHDLERIQARFKQAKALNVSDGDIEKWNEG 360

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIPLL AHP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q    + V +
Sbjct: 361 KIPLLLAHPQSAGHGLNLQKGGHIIVWFGLTWSLEFYQQANARL--DRQGQT---QPVII 415

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           ++L+ + TIDE V++ L+ K   Q  L+ A+K
Sbjct: 416 HHLVTKGTIDEQVIKALQAKEQGQSALMAAVK 447


>gi|159146258|gb|ABW90592.1| DEAD box helicase [Bacteriophage APSE-2]
          Length = 295

 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 157/296 (53%), Positives = 211/296 (71%), Gaps = 2/296 (0%)

Query: 139 KTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTT 197
           K   ALAK A +   R++ LTGTPSPNGL+DLWGQ WF+D+G+RLGR   +F +RWFN  
Sbjct: 1   KRTTALAKIAHKCVHRWVNLTGTPSPNGLMDLWGQAWFVDQGERLGRTHNAFTSRWFNRI 60

Query: 198 QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQY 257
           Q+     + R+     A  +I   LSD  LSLD AD+ +I++PI     V LP      Y
Sbjct: 61  QLPGQQWS-RFEPLGFAHLQIPLALSDVTLSLDAADWFDIEEPIHNVINVELPAKARAHY 119

Query: 258 HKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE 317
           H  ++EL+ +L    IEA N+A+KT+K LQ+A+GA+Y D+  +W  +HD KI+ALE I+ 
Sbjct: 120 HAMEKELFLELGESAIEALNAAAKTIKILQIASGAIYSDDNHNWTAIHDAKIQALESIVN 179

Query: 318 KANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN 377
           ++   P++VAYH+  DL RL KAFP+G+ LD +P T+  WN GK+PLLFAHPASCGHGLN
Sbjct: 180 ESGGTPVLVAYHWKHDLERLLKAFPKGKMLDTNPQTLTNWNSGKVPLLFAHPASCGHGLN 239

Query: 378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 433
           LQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+++++A++T+DE+V
Sbjct: 240 LQDGGNILVFFSHWWDLEQYQQIIERIGPTRQAQAGHNRPVFIHHIVAKDTLDEVV 295


>gi|159146262|gb|ABW90594.1| DEAD box helicase [Bacteriophage APSE-2]
          Length = 295

 Score =  330 bits (846), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 157/296 (53%), Positives = 212/296 (71%), Gaps = 2/296 (0%)

Query: 139 KTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTT 197
           K   ALAK A +S  R++ LTGTPSPNGL+DLWGQ WF+D+G+RLGR   +F +RWFN  
Sbjct: 1   KRTAALAKIAHKSVHRWVNLTGTPSPNGLMDLWGQAWFVDQGERLGRTHNAFTSRWFNRI 60

Query: 198 QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQY 257
           Q+     + R+     A  +I+  LSD  LSL+ AD+ +I++PI     V LP      Y
Sbjct: 61  QLPGQQWS-RFEPLGFAHLQIQLALSDVTLSLNAADWFDIEEPIHNVINVELPAKARAHY 119

Query: 258 HKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE 317
              ++EL+ +L    IEA N+A+KT+K LQ+A+GA+Y D+  +W  +HD KI+ALE I+ 
Sbjct: 120 QAMEKELFLELGDSAIEALNAAAKTIKNLQIASGAIYSDDNHNWTAIHDAKIQALESIVN 179

Query: 318 KANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN 377
           ++   P++VAYH+  DL RL KAFP+G+ LD +P T+  WN GKIPLLFAHPASCGHGLN
Sbjct: 180 ESGGTPVLVAYHWKHDLERLLKAFPKGKMLDANPQTLTNWNSGKIPLLFAHPASCGHGLN 239

Query: 378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 433
           LQ GGNILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF+++++A++T+DE+V
Sbjct: 240 LQDGGNILVFFSHWWDLEQYQQIIERIGPTRQAQAGHNRPVFIHHIVAKDTLDEVV 295


>gi|332800346|ref|YP_004461845.1| SNF2-like protein [Tepidanaerobacter sp. Re1]
 gi|332698081|gb|AEE92538.1| SNF2-related protein [Tepidanaerobacter sp. Re1]
          Length = 451

 Score =  329 bits (844), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 188/449 (41%), Positives = 272/449 (60%), Gaps = 15/449 (3%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLRVAQSVWT 63
           +Q   +D+IL+ K   I+   G GKTV  LTA++ +  + +     LVIAPLRVA+S+W 
Sbjct: 8   YQKYALDFILNQKAAGIFLDCGLGKTVITLTAIAELMHNRFEIARPLVIAPLRVAESIWD 67

Query: 64  SEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVV 123
            E ++W +  H+ I+ + G+ ++R + L T A +YVIN EN  WLV   K  WPF  +V+
Sbjct: 68  VEAKKWDHLKHLRIAKVLGSKEERIQALNTAADIYVINRENTKWLVDYYKNNWPFDMVVL 127

Query: 124 DESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLG 183
           DE +  KS +    ++  +AL K     +R + LTGTP+PNGLIDLW Q++ LD GKRLG
Sbjct: 128 DELSSFKSHK----AQRFKALRKVRPFCKRVVGLTGTPAPNGLIDLWSQVYLLDSGKRLG 183

Query: 184 RVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILI 243
           +    +  R+F   +  +H     Y  KE A++ I  +LSD C+S+   DY NI + I  
Sbjct: 184 KTITGYRERYFLPDK-RNHNVIFTYKPKEGAEEAIYNKLSDICISMKSGDYLNIPERIDN 242

Query: 244 TKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKE 303
              V LP   M+QY K +R+L   L   ++ A ++A  T K LQ+  GAV YDE+   + 
Sbjct: 243 IATVELPPKAMEQYRKLERDLLLPLLNGDVVAGSAAVLTNKLLQITGGAV-YDEDGGVQV 301

Query: 304 VHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIP 363
           +HDEK+KALE ++E AN  P+++ Y +  +  R+QK     R LDK P  I +WN+G+IP
Sbjct: 302 LHDEKLKALEDLVEAANGKPVLIYYAYRHEQKRIQKHL-DCRVLDK-PKDIADWNKGEIP 359

Query: 364 LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
           ++ AHPAS GHGLNLQ GG+ +++F L W LE + Q   RI     RQ G +  V V++L
Sbjct: 360 VMLAHPASAGHGLNLQAGGSTIIWFGLPWSLELYSQANARI----HRQ-GQRNTVVVHHL 414

Query: 424 IAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           +A+ TIDE V+Q L+ K   QD LLNA+K
Sbjct: 415 VARGTIDEDVMQVLKNKEAGQDALLNAVK 443


>gi|227520161|ref|ZP_03950210.1| helicase [Enterococcus faecalis TX0104]
 gi|227072406|gb|EEI10369.1| helicase [Enterococcus faecalis TX0104]
 gi|315574062|gb|EFU86253.1| protein, SNF2 family [Enterococcus faecalis TX0309B]
 gi|315582007|gb|EFU94198.1| protein, SNF2 family [Enterococcus faecalis TX0309A]
          Length = 455

 Score =  329 bits (844), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 183/452 (40%), Positives = 268/452 (59%), Gaps = 13/452 (2%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQS 60
           L P+Q    ++ILDH  CA+   MG GKT+S LTA+  +    E  ++VLVIAPL VA+ 
Sbjct: 7   LHPYQEYSKNFILDHPYCALLLDMGLGKTLSSLTAIDELLHTFEIIENVLVIAPLSVAEK 66

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            WT E+++W +  H+  S + G  KQR + L   A +Y+IN EN+ WLV   +  WPF T
Sbjct: 67  TWTDEIEKWDHLQHLTFSKVLGNPKQREEALFKKADVYLINRENVEWLVNYYQRNWPFKT 126

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           +++DE +  KS      +K  +AL K   + ER I LTGTPSPN L+DLW Q++ LD+G+
Sbjct: 127 VIIDELSSFKS----SSAKRFKALRKVRPKMERVIGLTGTPSPNSLMDLWAQMYLLDQGE 182

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLG+    +  ++F   Q   HI    +     A++ I  ++SD C+S+   DY  +   
Sbjct: 183 RLGKTITQYRNKYFAPAQKNGHI-VYSWQLIPGAEEAIYNKISDICVSMKAKDYLQLPPR 241

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
                ++ L     KQY + +RE   +L+  ++ A N+A+ + K LQL+NGAVY DE   
Sbjct: 242 TENIIELDLNPTSWKQYKELEREYVLELEETDVVASNAATLSNKLLQLSNGAVY-DENGD 300

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
            +E+H EK+ ALE +IE A    ++V Y +  DL R+Q  F Q + L+     I++WNEG
Sbjct: 301 GREIHQEKLNALERVIEDAQGQSVLVFYQYQHDLERIQARFKQAKALNVSDGDIEKWNEG 360

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KIPLL AHP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q    + V +
Sbjct: 361 KIPLLLAHPQSAGHGLNLQKGGHIIVWFGLTWSLEFYQQANARL--DRQGQT---QPVII 415

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           ++L+ + TIDE V++ L+ K   Q  L+ A+K
Sbjct: 416 HHLVTKGTIDEQVIKALQAKEQGQSALMAAVK 447


>gi|29374969|ref|NP_814122.1| SNF2 domain-containing protein [Enterococcus faecalis V583]
 gi|29342427|gb|AAO80193.1| SNF2 domain protein [Enterococcus faecalis V583]
          Length = 457

 Score =  328 bits (842), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 183/452 (40%), Positives = 268/452 (59%), Gaps = 13/452 (2%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQS 60
           L P+Q    ++ILDH  CA+   MG GKT+S LTA+  +    E  ++VLVIAPL VA+ 
Sbjct: 5   LHPYQEYSKNFILDHPYCALMLDMGLGKTLSSLTAIDELLHTFEIIENVLVIAPLSVAEK 64

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            WT E+++W +  H+  S + G  KQR + L   A +Y+IN EN+ WLV   +  WPF T
Sbjct: 65  TWTDEIEKWDHLQHLTFSKVLGNPKQREEALFKKADVYLINRENVEWLVNYYQRNWPFKT 124

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           +++DE +  KS      +K  +AL K   + ER I LTGTPSPN L+DLW Q++ LD+G+
Sbjct: 125 VIIDELSSFKS----SSAKRFKALRKVRPKMERVIGLTGTPSPNSLMDLWAQMYLLDQGE 180

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLG+    +  ++F   Q   HI    +     A++ I  ++SD C+S+   DY  +   
Sbjct: 181 RLGKTITQYRNKYFVPAQKNGHI-VYSWQLIPGAEEAIYNKISDICVSMKAKDYLRLPPR 239

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
                ++ L     KQY + +RE   +L+G ++ A N+A+ + K LQL+NGAVY DE   
Sbjct: 240 TENIIELDLNPTSWKQYKELEREYVLELEGTDVVASNAATLSNKLLQLSNGAVY-DENGD 298

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
            +E+H EK+ ALE +IE A    ++V Y +  DL R+Q  F Q + L+     I++WNEG
Sbjct: 299 GREIHQEKLNALERVIEDAQGQSVLVFYQYQHDLERIQARFKQAKALNVSDGDIEKWNEG 358

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
           KI LL AHP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q    + V +
Sbjct: 359 KISLLLAHPQSAGHGLNLQKGGHIIVWFGLTWSLEFYQQANARL--DRQGQT---QPVII 413

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           ++L+ + TIDE V++ L+ K   Q  L+ A+K
Sbjct: 414 HHLVTKGTIDEQVIKALQAKEQGQSALMAAVK 445


>gi|220930418|ref|YP_002507327.1| SNF2-related protein [Clostridium cellulolyticum H10]
 gi|220000746|gb|ACL77347.1| SNF2-related protein [Clostridium cellulolyticum H10]
          Length = 457

 Score =  326 bits (835), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 188/461 (40%), Positives = 270/461 (58%), Gaps = 22/461 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           M   PH  Q   ++ I+D     ++  MG GKTV  LTAL  +    +    +L++APLR
Sbjct: 1   MKFKPHKYQEYAIERIMDTPAVGLFLEMGLGKTVITLTALDELLYDRFEASRILIVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W+ E Q+W +  H+ IS I G+  QR K LK  A LY+IN EN+ WLV      W
Sbjct: 61  VAEDTWSRESQKWDHLKHLTISKILGSRSQREKALKADADLYIINRENVPWLVSMTGSDW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF T+V+DE +  KS      S+  RAL +      R I LTGTP+PNGL+DLW QI+ L
Sbjct: 121 PFDTVVIDELSSFKS----PSSQRFRALRRNRPLINRIIGLTGTPTPNGLLDLWSQIYLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYT--AKETAQKEIEAQLSDCCLSLDIADY 234
           D+G+RLG+    +  R+F     G+  G V Y    K+ A++ +  ++SD C+S+   D+
Sbjct: 177 DQGQRLGKTITGYRERYFTA---GARSGYVVYDWKQKKEAEEVVFNKISDICVSMKSEDW 233

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
             + + I     V L +    +Y K +R+L   L   +I A  +A  + K LQ ANGAV 
Sbjct: 234 LELPERIDRVVPVKLDESAKAKYRKLERDLLLPLVDGDIVANTAAVLSNKLLQFANGAV- 292

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP--- 351
           Y+E +  +++H+ K+ ALE I+E AN  P+++ Y +  DL+R+Q+ F Q RTL K P   
Sbjct: 293 YNENQEIQKIHNAKLDALEDILEAANGHPVLLFYSYKHDLSRIQERFTQTRTLRKGPEGS 352

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             I +WN GKI LL  HP S GHGLNLQ GG+I+V+F L W LE +QQ   R+     RQ
Sbjct: 353 KDIADWNSGKIQLLAVHPGSAGHGLNLQDGGSIIVWFGLTWSLELYQQANARL----HRQ 408

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            G K++V +++L+A  TIDE V++ L  K+T QD L+ A+K
Sbjct: 409 -GQKQSVIIHHLVADGTIDEDVMRALEDKATGQDALMEAVK 448


>gi|300856809|ref|YP_003781793.1| putative phage related DNA helicase [Clostridium ljungdahlii DSM
           13528]
 gi|300436924|gb|ADK16691.1| predicted phage related DNA helicase [Clostridium ljungdahlii DSM
           13528]
          Length = 443

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 181/435 (41%), Positives = 259/435 (59%), Gaps = 17/435 (3%)

Query: 23  WASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
           W  +  GKTVS LTA+  +   GE   VLVIAPLRVA+  W++EV++W +  H+ IS I 
Sbjct: 10  WVWVEYGKTVSTLTAVDELLFLGEVYRVLVIAPLRVAEDTWSTEVEKWDHLKHLKISKII 69

Query: 82  GTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTA 141
           GT   R + L   A +YV N EN+ WLV+     WPF   V+DE +  KS +    +K  
Sbjct: 70  GTKSNRERALMADADIYVTNRENVDWLVKYCFNRWPFDMCVIDELSSFKSSK----AKRF 125

Query: 142 RALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGS 201
           R+L K     +R + LTGTP+PN LIDLW Q++ LD GKRLG+   S+  ++F       
Sbjct: 126 RSLKKVRLYFKRIVGLTGTPAPNSLIDLWPQVYLLDGGKRLGKTIGSYREQYFTPGNRNQ 185

Query: 202 HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQ 261
            +    +  KE A + IE ++SD C+S+   DY ++ + I    ++ LP+    +Y + +
Sbjct: 186 FV-VYNWNLKEGAGEAIENKISDICVSMKAKDYLDLPERIDNIVEINLPEKAKDKYKELE 244

Query: 262 RELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANA 321
           ++L  +L  E+I A N+A  T K LQ++NGA+ Y E+K   ++HDEK+KAL  IIE AN 
Sbjct: 245 KDLVLELGKEDITAANAAVLTNKLLQMSNGAI-YSEDKKVVKIHDEKLKALFEIIEAANG 303

Query: 322 APIIVAYHFNSDLARLQKAFPQGRTLD----KDPCTIQEWNEGKIPLLFAHPASCGHGLN 377
            P++V Y F  D  R+   F   + L     KD   I+ WN+G+IP+L  HPAS GHGLN
Sbjct: 304 KPVLVFYSFKHDFDRIIN-FLSSKKLKAVGLKDSADIKRWNKGEIPILLIHPASAGHGLN 362

Query: 378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRL 437
           LQYGGNI+V+F L W LE +QQ   R+     RQ G K  V + ++IA+ T+DE V++ L
Sbjct: 363 LQYGGNIIVWFGLTWSLELYQQANARL----HRQ-GQKETVVINHIIAKGTVDEDVMKSL 417

Query: 438 RTKSTIQDLLLNALK 452
             K   Q++LL A+K
Sbjct: 418 GNKKVNQNILLEAVK 432


>gi|300933380|ref|ZP_07148636.1| phage-associated protein [Corynebacterium resistens DSM 45100]
          Length = 454

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 188/463 (40%), Positives = 264/463 (57%), Gaps = 26/463 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q +   ++ DH + AI   MG GKTV  LTA+  + L  +  + VL++APLR
Sbjct: 1   MRYEPHDYQRQATAFVEDHPQAAILLGMGLGKTVITLTAIWNLLLDSFHARRVLIVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E  +W + + + I+V  G+  QR   L   A++ VIN EN+ WLV+ L  TW
Sbjct: 61  VARDTWPAEATKWDHLAGLTIAVAVGSKAQRVDALAAEAMVTVINRENVPWLVRHLGNTW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +V+DE +  K+ R    ++  +ALA       R + LTGTP+ NGL+DLW Q   L
Sbjct: 121 PFDMVVIDELSSFKNHR----AQRFKALASVRPRLTRIVGLTGTPAANGLMDLWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWF-----NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
           D+G+RLGR    +  RWF     N  QI +      Y     A+ EI   +SD  LS+  
Sbjct: 177 DEGQRLGRFITYYRNRWFVPDRRNGQQIFT------YKPAPGAEGEIYEAISDITLSMRT 230

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG 291
            DY  + +  + T  V L     K Y + + E+  DL G+ I+A N+A+ + K LQLA+G
Sbjct: 231 TDYLRLPELTVTTTLVDLEPKERKAYERLRDEMVLDLDGQVIDAANAAALSGKLLQLASG 290

Query: 292 AVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP 351
           A+ YDEE +   VHD K+ ALE ++E AN  P++VAY F  D  R+ +  PQ R L    
Sbjct: 291 AI-YDEEGNTVVVHDRKLDALEDLVEAANGQPLLVAYWFKHDRQRITERLPQARELTTS- 348

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             I+ WNEG IPL   HPAS GHGLNLQ GGN+LV+FSL W LE +QQ   R+     RQ
Sbjct: 349 ADIEAWNEGGIPLALIHPASAGHGLNLQQGGNLLVWFSLTWSLELYQQTNARL----YRQ 404

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
            G  + V + +L + +T+DE VL  L +K+ IQ  L++A+  E
Sbjct: 405 -GQDQPVTITHLASADTLDEAVLAALESKNDIQSALIDAVTSE 446


>gi|170730331|ref|YP_001775764.1| hypothetical protein Xfasm12_1183 [Xylella fastidiosa M12]
 gi|167965124|gb|ACA12134.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 295

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 149/280 (53%), Positives = 203/280 (72%), Gaps = 2/280 (0%)

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           + +  RLG  F++F  RWF   QIGS   AVR      A +EI+ ++ D CLSLD   Y 
Sbjct: 1   MQRAARLGTHFKAFSDRWFRAVQIGSDPHAVRLVPAPNASQEIQDKIRDLCLSLDPHAYF 60

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVY 294
           ++ +PI+ T +V LP+   + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y
Sbjct: 61  DLRQPIVNTIRVALPEHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALY 120

Query: 295 YDEEKH-WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCT 353
            D+ +  W+ VHD K++AL  IIE+A   P++VAYHF SD+ARLQ+AFP+GR LDK+P T
Sbjct: 121 TDDTRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVARLQRAFPKGRALDKNPDT 180

Query: 354 IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 413
           I++WN G IP+LFAHPAS GHGLNLQ GGNIL FF  WWDLE++QQ+IERIG TRQ QAG
Sbjct: 181 IRDWNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLEQYQQIIERIGPTRQAQAG 240

Query: 414 FKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
             R VF+++++A  T+DELV+ R  +K  +QDLLL A+K+
Sbjct: 241 HTRPVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKR 280


>gi|298253802|ref|ZP_06977391.1| superfamily II DNA/RNA helicase, SNF2 family [Gardnerella vaginalis
           5-1]
 gi|297532138|gb|EFH71111.1| superfamily II DNA/RNA helicase, SNF2 family [Gardnerella vaginalis
           5-1]
          Length = 479

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 179/456 (39%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q    D+I+ H   A+   MG GK+V  LTA++ + L  +     LVIAPLR
Sbjct: 1   MRYKPHEYQKYATDFIITHPVSAVLLEMGLGKSVISLTAINNLMLDSFDVSRTLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA + W  E+++W +  H+  SV+TG+ K+R + LKTPA +Y+IN EN+ WL+ +    +
Sbjct: 61  VANATWPLELEKWEHLKHLTYSVVTGSEKERIQALKTPAHVYIINRENVEWLIMKSGLPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE +  KS++    +K  +AL K   + +R + LTGTPS NGL+DLW +   L
Sbjct: 121 NFDMVVIDELSSFKSYQ----AKRFKALLKARPKVKRIVGLTGTPSSNGLMDLWAEFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +   +FN  +   H+    Y  K+ A+  I  Q++D  +S+   DY  
Sbjct: 177 DMGQRLGRYITYYRQNFFNPDKRNQHM-IFSYKPKDGAESLIYKQIADITISMKSKDYLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           +   ++   KV L     K Y + + ++   L+G+ I+A N+AS + K LQ+A GAV Y+
Sbjct: 236 MPACVINEVKVELSGKERKLYDELKADMVVSLEGKEIDAINAASLSNKLLQMAGGAV-YN 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           E+K    +HD K+ ALE +IE AN  P++VAY F  DL R++K F       K    I +
Sbjct: 295 EKKESVHIHDRKLDALEDLIEAANGKPVLVAYWFKHDLERIKKRFNVREI--KTSADIAD 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+   HPAS GHGLNLQ GG+ L++FSL W LE +QQ   R+   RQ Q     
Sbjct: 353 WNAGMIPVALIHPASAGHGLNLQAGGSTLIWFSLTWSLELYQQTNARL--NRQGQTS--- 407

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V ++++I +NTIDE V++ L  K+ +QD L+ ++K
Sbjct: 408 TVVIHHIITKNTIDEDVMRALSMKAKVQDALIESVK 443


>gi|161509685|ref|YP_001575344.1| helicase [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|294848484|ref|ZP_06789230.1| helicase [Staphylococcus aureus A9754]
 gi|160368494|gb|ABX29465.1| possible helicase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|294824510|gb|EFG40933.1| helicase [Staphylococcus aureus A9754]
 gi|320140665|gb|EFW32519.1| protein, SNF2 family [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320142763|gb|EFW34566.1| protein, SNF2 family [Staphylococcus aureus subsp. aureus MRSA177]
          Length = 455

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 175/456 (38%), Positives = 268/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI   ++  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHI--FKWELRDGSEEKIYKQIEDICLSMKAKDYLDM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           EE   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TLD D    + 
Sbjct: 300 EED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLD-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|315197730|gb|EFU28064.1| possible helicase [Staphylococcus aureus subsp. aureus CGS01]
          Length = 452

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 175/456 (38%), Positives = 268/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 3   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI   ++  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHI--FKWELRDGSEEKIYKQIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           EE   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TLD D    + 
Sbjct: 297 EED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLD-DSNYKER 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 355 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 445


>gi|297242712|ref|ZP_06926650.1| superfamily II DNA/RNA helicase, SNF2 family [Gardnerella vaginalis
           AMD]
 gi|296888923|gb|EFH27657.1| superfamily II DNA/RNA helicase, SNF2 family [Gardnerella vaginalis
           AMD]
          Length = 479

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 178/456 (39%), Positives = 269/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q    D+I+ H   A+   MG GK+V  LTA++ + L  +     LVIAPLR
Sbjct: 1   MRYEPHEYQKYATDFIITHPVSAVLLEMGLGKSVISLTAINDLMLDSFDVSRTLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA + W  E+++W +  H+  SV+TG+ K+R + LKTPA +Y+IN EN+ WL+ +    +
Sbjct: 61  VANATWPLELEKWEHLKHLTYSVVTGSEKERIQALKTPAHVYIINRENVEWLIMKSGLPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE +  KS++    +K  +AL K   + +R + LTGTPS NGL+DLW +   L
Sbjct: 121 NFDMVVIDELSSFKSYQ----AKRFKALLKARPKVKRIVGLTGTPSSNGLMDLWAEFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +   +F+  +   H+    Y  K+ A+  I  Q++D  +S+   DY  
Sbjct: 177 DMGQRLGRYITYYRQNFFDPDKRNQHM-IFSYKPKDGAESLIYKQIADITISMKSKDYLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           +   ++   KV L     K Y + ++++   L+G+ I+A N+A  + K LQ+A GAV Y+
Sbjct: 236 MPACVINEVKVELSGNERKLYDELKQDMVVSLEGKEIDAINAAYLSNKLLQMAGGAV-YN 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           E+K    +HD K+ ALE +IE AN  P++VAY F  DL R++K F       K    I +
Sbjct: 295 EKKESVHIHDRKLDALEDLIEAANGKPVLVAYWFKHDLERIKKRFNVREI--KTSADIAD 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+   HPAS GHGLNLQ GG+ L++FSL W LE +QQ   R+   RQ Q G   
Sbjct: 353 WNAGMIPVALIHPASAGHGLNLQAGGSTLIWFSLTWSLELYQQTNARL--NRQGQTG--- 407

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V ++++I +NTIDE V++ L  K+ +QD L++++K
Sbjct: 408 TVVIHHIITKNTIDEDVMRALSMKAKVQDALIDSVK 443


>gi|295407565|ref|ZP_06817358.1| helicase [Staphylococcus aureus A8819]
 gi|297246595|ref|ZP_06930428.1| helicase [Staphylococcus aureus A8796]
 gi|294967584|gb|EFG43620.1| helicase [Staphylococcus aureus A8819]
 gi|297176553|gb|EFH35818.1| helicase [Staphylococcus aureus A8796]
          Length = 455

 Score =  315 bits (808), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 175/456 (38%), Positives = 268/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S+I GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLILGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI   ++  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHI--FKWELRDGSEEKIYKQIEDICLSMKAKDYLDM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           EE   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 EED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|258420304|ref|ZP_05683251.1| helicase [Staphylococcus aureus A9719]
 gi|258448843|ref|ZP_05696953.1| phage helicase [Staphylococcus aureus A6224]
 gi|257843729|gb|EEV68131.1| helicase [Staphylococcus aureus A9719]
 gi|257857880|gb|EEV80771.1| phage helicase [Staphylococcus aureus A6224]
 gi|329730625|gb|EGG67010.1| SNF2 family N-terminal domain protein [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 452

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 175/456 (38%), Positives = 268/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 3   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S+I GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLILGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI   ++  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHI--FKWELRDGSEEKIYKQIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           EE   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 297 EED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 355 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 445


>gi|295428024|ref|ZP_06820656.1| helicase [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297591005|ref|ZP_06949643.1| SNF2 domain protein [Staphylococcus aureus subsp. aureus MN8]
 gi|300911909|ref|ZP_07129352.1| SNF2 domain protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|295128382|gb|EFG58016.1| helicase [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297575891|gb|EFH94607.1| SNF2 domain protein [Staphylococcus aureus subsp. aureus MN8]
 gi|300886155|gb|EFK81357.1| SNF2 domain protein [Staphylococcus aureus subsp. aureus TCH70]
          Length = 455

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 174/456 (38%), Positives = 268/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI   ++  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHI--FKWELRDGSEEKIYKQIEDICLSMKAKDYLDM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           EE   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 EED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|49485834|ref|YP_043055.1| hypothetical protein SAS0928 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|49244277|emb|CAG42704.1| hypothetical phage protein [Staphylococcus aureus subsp. aureus
           MSSA476]
          Length = 455

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 174/456 (38%), Positives = 268/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 3   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI   ++  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHI--FKWELRDGSEEKIYKQIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           EE   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 297 EED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 355 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 445


>gi|21283134|ref|NP_646222.1| hypothetical protein MW1405 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49483700|ref|YP_040924.1| hypothetical protein SAR1523 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|148267489|ref|YP_001246432.1| SNF2-related protein [Staphylococcus aureus subsp. aureus JH9]
 gi|150393543|ref|YP_001316218.1| SNF2-related protein [Staphylococcus aureus subsp. aureus JH1]
 gi|282905864|ref|ZP_06313719.1| hypothetical protein SDAG_01488 [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282919229|ref|ZP_06326964.1| hypothetical protein SASG_00535 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282921765|ref|ZP_06329482.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282927343|ref|ZP_06334961.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|21204574|dbj|BAB95270.1| hypothetical protein [Staphylococcus aureus subsp. aureus MW2]
 gi|49241829|emb|CAG40521.1| hypothetical phage protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|147740558|gb|ABQ48856.1| SNF2-related protein [Staphylococcus aureus subsp. aureus JH9]
 gi|149945995|gb|ABR51931.1| SNF2-related protein [Staphylococcus aureus subsp. aureus JH1]
 gi|282317039|gb|EFB47413.1| hypothetical protein SASG_00535 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282331156|gb|EFB60670.1| hypothetical protein SDAG_01488 [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282590667|gb|EFB95743.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|282594027|gb|EFB99016.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|283470735|emb|CAQ49946.1| SNF2 family N-domain protein [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 452

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 174/456 (38%), Positives = 268/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 3   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI   ++  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHI--FKWELRDGSEEKIYKQIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           EE   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 297 EED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 355 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 445


>gi|257088837|ref|ZP_05583198.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|256997649|gb|EEU84169.1| conserved hypothetical protein [Enterococcus faecalis CH188]
          Length = 430

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 175/429 (40%), Positives = 256/429 (59%), Gaps = 13/429 (3%)

Query: 26  MGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
           MG GKT+S LTA+  +    E  ++VLVIAPL VA+  WT E+++W +  H+  S + G 
Sbjct: 1   MGLGKTLSSLTAIDELLHTFEIIENVLVIAPLSVAEKTWTDEIEKWDHLQHLTFSKVLGN 60

Query: 84  VKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARA 143
            KQR + L   A +Y+IN EN+ WLV   +  WPF T+++DE +  KS      +K  +A
Sbjct: 61  PKQREEALFKKADVYLINRENVEWLVNYYQRNWPFKTVIIDELSSFKS----SSAKRFKA 116

Query: 144 LAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHI 203
           L K   + ER I LTGTPSPN L+DLW Q++ LD+G+RLG+    +  ++F   Q   HI
Sbjct: 117 LRKVRPKMERVIGLTGTPSPNSLMDLWAQMYLLDQGERLGKTITQYRNKYFVPAQKNGHI 176

Query: 204 GAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRE 263
               +     A++ I  ++SD C+S+   DY  +        ++ L     KQY + +RE
Sbjct: 177 -VYSWQLIPGAEEAIYNKISDICVSMKAKDYLRLPPRTENIIELDLNPTSWKQYKELERE 235

Query: 264 LYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAP 323
              +L+G ++ A N+A+ + K LQL+NGAVY DE    +E+H EK+ ALE +IE A    
Sbjct: 236 YVLELEGTDVVASNAATLSNKLLQLSNGAVY-DENGDGREIHQEKLNALERVIEDAQGQS 294

Query: 324 IIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN 383
           ++V Y +  DL R+Q  F Q + L+     I++WNEGKIPLL AHP S GHGLNLQ GG+
Sbjct: 295 VLVFYQYQHDLERIQARFKQAKALNVSDGDIEKWNEGKIPLLLAHPQSAGHGLNLQKGGH 354

Query: 384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
           I+V+F L W LE +QQ   R+   RQ Q    + V +++L+ + TIDE V++ L+ K   
Sbjct: 355 IIVWFGLTWSLEFYQQANARL--DRQGQT---QPVIIHHLVTKGTIDEQVIKALQAKEQG 409

Query: 444 QDLLLNALK 452
           Q  L+ A+K
Sbjct: 410 QSALMAAVK 418


>gi|260579063|ref|ZP_05846962.1| SNF2 domain protein [Corynebacterium jeikeium ATCC 43734]
 gi|258602814|gb|EEW16092.1| SNF2 domain protein [Corynebacterium jeikeium ATCC 43734]
          Length = 453

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 186/460 (40%), Positives = 259/460 (56%), Gaps = 26/460 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q +   ++ DH +  I   MG GKTV  LTA+  + L  +  + VL++APLR
Sbjct: 1   MRYEPHDYQRQATQFVEDHPQAVILLGMGLGKTVITLTAIWNLLLDSFQARRVLIVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E  +W + + + I+V  G+  QR   L   A++ VIN EN+ WLV+ L  TW
Sbjct: 61  VARDTWPAEATKWDHLAGLTIAVAVGSKSQRVDALAAEAMVTVINRENVPWLVKHLGNTW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +V+DE +  K+ R    ++  +ALA       R + LTGTP+ NGL+DLW Q   L
Sbjct: 121 PFDMVVIDELSSFKNHR----AQRFKALAAVRPRLTRIVGLTGTPAANGLMDLWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWF-----NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
           D+G+RLGR    +  RWF     N  QI +      Y     A+ EI   +SD  LS+  
Sbjct: 177 DEGQRLGRFITHYRNRWFVPDRRNGQQIFT------YKPAPGAEDEIYEAISDITLSMRT 230

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG 291
            DY  + +  + T  V L     K Y + + E+  DL G+ I+A N+A+ + K LQLA+G
Sbjct: 231 TDYLRLPELTVTTTLVDLEPKERKAYERLRDEMVLDLDGQVIDAANAAALSGKLLQLASG 290

Query: 292 AVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP 351
           A+ YDE+ +   VHD K+ ALE ++E AN  P++VAY F  DL R+ + FPQ R L    
Sbjct: 291 AI-YDEDGNTVVVHDRKLDALEDLVEAANGQPLLVAYWFKHDLQRITERFPQARELTTS- 348

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             I  WN  +IPL   HPAS GHGLNLQ GGN+LV+FSL W LE +QQ   R+     RQ
Sbjct: 349 TDIAAWNAREIPLALIHPASAGHGLNLQQGGNLLVWFSLTWSLELYQQTNARL----YRQ 404

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNAL 451
            G  + V + +L A +T+DE VL  L  K   Q  L+NA+
Sbjct: 405 -GQDQPVTITHLAADHTLDEAVLAALDNKDMTQAALINAV 443


>gi|255306562|ref|ZP_05350733.1| SNF2-related protein [Clostridium difficile ATCC 43255]
          Length = 456

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 174/453 (38%), Positives = 267/453 (58%), Gaps = 16/453 (3%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLRVAQSVW 62
           P+Q   +   +D+    +   MG GKTV  LTA+S +    +    VLVIAPLRVA+  W
Sbjct: 7   PYQEYTIRKTIDNNNIGLLLDMGLGKTVCTLTAISELMYDYFDISKVLVIAPLRVARDTW 66

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
           +SEV++W +  H+ +S + G+   R + L T + +Y+IN E + W+V   K  WPF  +V
Sbjct: 67  SSEVKKWEHLKHLKVSKVLGSKLDRVRALSTDSDIYIINREMVPWIVDFYKRKWPFDMVV 126

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRL 182
           +DE +  KS +    ++  ++L K    ++R + LTGTP+PN LIDLW Q++ LD+G+RL
Sbjct: 127 IDELSSFKSNK----AQRFKSLKKVLPLTKRVVGLTGTPTPNSLIDLWAQMYLLDRGERL 182

Query: 183 GRVFQSFVARWFNTTQIGSHIGAV-RYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
           G+    +  R+F   Q     GA+  +  K+ A+  I  ++ D C+SL   DY N+ + I
Sbjct: 183 GKTITGYKERYFEPGQKNYQTGAIYNWQPKDGAENAIHNKIKDICISLKAEDYLNMPRKI 242

Query: 242 LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
               ++ L   ++K Y + ++E   +L  + I A ++A    K LQLANGA+ YD +K+ 
Sbjct: 243 DNKIEIHLDNKILKYYKELEKEKILELDKDIITASSAAVAANKLLQLANGAI-YDNDKNV 301

Query: 302 KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFP--QGRTLDKDPCTIQEWNE 359
           KE+H EK++AL+ II+ +N  PII+ Y++  D  RL K F   + RT++ +   I +WN 
Sbjct: 302 KELHREKLEALKEIIDVSNGKPIIIFYNYKHDYNRLMKEFKSLKPRTIE-NSKDIYDWNN 360

Query: 360 GKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVF 419
           G+I LL  HPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+    QR+      V 
Sbjct: 361 GRIQLLLCHPASTGHGLNLQSGGSIIVWFGLTWSLELYQQANARLYRQGQRE-----TVI 415

Query: 420 VYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           +++LI + TIDE V++ L  K   Q  LL A+K
Sbjct: 416 IHHLICKGTIDEQVMEALENKDKGQSALLEAVK 448


>gi|302333125|gb|ADL23318.1| SNF2 family N-terminal domain protein [Staphylococcus aureus subsp.
           aureus JKD6159]
          Length = 452

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 173/456 (37%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVI P +VA
Sbjct: 3   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVITPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI   ++  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHI--FKWELRDGSEEKIYKQIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           EE   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 297 EED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 355 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 445


>gi|298693629|gb|ADI96851.1| putative DNA helicase [Staphylococcus aureus subsp. aureus ED133]
          Length = 455

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 173/456 (37%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHNYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNAALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYKQIEDICLSMKAKDYLDM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y K ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PDRVDTKQTVVLSEKERKVYEKLEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 DED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|331085752|ref|ZP_08334835.1| hypothetical protein HMPREF0987_01138 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406675|gb|EGG86180.1| hypothetical protein HMPREF0987_01138 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 448

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 180/449 (40%), Positives = 266/449 (59%), Gaps = 16/449 (3%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQSVWT 63
           +Q+    +IL+H  C +   MG GKTV  LTAL  + L  +    +LVIAP RVA+  W 
Sbjct: 8   YQSYASRFILEHPYCGLILDMGLGKTVITLTALFALALDYFTAGKILVIAPKRVAEDTWP 67

Query: 64  SEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVV 123
            E+++W +   M  S++ GT KQR + L   A +Y+IN EN+ WLV+  +  W F+T+V+
Sbjct: 68  KELKKWEHLIGMKASLVVGTKKQREQALAEAADVYIINRENVVWLVENHR--WDFSTVVI 125

Query: 124 DESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLG 183
           DE +  KS +    ++  +AL     +  R I LTGTPSPNGL+DLW Q++ LD G+RLG
Sbjct: 126 DELSSFKSSK----AQRFKALKHVRPQVSRVIGLTGTPSPNGLLDLWPQMYLLDMGQRLG 181

Query: 184 RVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILI 243
           R    +  R+F   +    I    Y  K+ A+++I + +SD C+S+  ADY N+ + I  
Sbjct: 182 RYIGGYRERFFLPDKRNREI-IYSYKTKQGAEEKIYSLISDICISMKAADYLNMPERIEN 240

Query: 244 TKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKE 303
             +V +     K Y  F+R++   +  E ++A N+A+ + K LQ+ANGAV Y E+K    
Sbjct: 241 RVEVSMNAKEEKLYQSFERDMVLSIGEEELDAANAAALSNKLLQMANGAV-YGEDKKVIS 299

Query: 304 VHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIP 363
           +HD K+ ALE ++E AN  PI+VAY +  DL R+QK  P+ R +D     I +WN G+I 
Sbjct: 300 IHDRKLDALEDLVEAANGKPILVAYWYKHDLMRIQKRLPEARVIDTSK-DITDWNHGEIA 358

Query: 364 LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
           +   HPAS GHGLNLQ GG  +V+F L W LE +QQM  R+     RQ G K  V +++L
Sbjct: 359 IGLIHPASAGHGLNLQEGGCTIVWFGLTWSLELYQQMNARL----WRQ-GQKHTVVIHHL 413

Query: 424 IAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           I + T DE V++ L  K T Q  L++A++
Sbjct: 414 ITKGTHDEDVMKALEKKETGQSALIHAVR 442


>gi|284024515|ref|ZP_06378913.1| SNF2-related protein [Staphylococcus aureus subsp. aureus 132]
          Length = 452

 Score =  312 bits (800), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 174/456 (38%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 3   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S+I GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLILGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGT SPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTSSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI   ++  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHI--FKWELRDGSEEKIYKQIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           EE   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 297 EED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 355 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 445


>gi|254975145|ref|ZP_05271617.1| SNF2-related protein [Clostridium difficile QCD-66c26]
 gi|255092535|ref|ZP_05322013.1| SNF2-related protein [Clostridium difficile CIP 107932]
 gi|255314272|ref|ZP_05355855.1| SNF2-related protein [Clostridium difficile QCD-76w55]
 gi|255516952|ref|ZP_05384628.1| SNF2-related protein [Clostridium difficile QCD-97b34]
 gi|255650054|ref|ZP_05396956.1| SNF2-related protein [Clostridium difficile QCD-37x79]
 gi|260683194|ref|YP_003214479.1| phosphoribosylformimino-5-aminoimidazole carboxamide ribotide
           isomerase [Clostridium difficile CD196]
 gi|260686790|ref|YP_003217923.1| snf2-related protein [Clostridium difficile R20291]
 gi|306519589|ref|ZP_07405936.1| snf2-related protein [Clostridium difficile QCD-32g58]
 gi|260209357|emb|CBA62788.1| phosphoribosylformimino-5-aminoimidazole carboxamide ribotide
           isomerase [Clostridium difficile CD196]
 gi|260212806|emb|CBE03974.1| phosphoribosylformimino-5-aminoimidazole carboxamide ribotide
           isomerase [Clostridium difficile R20291]
          Length = 456

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 174/453 (38%), Positives = 266/453 (58%), Gaps = 16/453 (3%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLRVAQSVW 62
           P+Q   +   +D+    +   MG GKTV  LTA+S +    +    VLVIAPLRVA+  W
Sbjct: 7   PYQEYTIRKTIDNNNIGLLLDMGLGKTVCTLTAISELMYDYFDISKVLVIAPLRVARDTW 66

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
           +SEV++W +  H+ +S + G+   R + L T + +Y+IN E + W+V   K  WPF  +V
Sbjct: 67  SSEVKKWEHLKHLKVSKVLGSKLDRVRALSTDSDIYIINREMVPWIVDFYKRKWPFDMVV 126

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRL 182
           +DE +  KS +    ++  ++L K    ++R + LTGTP+PN LIDLW Q++ LD+G+RL
Sbjct: 127 IDELSSFKSNK----AQRFKSLKKVLPLTKRVVGLTGTPTPNSLIDLWAQMYLLDRGERL 182

Query: 183 GRVFQSFVARWFNTTQIGSHIGAV-RYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
           G+    +  R+F   Q     GA+  +  K  A+  I  ++ D C+SL   DY N+ + I
Sbjct: 183 GKTITGYKERYFEPGQKNYQTGAIYNWQPKNGAENAIHNKIKDICISLKAEDYLNMPRKI 242

Query: 242 LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
               ++ L   ++K Y + ++E   +L  + I A ++A    K LQLANGA+ YD +K+ 
Sbjct: 243 DNKIEIHLDSKILKYYKELEKEKILELDRDIITASSAAVAANKLLQLANGAI-YDNDKNV 301

Query: 302 KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFP--QGRTLDKDPCTIQEWNE 359
           KE+H EK++AL+ II+ +N  PIIV Y++  D  RL K F   + RT++ +   I +WN 
Sbjct: 302 KELHREKLEALKEIIDVSNGKPIIVFYNYKHDYNRLMKEFKSLKPRTIE-NSKDIYDWNN 360

Query: 360 GKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVF 419
           G+I LL  HPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+    QR+      V 
Sbjct: 361 GRIQLLLCHPASTGHGLNLQSGGSIIVWFGLTWSLELYQQANARLYRQGQRE-----TVI 415

Query: 420 VYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           +++LI + TIDE V++ +  K   Q  LL A+K
Sbjct: 416 IHHLICKGTIDEQVMEAIENKDKGQSALLEAVK 448


>gi|258427143|ref|ZP_05688065.1| SNF2 family protein [Staphylococcus aureus A9299]
 gi|257849921|gb|EEV73880.1| SNF2 family protein [Staphylococcus aureus A9299]
          Length = 455

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 172/456 (37%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  ++ ++++I  ++ D CLS+   DY N+
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYERIEDICLSMKAKDYLNM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PDRVDTKQTVVLSEKERKVYAELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 DED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|257428238|ref|ZP_05604636.1| SNF2 family protein [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257275079|gb|EEV06566.1| SNF2 family protein [Staphylococcus aureus subsp. aureus 65-1322]
          Length = 455

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 172/456 (37%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S+I GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLILGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  ++ ++++I  ++ D CLS+   DY ++
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYERIEDICLSMKAKDYLDM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 DED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|320530608|ref|ZP_08031660.1| protein, SNF2 family [Selenomonas artemidis F0399]
 gi|320137135|gb|EFW29065.1| protein, SNF2 family [Selenomonas artemidis F0399]
          Length = 429

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 169/429 (39%), Positives = 254/429 (59%), Gaps = 14/429 (3%)

Query: 26  MGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
           MG GKT+S LTA+S +    +  + VLVIAPLRVA S W  E + W++   + +SV  G+
Sbjct: 1   MGMGKTISTLTAISELMYDRFEVRRVLVIAPLRVAMSTWRDECELWAHTRGLRLSVAVGS 60

Query: 84  VKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARA 143
            ++R   L   A +YVIN EN+ WLV+  +  WPF  +V+DES+  K+      S+  +A
Sbjct: 61  AREREAALSKDADVYVINRENVKWLVERCRKDWPFDMVVIDESSSFKN----PASQRFKA 116

Query: 144 LAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHI 203
           L K     +R + LTGTP+PNGL+DLW Q + LD+G+RLG     +  R+F   Q   HI
Sbjct: 117 LRKVRPLVKRVVLLTGTPAPNGLMDLWSQFYLLDRGERLGHTLTEYRDRYFTPGQRSGHI 176

Query: 204 GAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRE 263
               Y  +  A K+I  +++D C+S+   DY ++   +     V LP+  M++Y + +RE
Sbjct: 177 -VYNYNLRPGADKKIYERINDICVSMKSDDYLSLPPLMQNVVTVTLPESAMRKYAEMERE 235

Query: 264 LYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAP 323
           L   +   +I A  +A+ T K LQ+ANG+V YDE+     +H+ K  AL+ II       
Sbjct: 236 LVLSIGASDITAVTAAALTGKLLQMANGSV-YDEDGEAVTIHEAKADALDEIIACNEGKS 294

Query: 324 IIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN 383
           ++  Y +  D A L +  P+ R L K P  I++WN GKI LL  HPAS GHGLNLQ+GG+
Sbjct: 295 VMAIYSYRHDRATLLRRHPEAREL-KTPEDIRDWNAGKISLLLVHPASAGHGLNLQHGGH 353

Query: 384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
           I+V++ L W LE++QQ  +R+      + G    V +++LIA++T+DE V++ L  KST 
Sbjct: 354 IVVWYGLTWSLEQYQQTNKRL-----HRPGQTEPVILHHLIAKDTVDEDVMRALERKSTG 408

Query: 444 QDLLLNALK 452
           Q+ +L A+K
Sbjct: 409 QEGMLQAVK 417


>gi|66395597|ref|YP_239997.1| ORF009 [Staphylococcus phage 3A]
 gi|62635943|gb|AAX91054.1| ORF009 [Staphylococcus phage 3A]
          Length = 455

 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 171/456 (37%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  ++ ++++I  ++ D CLS+   DY ++
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYERIEDICLSMKAKDYLDM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 DED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|308174984|ref|YP_003921689.1| SWI/SNF chromatin-remodeling complex subunit snf22 [Bacillus
           amyloliquefaciens DSM 7]
 gi|307607848|emb|CBI44219.1| SWI/SNF chromatin-remodeling complex subunit snf22 SWI/SNF complex
           subunit snf22; ATP-dependent helicase snf22 [Bacillus
           amyloliquefaciens DSM 7]
          Length = 451

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 178/456 (39%), Positives = 266/456 (58%), Gaps = 16/456 (3%)

Query: 1   MNLAPHQTK--IVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           M   PHQ +   +  I+D     ++  MG GKTVS LTA+S +    +   +VLVIAPLR
Sbjct: 1   MKFKPHQYQEHAIKHIIDTHAAGLFLDMGMGKTVSTLTAVSDLLYDYFDVSNVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W+ E ++W + S++ +S + G    R   L   A +YVIN EN+ WLV      W
Sbjct: 61  VAEDTWSRESEKWDHTSYLKVSKVLGPESSRIMALDMKADIYVINRENVEWLVNFYGKKW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +V+DE +  KS +    +K  RAL K     +R + LTGTP+PN LIDLW Q++ L
Sbjct: 121 PFDMVVIDELSSFKSSK----AKRFRALKKVRPFIKRIVGLTGTPAPNSLIDLWPQMYLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D+G+RLG+   S+  ++F   Q    +    +  KE A+K I  ++SD C+S+   D+  
Sbjct: 177 DQGERLGKTVTSYREKYFQPDQRNRTV-IYSWKLKEGAEKAIHEKVSDICISMQARDWLQ 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + I    KV +   V  +Y + +++L       ++ A  +A  + K LQLANGAV YD
Sbjct: 236 LPERIDNIVKVRMTDKVKAKYKQLEKDLLLPFLDGDVVADTAAVLSNKLLQLANGAV-YD 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           E    +++HDEK+ ALE I++ AN  PI+V Y +  DL R+Q+ F + + LD     I +
Sbjct: 295 ENGEIQKLHDEKLNALEDIVDAANGKPILVFYSYKHDLERIQQKFKKAKPLDS-SREIAD 353

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN GKI +L AHPAS GHGLNLQ GG+++V+F + W LE +QQ   R+     RQ G K 
Sbjct: 354 WNNGKIEMLLAHPASTGHGLNLQDGGHVIVWFGMTWSLELYQQANARL----DRQ-GQKH 408

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           +V V +L+ + T+DE V++ L  K+  Q+ L+ A+K
Sbjct: 409 SVIVNHLVTEGTVDEDVMRALEGKAVGQNALMEAVK 444


>gi|257432448|ref|ZP_05608811.1| SNF2 family protein [Staphylococcus aureus subsp. aureus E1410]
 gi|257283327|gb|EEV13459.1| SNF2 family protein [Staphylococcus aureus subsp. aureus E1410]
          Length = 455

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 171/456 (37%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNAALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  ++ ++++I  ++ D CLS+   DY ++
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYERIEDICLSMKAKDYLDM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 DED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|296276324|ref|ZP_06858831.1| SNF2 family protein [Staphylococcus aureus subsp. aureus MR1]
          Length = 455

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 171/456 (37%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 3   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  ++ ++++I  ++ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYERIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKVYAELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 297 DED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 355 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 445


>gi|304389862|ref|ZP_07371821.1| SNF2 domain protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|304327038|gb|EFL94277.1| SNF2 domain protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
          Length = 458

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 182/466 (39%), Positives = 263/466 (56%), Gaps = 27/466 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M+  PH  Q +   +I+DH   AI   MG GK+V  LTA+  + L  +    VLVIAPLR
Sbjct: 1   MHYQPHNYQRQATQYIIDHPEAAILLGMGLGKSVITLTAIWQLMLDYFTISRVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W++E+ +W +   + ++V  GT + R   L   A++ +IN EN+ WLV +L G+W
Sbjct: 61  VARDTWSAEIAKWDHLDGLAVAVAVGTKQDRLAALAKSAMVTIINRENIPWLVNQLNGSW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +V+DE +  K+ R    +K   AL K     +R++ LTGTP+ NGL+D+W Q   L
Sbjct: 121 PFDMVVIDELSSFKNHR----AKRFTALVKMRPFVKRWVGLTGTPASNGLMDVWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWF-----NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
           D G+RLGR    +  RWF     N  Q+ +      Y  +  A+ EI   + D  LS+  
Sbjct: 177 DGGERLGRFITRYRERWFVPDKRNGMQVFT------YKPRAGAEDEIYGAIGDMTLSMRT 230

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG 291
            D+  + +  + T  V L     K Y + + +L   L  E I+A N+A+ + K LQLA+G
Sbjct: 231 TDHLQLPELTVTTTSVKLEPKERKVYEQLKADLVLQLGDETIDAANAAALSGKLLQLASG 290

Query: 292 AVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP 351
           A+Y   +  W  VHD K+ ALE ++E  N  P++VAY F  D  R+   FPQ R L K  
Sbjct: 291 AIYTG-DGDWASVHDRKLDALEDLVEATNGNPLLVAYWFTHDRERITARFPQAREL-KTS 348

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             I+ WN+G+I     HPAS GHGLNLQ GG++LV+FSL W LE +QQ   R+   RQ Q
Sbjct: 349 ADIEAWNKGEITFGLIHPASAGHGLNLQAGGHLLVWFSLTWSLELYQQTNARL--YRQGQ 406

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIH 457
           +     V + +L+A+ T+DE VL+ L  K   Q  L+NA+ +E IH
Sbjct: 407 S---EPVTITHLVAEGTLDEAVLRALDVKDATQAALINAVAQE-IH 448


>gi|66395664|ref|YP_240070.1| ORF008 [Staphylococcus phage 47]
 gi|88195255|ref|YP_500058.1| SNF2 family protein [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|258445562|ref|ZP_05693744.1| phage helicase [Staphylococcus aureus A6300]
 gi|258455568|ref|ZP_05703525.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|297207823|ref|ZP_06924257.1| SNF2 domain protein [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|62636088|gb|AAX91199.1| ORF008 [Staphylococcus phage 47]
 gi|87202813|gb|ABD30623.1| SNF2 family N-terminal domain protein [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|257855609|gb|EEV78542.1| phage helicase [Staphylococcus aureus A6300]
 gi|257862256|gb|EEV85027.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|296887539|gb|EFH26438.1| SNF2 domain protein [Staphylococcus aureus subsp. aureus ATCC
           51811]
          Length = 455

 Score =  309 bits (792), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 171/456 (37%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  ++ ++++I  ++ D CLS+   DY ++
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYERIEDICLSMKAKDYLDM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PDRVDTKQTVVLSEKERKVYAELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 DED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|315128428|gb|EFT84436.1| SNF2 family N-terminal domain protein [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329729408|gb|EGG65813.1| SNF2 family N-terminal domain protein [Staphylococcus aureus subsp.
           aureus 21189]
          Length = 452

 Score =  309 bits (792), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 171/456 (37%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 3   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  ++ ++++I  ++ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYERIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKVYAELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 297 DED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 355 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 445


>gi|300933478|ref|ZP_07148734.1| phage-associated protein [Corynebacterium resistens DSM 45100]
          Length = 453

 Score =  309 bits (791), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 183/460 (39%), Positives = 257/460 (55%), Gaps = 26/460 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q +   ++ DH +  I   MG GKTV  LTA+  + L  +  + VL++APLR
Sbjct: 1   MRYEPHDYQRQATQFVEDHPQAVILLGMGLGKTVITLTAIWNLLLDSFQARRVLIVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E  +W + + + I+V  G+  QR   L   A++ VIN EN+ WLV+ L  TW
Sbjct: 61  VARDTWPAEATKWDHLAGLTIAVAVGSKSQRVDALAAEAMVTVINRENVPWLVKHLGNTW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +V+DE +  K+ R    ++  +ALA       R + LTGTP+ NGL+DLW Q   L
Sbjct: 121 PFDMVVIDELSSFKNHR----AQRFKALAAVRPRLTRIVGLTGTPAANGLMDLWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWF-----NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
           D+G+RLGR    +  RWF     N  QI +      Y     A+ EI   +SD  LS+  
Sbjct: 177 DEGQRLGRFITHYRNRWFVPDRRNGQQIFT------YKPAPGAEDEIYEAISDITLSMRT 230

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG 291
            DY  + +  + T  V L     K Y + + E+  DL G+ I+A N+A+ + K LQLA+G
Sbjct: 231 TDYLRLPELTVTTTLVDLEPKERKAYERLRDEMVLDLDGQVIDAANAAALSGKLLQLASG 290

Query: 292 AVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP 351
           A+ YDE+ +   VHD K+ ALE ++E AN  P++VAY F  D  R+   FP  R L    
Sbjct: 291 AI-YDEDGNTVVVHDRKLDALEDLVEAANGQPLLVAYWFKHDRERITTRFPGARELTTS- 348

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             I +WN  ++PL   HPAS GHGLNLQ GGN+LV+FSL W LE +QQ   R+     RQ
Sbjct: 349 ADITQWNAREVPLALIHPASAGHGLNLQQGGNLLVWFSLTWSLELYQQTNARL----YRQ 404

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNAL 451
            G  + V + +L A +T+DE VL  L  K   Q  L+NA+
Sbjct: 405 -GQDQPVTITHLAADHTLDEAVLAALDNKDMTQAALINAV 443


>gi|87160506|ref|YP_494105.1| phage helicase [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|87126480|gb|ABD20994.1| phage helicase [Staphylococcus aureus subsp. aureus USA300_FPR3757]
          Length = 423

 Score =  306 bits (783), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 170/429 (39%), Positives = 253/429 (58%), Gaps = 15/429 (3%)

Query: 26  MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK 85
           MG GKTVS LTA S + L   K +LVIAP +VA+  W  EV +W++ +H+ +S++ GT K
Sbjct: 1   MGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVAKDTWVDEVDKWNHLNHLKVSLVLGTPK 60

Query: 86  QRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
           +R   L T A +YV N EN  WL  + K  WPF  +V+DE +  KS +    S+  +++ 
Sbjct: 61  ERNDALNTEADIYVTNKENTKWLCDQYKKEWPFDMVVIDELSTFKSPK----SQRFKSIK 116

Query: 146 KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTT-QIGSHIG 204
           K      RFI LTGTPSPN L DLW Q++ +D+G+RL   F  +  R+F  T Q+  HI 
Sbjct: 117 KKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDRGERLESSFSRYRERYFKPTHQVSEHI- 175

Query: 205 AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQREL 264
             ++  ++ ++++I  Q+ D CLS+   DY ++   +   + V L +   K Y + ++  
Sbjct: 176 -FKWELRDGSEEKIYKQIEDICLSMKAKDYLDMPDRVDTKQTVVLSEKERKVYEELEKNY 234

Query: 265 YCDLQGE-NIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAP 323
             + + E  + A N AS + K LQL+NGAVY DEE   + +HD+K+  LE IIE++   P
Sbjct: 235 ILESEEEGTVVAQNGASLSQKLLQLSNGAVYTDEED-VRLIHDKKLDKLEEIIEESQGQP 293

Query: 324 IIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN 383
           I++ Y+F  D  R+ + F +  TLD D    + WN G I LL AHPAS GHGLNLQ GG+
Sbjct: 294 ILLFYNFKHDKERILQRFKEATTLD-DSNYKERWNSGDIKLLIAHPASAGHGLNLQQGGH 352

Query: 384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
           I+V+F L W LE +QQ   R+   RQ   G      +++++  NTID+ V + L+ K   
Sbjct: 353 IIVWFGLTWSLELYQQANARL--YRQ---GQNHTTIIHHIMTDNTIDQRVYKALQNKELT 407

Query: 444 QDLLLNALK 452
           Q+ L+ A+K
Sbjct: 408 QEELMKAIK 416


>gi|293400001|ref|ZP_06644147.1| SNF2 domain protein [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306401|gb|EFE47644.1| SNF2 domain protein [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 446

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 181/461 (39%), Positives = 270/461 (58%), Gaps = 28/461 (6%)

Query: 5   PH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLRVAQS 60
           PH  Q K   W+LDH +  ++  MG GKT   LTA+  +   ++  K VL+IAP+RVAQ+
Sbjct: 2   PHEYQDKAKKWVLDHPKSGLFLPMGMGKTSITLTAIEDLMYDMFQVKKVLIIAPIRVAQT 61

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            W  E+++W +  HM  S + G+ +QR K L+  A +Y+IN EN+ WLV E+   WPF  
Sbjct: 62  TWPDEIEKWDHTRHMTYSRVLGSKEQRMKGLEEKADIYLINRENVPWLVDEVDHDWPFDM 121

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           +V+DE +  K+ +    +K  +AL K     ERFI LTGTP+P GL DLW Q++ +D+GK
Sbjct: 122 VVIDELSSFKNPK----AKRFKALRKVIPLVERFIGLTGTPAPKGLPDLWPQLYLMDQGK 177

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYT--AKETAQKEIEAQLSDCCLSLDIADYQNID 238
           RLG+   SF +R+      G   G V Y    ++ A++ I   + D C+SL   D+  + 
Sbjct: 178 RLGKTLTSFRSRFLIP---GRRNGNVIYEWLLQDGAKRRIYDVIGDICMSLKAEDWLKLP 234

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQGEN-IEAFNSASKTVKCLQLANGAVYYDE 297
           +   I  +  L +  M  YH+F+RE    +  +  I A N+   T K LQ   GAV YDE
Sbjct: 235 ECQYINHEAILDEKTMVAYHRFKREKILQICEDGVITAANAGVVTNKLLQFTAGAV-YDE 293

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFP--QGRTLDKDPC--T 353
               +E+HD K+KALE ++E AN  P++V Y+F  D  R+   FP  + R ++   C   
Sbjct: 294 NHEVQELHDTKLKALEDLLEAANGNPVMVFYYFKHDRDRIIDHFPDVEIRAIE---CQQD 350

Query: 354 IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLW-WDLEEHQQMIERIGVTRQRQA 412
           +++WN+GKI +L  HPAS GHGLNLQ GGNI+++++L  W+LE + Q   R+     RQ 
Sbjct: 351 VKDWNDGKIEMLLVHPASVGHGLNLQQGGNIIIWYTLPNWNLELYLQANARL----HRQ- 405

Query: 413 GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           G +  V +Y+LIA+ T+DE +++ L  K   Q  L+ ALK+
Sbjct: 406 GQQNTVMIYHLIAKGTVDEDMIRSLEQKDISQKTLIEALKR 446


>gi|328913305|gb|AEB64901.1| SWI/SNF chromatin-remodeling complex subunit snf22 SWI/SNF complex
           subunit snf22; ATP-dependent helicase snf22 [Bacillus
           amyloliquefaciens LL3]
          Length = 424

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 173/429 (40%), Positives = 256/429 (59%), Gaps = 14/429 (3%)

Query: 26  MGSGKTVSVLTALSYI--HLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
           MG GKTVS LTA+S +    +   +VLVIAPLRVA+  W+ E ++W + S++ +S + G 
Sbjct: 1   MGMGKTVSTLTAVSDLLYDYFDVSNVLVIAPLRVAEDTWSRESEKWDHTSYLKVSKVLGP 60

Query: 84  VKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARA 143
              R   L   A +YVIN EN+ WLV      WPF  +V+DE +  KS +    +K  RA
Sbjct: 61  ESSRIMALDMKADIYVINRENVEWLVNFYGKKWPFDMVVIDELSSFKSSK----AKRFRA 116

Query: 144 LAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHI 203
           L K     +R + LTGTP+PN LIDLW Q++ LD+G+RLG+   S+  ++F   Q    +
Sbjct: 117 LKKVRPFIKRIVGLTGTPAPNSLIDLWPQMYLLDQGERLGKTVTSYREKYFQPDQRNRTV 176

Query: 204 GAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRE 263
               +  KE A+K I  ++SD C+S+   D+  + + I    KV +   V  +Y + +++
Sbjct: 177 -IYSWKLKEGAEKAIHEKVSDICISMQARDWLQLPERIDNIVKVRMTDKVKAKYKQLEKD 235

Query: 264 LYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAP 323
           L       ++ A  +A  + K LQLANGAV YDE    +++HDEK+ ALE I++ AN  P
Sbjct: 236 LLLPFLDGDVVADTAAVLSNKLLQLANGAV-YDENGEIQKLHDEKLNALEDIVDAANGKP 294

Query: 324 IIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN 383
           I+V Y +  DL R+Q+ F + +TLD     I +WN GKI +L AHPAS GHGLNLQ GG+
Sbjct: 295 ILVFYSYKHDLERIQQKFKKAKTLDS-SREIADWNNGKIEMLLAHPASTGHGLNLQDGGH 353

Query: 384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
           ++V+F + W LE +QQ   R+     RQ G K +V V +L+ + T+DE V++ L  K+  
Sbjct: 354 VIVWFGMTWSLELYQQANARL----DRQ-GQKHSVIVNHLVTEGTVDEDVMRALEGKAVG 408

Query: 444 QDLLLNALK 452
           Q+ L+ A+K
Sbjct: 409 QNALMEAVK 417


>gi|253581729|ref|ZP_04858953.1| SNF2 domain-containing protein [Fusobacterium varium ATCC 27725]
 gi|251836078|gb|EES64615.1| SNF2 domain-containing protein [Fusobacterium varium ATCC 27725]
          Length = 459

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 175/461 (37%), Positives = 273/461 (59%), Gaps = 22/461 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q   +D +L   +  +   MG GKTV  L+A++ +    +    VLVIAP +
Sbjct: 3   MKFIPHGYQQYCIDRMLTDDKLGLMLDMGLGKTVITLSAIADLRFNRFLINKVLVIAPKK 62

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA++ W+ E ++W +   + I  I G+ ++R K L TP  +YVIN EN+ WLV+  +  W
Sbjct: 63  VAEATWSKEAEKWDHLKLLRIVPILGSSQKRIKALNTPGDIYVINRENVVWLVEYTRNNW 122

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +VVDE +  KS +    +K  +AL       +RF+ LTGTP+PNGL+DLW QI+ L
Sbjct: 123 PFDMVVVDEFSSFKSHQ----AKRFKALTWVRKHIQRFVGLTGTPTPNGLMDLWAQIYLL 178

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D+G+RLG+    +  R+F+  Q   ++   +Y  KE A + I+ ++SD C+S+   DY  
Sbjct: 179 DQGERLGKFISHYRERYFDPGQRDRNV-IFKYDLKEGAAESIQEKISDICISMKAEDYLQ 237

Query: 237 IDKPILITKKVP--LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
           +  P +    VP  L    MK+Y + ++++  +L+ + I+  ++A+ + K +QLANGA+ 
Sbjct: 238 L--PDITFNNVPVVLDSKAMKEYEELEKKMILELEDKTIDVTSAAALSNKLMQLANGAI- 294

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
           YDE +   EVH+ KI+A   +IEK N    +V Y+F  DLARLQ+A  +     +   T+
Sbjct: 295 YDENRGIHEVHNCKIEAFMELIEKLNGKAALVFYNFQHDLARLQEALKKTGLKVRILKTV 354

Query: 355 QE---WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
           ++   WN+ +I +L  HPAS  +GLNLQ GGN +++F L W LE +QQ  +R+     RQ
Sbjct: 355 EDQDAWNKKEIDILLTHPASSAYGLNLQEGGNHVIWFGLNWSLELYQQANKRL----HRQ 410

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            G K  V V++L+ Q+T DE V++ L TK  +Q+ LL +LK
Sbjct: 411 -GQKEKVIVHHLVVQDTRDEDVIKALNTKGDVQEALLESLK 450


>gi|217965845|ref|YP_002351523.1| SNF2 domain protein [Listeria monocytogenes HCC23]
 gi|217335115|gb|ACK40909.1| SNF2 domain protein [Listeria monocytogenes HCC23]
 gi|307569607|emb|CAR82786.1| SNF2/RAD54 helicase family protein [Listeria monocytogenes L99]
          Length = 463

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 170/450 (37%), Positives = 271/450 (60%), Gaps = 14/450 (3%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLRVAQSVWT 63
           +Q   ++ I    +C ++  MG GKTV+ LTA++ +  +L     VLVIAPLRVA+  W+
Sbjct: 12  YQEYAINKITASPKCGLFLDMGMGKTVTTLTAIAGLMYNLLEVNKVLVIAPLRVAEDTWS 71

Query: 64  SEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVV 123
            E ++WS+ + + +S I G  + R + L   A +YVIN ENL WLV  L   W F  +VV
Sbjct: 72  RETEKWSHTAFLQVSKILGPAECRKEALNQRADIYVINRENLAWLVDHLGKNWDFDMVVV 131

Query: 124 DESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLG 183
           DE +  K+ +    S+  +AL K   + +R + LTGTP+PN L+DLW QI+ LD+G+RLG
Sbjct: 132 DEFSSFKNSK----SQRFKALRKVLPKIKRLVGLTGTPAPNTLLDLWPQIYLLDRGERLG 187

Query: 184 RVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILI 243
           +  ++++ ++F       H+    +  K  A+  I   +SD C+S+   D+  + + I  
Sbjct: 188 KTKRAYLDKYFTPGARNGHV-IFEWRLKNGAEDRIHQHISDICVSMKAEDWLEMPERIDN 246

Query: 244 TKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKE 303
           T  + LP     QY + ++E   + +  ++ A ++A  + K LQLANGA+ YDE + ++E
Sbjct: 247 TISIKLPSKARAQYSELEKEFLLEFEHSDVVADSAAVLSNKLLQLANGAI-YDENQEYQE 305

Query: 304 VHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLD-KDPCTIQEWNEGKI 362
           +H++K++AL  IIE++   P++V Y +  D  R+     Q +    KD  +I++WN GK 
Sbjct: 306 IHNKKLEALADIIEESVGQPVLVFYSYKHDEKRILNHLKQYKPEKIKDSRSIRKWNAGKT 365

Query: 363 PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
            +L AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G K++V V++
Sbjct: 366 RVLLAHPASAGHGLNLQDGGHIVVWFGLTWSLELYQQANARL--FRQ---GQKKSVIVHH 420

Query: 423 LIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           ++A++T+DE V++ L +K   QD LL A+K
Sbjct: 421 IVAKDTLDEKVIEALSSKKVGQDALLEAVK 450


>gi|297585287|ref|YP_003701067.1| SNF2-like protein [Bacillus selenitireducens MLS10]
 gi|297143744|gb|ADI00502.1| SNF2-related protein [Bacillus selenitireducens MLS10]
          Length = 460

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 179/460 (38%), Positives = 268/460 (58%), Gaps = 22/460 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           MN  P+  Q     W+++     ++  MG GKTV  LTA+  +    +    VL+IAPLR
Sbjct: 1   MNYTPYHYQEMAKTWMMERAYAGLFLDMGMGKTVITLTAIDDLLYDYFDVSRVLIIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  WT EV++WS+ + + ++ I G++K+R   L     + VIN EN+ WLV  L   W
Sbjct: 61  VARVTWTEEVEKWSHLNDLKVTKILGSLKERKAALDDVGQVAVINRENVTWLVDYLGKDW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE +  KS +    +K  R+L K     +R + LTGTPSPN L+DLW QI+ L
Sbjct: 121 LFDMVVIDELSSFKSSK----AKRFRSLKKVRPFIKRLVGLTGTPSPNSLLDLWPQIYLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D+G+RLGR F  F  R+F   +         +  KE ++ +I   L D C+S+  +DY +
Sbjct: 177 DQGERLGRTFSGFRERYFLPDKRNQQT-IFSWKLKEGSEHQIYELLEDLCISMKASDYLD 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + I  T  V LP    + Y + ++E     +  ++ A ++A    K LQLANGA+ YD
Sbjct: 236 VPERIDNTVPVELPPKAKRAYTQLEKEWLLAFEDADVLAGSAAVVANKLLQLANGAI-YD 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARL---QKAF-PQGRTLDKDPC 352
           E    +EVHDEK++AL+ +IE AN  P++V Y++  D  R+    KAF P+    D+D  
Sbjct: 295 ETGDVQEVHDEKLEALKELIESANGKPVLVYYNYQHDRDRILKHLKAFKPRVLKTDQD-- 352

Query: 353 TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQA 412
            I++WN+G +P+L AHPAS GHGLNLQ GG+++V+F L W LE +QQ   R+     RQ 
Sbjct: 353 -IRDWNKGNVPVLLAHPASAGHGLNLQAGGHVMVWFGLNWSLELYQQANARL----HRQ- 406

Query: 413 GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           G    V V++LI + T+DE V+  L+ K T Q+ L+ A+K
Sbjct: 407 GQTETVVVHHLITKGTMDERVMAALKQKDTSQEALIAAVK 446


>gi|50843064|ref|YP_056291.1| phage-associated protein [Propionibacterium acnes KPA171202]
 gi|50840666|gb|AAT83333.1| conserved phage-associated protein [Propionibacterium acnes
           KPA171202]
 gi|315106939|gb|EFT78915.1| protein, SNF2 family [Propionibacterium acnes HL030PA1]
          Length = 458

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 182/463 (39%), Positives = 258/463 (55%), Gaps = 26/463 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q     +ILDH   AI   MG GK+V  LTA+  + L  +    VLV+APLR
Sbjct: 1   MRYRPHNYQQTATRFILDHHEAAILLGMGLGKSVITLTAIWQLLLDYFTVSRVLVVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +EV +W +   ++++V  GT   R   L   A++ VIN EN+ WLV++   +W
Sbjct: 61  VARDTWPAEVAKWDHLQGLSVAVAVGTKADRLDALAKSAMVTVINRENIPWLVRQYGDSW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +V+DE +  K+ R    +K   AL K     +R++ LTGTP+ NGL+D+W Q   L
Sbjct: 121 PFDMVVIDELSSFKNHR----AKRFTALVKMRPHVKRWVGLTGTPASNGLMDIWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWF-----NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
           D G+RLGR    +  +WF     N  Q+ +      Y  +  A++EI   ++D  LS+  
Sbjct: 177 DGGQRLGRFITRYRDKWFLPDKRNGMQVFT------YKPRAGAEEEIYDAIADMTLSMRT 230

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG 291
            D+  +    + T  V L       Y + + +L  DL G+ ++A N+A+ + K LQLA+G
Sbjct: 231 TDHLTLPDLTVTTTPVVLGAGERAVYEQLKADLVVDLDGQVVDAANAAALSGKLLQLASG 290

Query: 292 AVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP 351
           A+ YDE     EVH  K+ ALE IIE AN   ++VAY +  D  R+Q+ FPQ R L K  
Sbjct: 291 AI-YDEHGDTVEVHGAKLDALEDIIEAANGQTVLVAYWYRHDRERIQRRFPQAREL-KTS 348

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             I+ WN G IPL   HPAS GHGLNLQ GG++LV+FSL W LE +QQ   R+   RQ Q
Sbjct: 349 ADIEAWNRGDIPLGLIHPASAGHGLNLQSGGHLLVWFSLTWSLELYQQTNARL--YRQGQ 406

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           A     V + +L A  T+D+ VL+ L  K   Q  L++A+  E
Sbjct: 407 A---EPVTITHLTATGTLDQAVLKALEAKDMTQAALIDAVATE 446


>gi|209363583|ref|YP_002268001.1| phage helicase [Staphylococcus phage phi2958PVL]
 gi|208973084|dbj|BAG74400.1| phage helicase [Staphylococcus phage phi2958PVL]
          Length = 423

 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 169/429 (39%), Positives = 253/429 (58%), Gaps = 15/429 (3%)

Query: 26  MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK 85
           MG GKTVS LTA S + L   K +LVIAP +VA+  W  EV +W++ +H+ +S++ GT K
Sbjct: 1   MGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVAKDTWVDEVDKWNHLNHLKVSLVLGTPK 60

Query: 86  QRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
           +R   L T A +YV N EN  WL  + K  WPF  +V+DE +  KS +    S+  +++ 
Sbjct: 61  ERNDALNTEADIYVTNKENTKWLCDQYKKEWPFDMVVIDELSTFKSPK----SQRFKSIK 116

Query: 146 KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTT-QIGSHIG 204
           K      RFI LTGTPSPN L DLW Q++ +D+G+RL   F  +  R+F  T Q+  HI 
Sbjct: 117 KKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDRGERLESSFSRYRERYFKPTHQVSEHI- 175

Query: 205 AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQREL 264
             ++  ++ ++++I  Q+ D CLS+   DY ++   +   + V L +   K Y + ++  
Sbjct: 176 -FKWELRDGSEEKIYKQIEDICLSMKAKDYLDMPDRVDTKQTVVLSEKERKVYEELEKNY 234

Query: 265 YCDLQGE-NIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAP 323
             + + E  + A N AS + K LQL+NGAVY DEE   + +HD+K+  LE IIE++   P
Sbjct: 235 ILESEEEGTVVAQNGASLSQKLLQLSNGAVYTDEED-VRLIHDKKLDKLEEIIEESQGQP 293

Query: 324 IIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN 383
           I++ Y+F  D  R+ + F +  TL+ D    + WN G I LL AHPAS GHGLNLQ GG+
Sbjct: 294 ILLFYNFKHDKERILQRFKEATTLE-DSNYKERWNSGDIKLLIAHPASAGHGLNLQQGGH 352

Query: 384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
           I+V+F L W LE +QQ   R+   RQ   G      +++++  NTID+ V + L+ K   
Sbjct: 353 IIVWFGLTWSLELYQQANARL--YRQ---GQNHTTIIHHIMTDNTIDQRVYKALQNKELT 407

Query: 444 QDLLLNALK 452
           Q+ L+ A+K
Sbjct: 408 QEELMKAIK 416


>gi|312438077|gb|ADQ77148.1| SNF2 domain protein [Staphylococcus aureus subsp. aureus TCH60]
          Length = 455

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 174/456 (38%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNAALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI    +  ++ ++++I  ++ D CLS+   D+ N+
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHI--FNWELRDGSEEKIYERIEDICLSMKAKDFLNM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
            + I   + V L     K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PERIDTKQTVALSDKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 DED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              ++++I  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIITDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|302873665|ref|YP_003842298.1| SNF2-related protein [Clostridium cellulovorans 743B]
 gi|307686611|ref|ZP_07629057.1| SNF2-related protein [Clostridium cellulovorans 743B]
 gi|302576522|gb|ADL50534.1| SNF2-related protein [Clostridium cellulovorans 743B]
          Length = 457

 Score =  303 bits (776), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 182/461 (39%), Positives = 267/461 (57%), Gaps = 24/461 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTAL-SYIHLWGEKS-VLVIAPLR 56
           M   PH  Q    +WI++    A++  +G GKTV  LTA    +H + + S VLVIAPLR
Sbjct: 1   MIYKPHNYQEYAKEWIIEKPSSALFLDLGMGKTVCTLTATQELLHDYFDVSKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W+SEV++W + +++ IS I G  K R   L+  + +YV+N EN+ WLV  L   W
Sbjct: 61  VAEDTWSSEVEKWEHLNYLKISKILGKEKTRVDALREKSDIYVVNRENVEWLVGYLGKAW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE +  KS +    +   +AL K     ++ + LTGTP+PNGL+DLW Q++ L
Sbjct: 121 FFDMVVIDELSSFKSPK----ANRFKALKKVRPFIKKLVGLTGTPAPNGLLDLWSQVYLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLG+   S+  ++F   +    I    +   + A+  I   + D C+S+   DY  
Sbjct: 177 DGGERLGKTLTSYRDKYFKPDKRNQSI-IFSWKPVDGAEDSIYEGIKDICISMKATDYLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + I  +  V LP+    +Y K ++EL    +  ++ A  +A  + K LQ+ANGAV YD
Sbjct: 236 LPERINNSITVQLPKTAEVKYKKLEKELLLPFEEADVVANTAAVLSNKLLQMANGAV-YD 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARL-----QKAFPQGRTLDKDP 351
           E    KE+H+EK+KAL+ +IE AN   I+V Y +  DL RL      KAF    T  KD 
Sbjct: 295 ENGEVKEIHNEKLKALDDVIEAANGKSILVFYSYKHDLERLSKHLKNKAFKVLNT-SKD- 352

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             I++WN+GKIP++  HPAS GHGLNLQ+GGNI+V+F L W LE +QQ   R+   RQ Q
Sbjct: 353 --IEKWNKGKIPIMLVHPASAGHGLNLQFGGNIIVWFGLTWSLELYQQANARL--YRQGQ 408

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
               + V V ++IA+ TIDE V++ L  K   Q  L+ A+K
Sbjct: 409 T---QGVIVNHIIAKGTIDEEVMKALENKEKGQSTLIEAVK 446


>gi|70726780|ref|YP_253694.1| hypothetical protein SH1779 [Staphylococcus haemolyticus JCSC1435]
 gi|68447504|dbj|BAE05088.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 452

 Score =  303 bits (775), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 174/458 (37%), Positives = 260/458 (56%), Gaps = 21/458 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           +   PH  Q   +D ++++++  ++  M  GKTVS LTA S + L   + +LVIAPL VA
Sbjct: 3   ITFQPHSYQKHAIDKVIENEKYGLFLDMVLGKTVSTLTAFSELQLLDTEKMLVIAPLNVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  E+ +W +  H+ +S I GT KQR   L   A +Y+ N EN  WL ++ K  WPF
Sbjct: 63  KDTWADEISKWEHLKHLRVSKILGTPKQRLAALNKDADIYITNKENTKWLCEQYKKDWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  K+      S+  +A+ K     +RF+ LTGTPSPN L+DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKN----PSSQRFKAIKKKLPLVKRFVGLTGTPSPNSLLDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  +E ++  I  Q+ D  LS+  +DY N+
Sbjct: 179 GERLETAFSRYRERYFRATHQVSDHV--YNWELREGSEDLIYKQIEDIALSMKASDYLNM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE---NIEAFNSASKTVKCLQLANGAVY 294
            + I   + V L     K Y + ++  Y  L+ E    I A + AS + K LQL+NGAVY
Sbjct: 237 PERIDTKQVVTLSNKERKLYDELEK--YYILEDETDGTIVAQSGASLSQKILQLSNGAVY 294

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
            D+E   + +HD K+  LE II++A   PI++ Y+F  D  R+ + F    TLD D    
Sbjct: 295 TDDED-VRHIHDRKLDKLEEIIDEAQGQPILLFYNFKHDRDRILERFDDVLTLD-DKGYK 352

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
            +WN GK  +L AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q   
Sbjct: 353 DKWNSGKAKILLAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQGQT-- 408

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
                +++++  NTID+ V Q L+ K   QD L+ A+K
Sbjct: 409 -HTTIIHHIMTDNTIDQRVYQALQNKELTQDELMKAIK 445


>gi|313813466|gb|EFS51180.1| protein, SNF2 family [Propionibacterium acnes HL025PA1]
          Length = 458

 Score =  302 bits (774), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 181/463 (39%), Positives = 258/463 (55%), Gaps = 26/463 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q     +ILDH   AI   MG GK+V  LTA+  + L  +    VLV+APLR
Sbjct: 1   MRYRPHNYQQTATRFILDHHEAAILLGMGLGKSVITLTAIWQLLLDYFTVSRVLVVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W ++V +W +   ++++V  GT   R   L   A++ VIN EN+ WLV++   +W
Sbjct: 61  VARDTWPAQVAKWDHLQGLSVAVAVGTKADRLDALAKSAMVTVINRENIPWLVRQYGDSW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +V+DE +  K+ R    +K   AL K     +R++ LTGTP+ NGL+D+W Q   L
Sbjct: 121 PFDMVVIDELSSFKNHR----AKRFTALVKMRPHVKRWVGLTGTPASNGLMDIWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWF-----NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
           D G+RLGR    +  +WF     N  Q+ +      Y  +  A++EI   ++D  LS+  
Sbjct: 177 DGGQRLGRFITRYRDKWFLPDKRNGMQVFT------YKPRAGAEEEIYDAIADMTLSMRT 230

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG 291
            D+  +    + T  V L       Y + + +L  DL G+ ++A N+A+ + K LQLA+G
Sbjct: 231 TDHLTLPDLTVTTTPVVLGAGERAVYEQLKADLVVDLDGQVVDAANAAALSGKLLQLASG 290

Query: 292 AVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP 351
           A+ YDE     EVH  K+ ALE IIE AN   ++VAY +  D  R+Q+ FPQ R L K  
Sbjct: 291 AI-YDEHGDTVEVHGAKLDALEDIIEAANGQTVLVAYWYRHDRERIQRRFPQAREL-KTS 348

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             I+ WN G IPL   HPAS GHGLNLQ GG++LV+FSL W LE +QQ   R+   RQ Q
Sbjct: 349 ADIEAWNRGDIPLGLIHPASAGHGLNLQSGGHLLVWFSLTWSLELYQQTNARL--YRQGQ 406

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           A     V + +L A  T+D+ VL+ L  K   Q  L++A+  E
Sbjct: 407 A---EPVTITHLTATGTLDQAVLKALEAKDMTQAALIDAVATE 446


>gi|303239099|ref|ZP_07325629.1| SNF2-related protein [Acetivibrio cellulolyticus CD2]
 gi|302593437|gb|EFL63155.1| SNF2-related protein [Acetivibrio cellulolyticus CD2]
          Length = 452

 Score =  302 bits (774), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 177/456 (38%), Positives = 260/456 (57%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           M   PH  Q    D+I+D    A+   +G GKTV  LTA++ +    +  K VLVIAPLR
Sbjct: 1   MIYEPHDYQKYAHDFIIDKPASALLLDLGLGKTVITLTAINELLYDSFEVKRVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VAQ  W  E Q+W +   + IS I G  ++R K + T A +Y+IN EN+ WLV   KG+W
Sbjct: 61  VAQDTWGRECQKWDHLKQLRISKILGNEEKRIKAVNTKADIYIINRENVEWLVDLYKGSW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           P+  +VVDE +  KS      +K  RAL K     +R + LTGTP+PNGLIDLW Q++ L
Sbjct: 121 PYDMVVVDELSSFKS----ATAKRFRALRKVRPYIKRIVGLTGTPAPNGLIDLWSQVYLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D+G+RL +    +  ++F   +   ++    Y  K+ A++EI  ++SD C+S+   D+  
Sbjct: 177 DRGERLEKTLGGYREKYFLPDKRSQNV-IFSYKPKDGAEREIYRKISDICISMKACDHLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + I     V + +   + Y K +RE        +++A N+A    K LQ++NGAV YD
Sbjct: 236 MPERIDNFVPVHMSEKEEELYRKLEREALLPFVDGDVDAVNAAVLAGKLLQMSNGAV-YD 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           E    + +H  K++ LE +IE AN  P++V Y +  D  R+ KAF + R +D  P  I +
Sbjct: 295 ENGGVRSIHRRKLEMLEDLIESANGKPVLVYYAYKHDRERILKAF-KARDIDT-PKDISD 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN+G+I +  AHPAS GHGLNLQ GG+ +++F L W LE +QQ   RI     RQ G   
Sbjct: 353 WNDGRIGIAIAHPASAGHGLNLQAGGSTIIWFGLTWSLELYQQANGRI----HRQ-GQTE 407

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V V ++I   T+DE V+  L  K T Q  L+NA++
Sbjct: 408 TVIVNHIITAGTMDEQVMAALNRKETGQTALINAVR 443


>gi|282911093|ref|ZP_06318895.1| SNF2 family protein [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282324788|gb|EFB55098.1| SNF2 family protein [Staphylococcus aureus subsp. aureus WBG10049]
          Length = 455

 Score =  302 bits (773), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 173/456 (37%), Positives = 266/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L     +LVIAP +VA
Sbjct: 6   IDFKPHNYQKYAIDKVIDNEKFGLFLDMGLGKTVSTLTAFSQLQLLDTDKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNAALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI    +  ++ ++++I  ++ D CLS+   D+ N+
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEHI--FNWELRDGSEEKIYERIEDICLSMKAKDFLNM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
            + I   + V L     K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PERIDTKQTVALSDKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD+K+  LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 DED-VRLIHDKKLDKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              ++++I  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIITDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|315656930|ref|ZP_07909817.1| SNF2 domain protein [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|315492885|gb|EFU82489.1| SNF2 domain protein [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 458

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 181/466 (38%), Positives = 263/466 (56%), Gaps = 27/466 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M+  PH  Q+   ++I+DH   AI   MG GK+V  LTA+  + L  +    VLV+APLR
Sbjct: 1   MHYTPHNYQSTATEFIIDHDEAAILLGMGLGKSVITLTAIWQLMLDYFTISRVLVVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+++W +   + ++V  GT   R   L   A++ +IN EN+ WLV ++ G+W
Sbjct: 61  VARDTWPAEIRKWDHLDGLTVAVAVGTKADRLAALAKSAIVTIINRENIPWLVNQMGGSW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +V+DE +  K+ R    +K   AL K     +R++ LTGTP+ NGL+D+W Q   L
Sbjct: 121 PFDMVVIDELSSFKNHR----AKRFTALVKMRPFVKRWVGLTGTPASNGLMDVWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWF-----NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
           D G+RLGR    +  RWF     N  Q+ +      Y  +  A+ EI   + D  LS+  
Sbjct: 177 DGGERLGRFITRYRERWFVPDKRNGMQVFT------YKPRAGAEDEIYGVIGDMTLSMRT 230

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG 291
            D+  + +  + T  V L     K Y + + +L  DL G  I+A N+A+ + K LQLA+G
Sbjct: 231 TDHLQLPELTVTTMPVVLEPKERKVYEQLKADLVLDLDGATIDAANAAALSGKLLQLASG 290

Query: 292 AVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP 351
           A+ Y     W  VH+ K+  LE +IE AN  P++VAY F  D  R+   FPQ R L K  
Sbjct: 291 AI-YTSNGQWTAVHERKLDVLEDLIEAANGNPLLVAYWFTHDRQRITARFPQAREL-KTS 348

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             I+ WN+G+I L   HPAS GHGLNLQ GG++LV+FSL W LE +QQ   R+   RQ Q
Sbjct: 349 ADIETWNKGEITLGLIHPASAGHGLNLQAGGHLLVWFSLTWSLELYQQTNARL--YRQGQ 406

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIH 457
           +     V + +L+A+ T+DE VL+ L  K   Q  L++A+  E IH
Sbjct: 407 S---EPVTITHLVAEGTLDEAVLKALDAKDATQAALIDAVAHE-IH 448


>gi|160935260|ref|ZP_02082643.1| hypothetical protein CLOBOL_00156 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441991|gb|EDP19688.1| hypothetical protein CLOBOL_00156 [Clostridium bolteae ATCC
           BAA-613]
          Length = 456

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 185/461 (40%), Positives = 268/461 (58%), Gaps = 24/461 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALS---YIHLWGEKSVLVIAPL 55
           M+  PH  Q    + I++   CA++  MG GKTVS LTA+    Y     EK VLVIAP 
Sbjct: 1   MHYEPHDYQKYATEKIIELPACALFMEMGLGKTVSTLTAIDELIYDRFEVEK-VLVIAPY 59

Query: 56  RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT 115
           RVA   WT+E ++W +  H+ +S + GT  +R   L+  A +YVIN EN+ WLV      
Sbjct: 60  RVADDTWTTETEKWDHLKHLRVSKVLGTSGERIAALEADADIYVINRENVTWLVNLTGKE 119

Query: 116 WPFATIVVDESTKLKSFRLR--QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQI 173
           WPF  IVVDE +  KS   +  +  +  R LA+      RF+ LTGTP+PNGL+DLW Q+
Sbjct: 120 WPFEMIVVDELSSFKSNSAKRFKSLRIVRPLAR------RFVGLTGTPAPNGLLDLWPQV 173

Query: 174 WFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD 233
           + +D+G+RLG+ +  +  R+F   +    +    +T KE A++ IE +LSD C+S+   D
Sbjct: 174 YLIDRGERLGKTYTGYKDRYFLPDRRNGFV-VYSWTPKEGAKEAIEQKLSDICISMKADD 232

Query: 234 YQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAV 293
           Y N+   I+    V + +  M++Y + ++E   +L G+ I A ++A+   K LQLANGA 
Sbjct: 233 YLNLPAQIVNDVYVSMDRHEMRKYRELEKEKLLELDGKEITALSAAAVWGKLLQLANGAA 292

Query: 294 YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFP--QGRTLDKDP 351
            YD E +   +HD K+ AL  I+E +   P++V Y+F  D  RL   F     RTL K  
Sbjct: 293 -YDGEGNVIPLHDRKLDALAEILEASGGHPVLVFYNFRHDYDRLMGRFKGYNPRTL-KSQ 350

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
             I++WNEG+IPLL A PAS GHGLN+Q GG+I+V+F L   LE + Q   R+     RQ
Sbjct: 351 QDIRDWNEGRIPLLLAQPASMGHGLNIQAGGHIIVWFGLNPSLELYLQANARL----HRQ 406

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            G   AV ++ LI + T+DE V+++L  K   QD L+ +LK
Sbjct: 407 -GQTEAVIIHRLITKGTVDEDVVKKLWVKDETQDGLMESLK 446


>gi|313618477|gb|EFR90480.1| putative protein p41 [Listeria innocua FSL S4-378]
          Length = 450

 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 178/456 (39%), Positives = 261/456 (57%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q+   ++IL H   A++  MG GK+V  L+A+  + L  +    VLVIAPLR
Sbjct: 1   MKYKPHEYQSYATEFILSHPISAVFLEMGLGKSVITLSAIFDLCLDSFLVCKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+ +W +   ++ SV  GT K+R   LK  + LY+IN EN+ WLV +    +
Sbjct: 61  VARDTWPAEINKWDHLKGLSYSVAVGTEKERIDALKKQSTLYIINRENVDWLVHKSGIPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE +  KS+    G+K  ++L K     +R + LTGTPS NGL+DLW +   L
Sbjct: 121 HFDMVVIDELSSFKSY----GAKRFKSLLKVRPSVKRIVGLTGTPSSNGLMDLWAEFRIL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +   +F   +  + I    Y     A++EI  Q+SD  +S+   DY  
Sbjct: 177 DLGQRLGRYISHYRNTYFKPDKRNAQI-IFSYKPLPGAEEEIYKQISDITISMKSTDYLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + +     V L     K Y  F+ ++  +L  + I+A N+A  + K LQ+ANGAV YD
Sbjct: 236 MPEYVSNEVFVTLSDKDWKVYSDFKEDMVANLGDDEIDAVNAAVLSGKLLQMANGAV-YD 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            E     +HD+K+ ALE +IE AN  P++VAY F  DL R++  FP  +   +    I++
Sbjct: 295 SENKAHVIHDKKLDALEDLIEGANGKPVLVAYWFKHDLERIKNRFPVRKI--QSSKDIED 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN+GKIP+   HPAS GHGLNLQ GG+ L++F L W LE +QQ   R+   RQ Q   + 
Sbjct: 353 WNDGKIPIAVIHPASAGHGLNLQSGGSTLIWFGLTWSLELYQQTNARL--YRQGQ---RD 407

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V V+++I +NTIDE VL  L  K   QD L++A+K
Sbjct: 408 TVIVHHIITKNTIDEDVLLALTKKEKTQDALIDAVK 443


>gi|66395458|ref|YP_239852.1| ORF008 [Staphylococcus phage 2638A]
 gi|62635885|gb|AAX90996.1| ORF008 [Staphylococcus phage 2638A]
          Length = 452

 Score =  300 bits (767), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 169/456 (37%), Positives = 259/456 (56%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           +   PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   + +LVIAPL VA
Sbjct: 3   IQFKPHVYQKHSIDKVIDNEKYGLFLDMGLGKTVSTLTAFSDLQLLDTEKMLVIAPLNVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  E+ +W +  H+ +S + GT KQR   L   A +Y+ N EN  WL  + K  WPF
Sbjct: 63  KDTWADEINKWEHLKHLRVSKVLGTPKQRLAALSKEADIYITNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  K+      S+  +A+ K     +RF+ LTGTPSPN L+DLW Q++ +D+
Sbjct: 123 DIVVIDELSTFKN----PSSQRFKAIRKKLPLMKRFVGLTGTPSPNSLLDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T QI  H+    +  ++ +++ I   + D CLS+   DY ++
Sbjct: 179 GERLETSFSRYRERFFKPTHQISDHV--FNWELRDGSEERIYELIEDVCLSMKAGDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
            K I   + V L     K Y + ++    + + +  I A + AS + K LQL+NGAVY D
Sbjct: 237 PKRIDAVQSVNLSSKERKLYDELEKHYILESEEDGTIVAQSGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E   + +HD K+  LE IIE++   P++V Y+F  D  R+ + F +  TL  D      
Sbjct: 297 DES-VRHLHDRKLDKLEEIIEESQGQPLLVFYNFKHDKERIMERFDEVVTLG-DESYKDR 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           W +GK+ +L AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q     
Sbjct: 355 WIKGKVKILLAHPASAGHGLNLQKGGHIIVWFGLTWSLELYQQANARL--YRQGQT---H 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V Q L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHIMTDNTIDQKVYQALQNKELTQEDLMQAIK 445


>gi|167630964|ref|YP_001681463.1| phage-associated helicase, snf2 family [Heliobacterium
           modesticaldum Ice1]
 gi|167593704|gb|ABZ85452.1| phage-associated helicase, snf2 family [Heliobacterium
           modesticaldum Ice1]
          Length = 452

 Score =  300 bits (767), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 176/456 (38%), Positives = 266/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M  +PH  Q+ + ++IL+H   A++  MG GK+V  LTA+  + L  +  + VLVIAPLR
Sbjct: 1   MKYSPHDYQSYVTNFILEHPISAVFLDMGLGKSVITLTAIFDLALDSFLIRKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+++W +   +  SV  GT ++R   L     +Y+IN EN+ WLV + K  +
Sbjct: 61  VARDTWPAEIEKWDHLKGLTYSVAVGTEQERRFALMQNVDVYLINRENVDWLVNKSKLPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +VVDE +  K++    GSK  +AL +   + +R + LTGTPS NGL+DLW +I  L
Sbjct: 121 DYDMVVVDELSSFKAY----GSKRFKALRRVRPKVKRIVGLTGTPSGNGLMDLWAEIGIL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +   +F   +    +    Y     A+ EI  ++SD  +S+   DY  
Sbjct: 177 DMGQRLGRFITHYRNSFFTPDKRNQQV-VFSYKPLPGAEDEIYRRISDITISMKSTDYLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + ++    V L +   K Y   +REL   L+G+ I+A ++AS + K LQ+ANGAVY D
Sbjct: 236 MPECVINEIPVRLSEKEKKVYETMKRELVLSLEGQEIDAGSAASLSNKLLQMANGAVYAD 295

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +     +H  K+ ALE I+E AN  P+++AY +  DL R+ K FP  R    D  +I+ 
Sbjct: 296 -DGSVVNIHGRKLDALEDILEAANGKPVLIAYWYKHDLNRILKRFPAERLDSVD--SIRR 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN+G+IP+   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+     RQ G K 
Sbjct: 353 WNDGEIPVAVIHPASAGHGLNLQAGGSTLVWFGLTWSLELYQQTNARL----WRQ-GQKE 407

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V ++++I + TIDE V++ LR K   Q  L++A+K
Sbjct: 408 TVVIHHIITKGTIDEQVMKALRLKDKTQTALIDAVK 443


>gi|227530256|ref|ZP_03960305.1| helicase [Lactobacillus vaginalis ATCC 49540]
 gi|227349829|gb|EEJ40120.1| helicase [Lactobacillus vaginalis ATCC 49540]
          Length = 451

 Score =  299 bits (765), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 177/457 (38%), Positives = 259/457 (56%), Gaps = 20/457 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRV 57
           M   PH  Q     +ILDH   AI   MG GK+V  LTA+  +   G+ + VLVIAPLRV
Sbjct: 1   MQYKPHEYQQYATQFILDHPVAAILLDMGLGKSVITLTAIKQLIQQGKVQRVLVIAPLRV 60

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           A+  W  E+++W +   +  SVITG+  QR K L+    +Y+IN ENL WL++    ++ 
Sbjct: 61  AKQTWPEEIEKWDHLKGLTYSVITGSRLQRIKALQQDVNIYIINRENLKWLIESSGNSFD 120

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           +   V+DE +  KS+R    S+  +AL +     +R + LTGTPS NGL+DLW +   LD
Sbjct: 121 YDMFVIDELSSFKSYR----SQRFKALKRVRPLIKRVVGLTGTPSSNGLMDLWAEFRVLD 176

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
            G+RLGR   S+   +F+  +   +     Y  K  A++ I   + D  +S+   DY N+
Sbjct: 177 MGQRLGRFISSYRMNYFDPDKRNMY-QVFTYKPKPGAEQSIYRAIDDITISMKSKDYLNL 235

Query: 238 DKPILITKKVPLPQPVMKQ--YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
             P L    VP+     +Q  Y +   +L    QG+ I+A N+AS + K  Q+ANG V Y
Sbjct: 236 --PPLTMNTVPVKMSNSEQAIYDELNAQLVVSTQGKQIDALNAASLSNKLCQMANGCV-Y 292

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355
           D+++   ++H  K+ ALE ++E AN  P++VAY F  DL +++  F + R + K P  IQ
Sbjct: 293 DDQQQIVQIHQRKLDALEDLVEAANGKPVLVAYWFKHDLIQIKSRF-KVREI-KTPRDIQ 350

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           +WN GKIPL   HPAS GHGLNLQ GG  L+++ L W LE +QQ   R+    QRQ    
Sbjct: 351 DWNAGKIPLALIHPASAGHGLNLQAGGATLIWYGLTWSLELYQQTNARLWRQGQRQ---- 406

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             V ++++I + TIDE +L  L+ K   Q  L+NA+K
Sbjct: 407 -PVVIHHIITEGTIDENILAALKRKDKTQLALINAVK 442


>gi|29028643|ref|NP_803332.1| helicase [Staphylococcus phage phi 12]
 gi|18920567|gb|AAL82307.1| phage helicase [Staphylococcus phage phi 12]
          Length = 423

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 166/429 (38%), Positives = 252/429 (58%), Gaps = 15/429 (3%)

Query: 26  MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK 85
           MG GKTVS LTA S + L   K +LVIAP +VA+  W  EV +W++ +H+ +S++ GT K
Sbjct: 1   MGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVAKDTWVDEVDKWNHLNHLKVSLVLGTPK 60

Query: 86  QRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
           +R   L T A +YV N EN  WL  + K  WPF  +V+DE +  KS +    S+  +++ 
Sbjct: 61  ERNDALNTEADIYVTNKENTKWLCDQYKKEWPFDMVVIDELSTFKSPK----SQRFKSIK 116

Query: 146 KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTT-QIGSHIG 204
           K      RFI LTGTPSPN L DLW Q++ +D+G+RL   F  +  R+F  T Q+  H+ 
Sbjct: 117 KKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDRGERLESSFSRYRERYFKPTHQVSEHV- 175

Query: 205 AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQREL 264
              +  ++ ++++I  ++ D CLS+   DY ++   +   + V L +   K Y + ++  
Sbjct: 176 -FNWELRDGSEEKIYERIEDICLSMKAKDYLDMPDRVDTKQTVVLSEKERKVYAELEKNY 234

Query: 265 YCDLQGE-NIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAP 323
             + + E  + A N AS + K LQL+NGAVY D+E   + +HD+K+  LE IIE++   P
Sbjct: 235 ILESEEEGTVVAQNGASLSQKLLQLSNGAVYTDDED-VRLIHDKKLDKLEEIIEESQGQP 293

Query: 324 IIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN 383
           I++ Y+F  D  R+ + F +  TL+ D    + WN G I LL AHPAS GHGLNLQ GG+
Sbjct: 294 ILLFYNFKHDKERILQRFKEATTLE-DSNYKERWNSGDIKLLIAHPASAGHGLNLQQGGH 352

Query: 384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
           I+V+F L W LE +QQ   R+   RQ   G      +++++  NTID+ V + L+ K   
Sbjct: 353 IIVWFGLTWSLELYQQANARL--YRQ---GQNHTTIIHHIMTDNTIDQRVYKALQNKELT 407

Query: 444 QDLLLNALK 452
           Q+ L+ A+K
Sbjct: 408 QEELMKAIK 416


>gi|227875061|ref|ZP_03993206.1| helicase [Mobiluncus mulieris ATCC 35243]
 gi|304390304|ref|ZP_07372257.1| SNF2 domain protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|306817348|ref|ZP_07451093.1| SNF2 domain protein [Mobiluncus mulieris ATCC 35239]
 gi|227844339|gb|EEJ54503.1| helicase [Mobiluncus mulieris ATCC 35243]
 gi|304326060|gb|EFL93305.1| SNF2 domain protein [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|304649789|gb|EFM47069.1| SNF2 domain protein [Mobiluncus mulieris ATCC 35239]
          Length = 457

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 179/458 (39%), Positives = 260/458 (56%), Gaps = 16/458 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M+  PH  Q +   +I+DH   AI+  MG GK+V  LTA+  + L  +    VLVIAPLR
Sbjct: 1   MHYQPHNYQRQATQFIIDHHEAAIFLGMGLGKSVITLTAIWQLMLDYFTIHRVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+ +W +   + ++V  GT + R   L   A++ +IN EN+ WL+ +L G+W
Sbjct: 61  VARDTWPAEIAKWDHLDGLTVAVAVGTKQDRLNALAASAMVTIINRENIPWLISQLGGSW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +V+DE +  K+ R    +K   AL K     +R++ LTGTP+ NGL+D+W Q   L
Sbjct: 121 PFDMVVIDELSSFKNHR----AKRFTALVKMRPHVKRWVGLTGTPTSNGLMDVWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +  RWF   +    +    Y  +  A+ EI   + D  LS+   D+  
Sbjct: 177 DGGERLGRFITRYRDRWFVPDKRNG-MQVFTYKPRAGAEDEIYGAIGDMTLSMRTTDHLQ 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + +  + T  V L     K Y + + +L  DL G  I+A N+A+ + K LQLA+GA+Y  
Sbjct: 236 LPELTVTTTLVTLEPKERKIYEQLKADLVLDLDGATIDAANAAALSGKLLQLASGAIYTG 295

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           + + W  VHD K+ ALE + E AN +P++VAY F  D  R+   FPQ R L K    I+ 
Sbjct: 296 DGQ-WAPVHDRKLDALEDLYEAANGSPLLVAYWFTHDRKRITARFPQAREL-KTSADIEA 353

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G+I L   HPAS GHGLNLQ GG++LV+FSL W LE +QQ   R+   RQ Q+    
Sbjct: 354 WNRGEIALGLIHPASAGHGLNLQAGGHLLVWFSLTWSLELYQQTNARL--YRQGQS---E 408

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
            V +  L+A+ T+DE VL+ L  K   Q  L++A+  E
Sbjct: 409 PVTITNLVAEGTLDETVLKALDAKDATQAALIDAVAAE 446


>gi|283469596|emb|CAQ48807.1| SNF2 family N-domain protein [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 452

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 173/456 (37%), Positives = 268/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 3   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNDALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  HI   ++  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHI--FKWELRDGSEEKIYKQIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKVYEELEKNYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
                +E+HD+K++ LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 297 -NGDVREIHDKKLEKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 355 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 445


>gi|300909415|ref|ZP_07126876.1| SNF2 domain protein [Lactobacillus reuteri SD2112]
 gi|300893280|gb|EFK86639.1| SNF2 domain protein [Lactobacillus reuteri SD2112]
          Length = 451

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 175/457 (38%), Positives = 261/457 (57%), Gaps = 20/457 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRV 57
           M   PH  Q     +IL+H   AI   MG GK+V  LTA+  +   G+ + VLV+APLRV
Sbjct: 1   MQYKPHEYQQYATQFILNHPVAAILLDMGLGKSVITLTAIKQLIQQGKVQRVLVVAPLRV 60

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           A+  W  E+++W +   +N SV+TG+  QR K L+    +Y+IN ENL WL++    ++ 
Sbjct: 61  AKQTWPEEIEKWDHLKGLNYSVVTGSKFQRIKALQQDVDIYIINRENLKWLIESSGTSFD 120

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           +  +V+DE +  KS+R    S+  +AL +     +R + LTGTPS NGL+DLW +   LD
Sbjct: 121 YDMLVIDELSSFKSYR----SQRFKALKRVRPLIKRVVGLTGTPSSNGLMDLWAEFRVLD 176

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
            G+RLGR   S+   +F+  +   +     Y  K  A++ I   + D  +S+   DY N+
Sbjct: 177 MGQRLGRFISSYRMNYFDPDKRNMY-QVFTYKPKPGAEQSIYRAIDDITISMKSKDYLNL 235

Query: 238 DKPILITKKVPLPQPVMKQ--YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
             P L    VP+     +Q  Y +   +L    QG+ I+A N+AS + K  Q+ANG V Y
Sbjct: 236 --PPLTMNTVPVKMSNSEQAIYDELNAQLVVSTQGKQIDALNAASLSNKLCQMANGCV-Y 292

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355
           D+++   ++H  K+ ALE ++E AN  P++VAY F  DL +++  F + R + K P  IQ
Sbjct: 293 DDQQQIVQIHQRKLDALEDLVEAANGKPVLVAYWFKHDLIQIKSRF-KVREI-KTPRDIQ 350

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           +WN GKIPL   HPAS GHGLNLQ GG  L+++ L W LE +QQ   R+    QRQ    
Sbjct: 351 DWNAGKIPLALIHPASAGHGLNLQAGGATLIWYGLTWSLELYQQTNARLWRQGQRQ---- 406

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             V ++++I + TIDE +L  L+ K   Q  L+NA+K
Sbjct: 407 -PVVIHHIITEGTIDENILAALKRKDKTQLALINAVK 442


>gi|300764700|ref|ZP_07074691.1| phage-associated helicase [Listeria monocytogenes FSL N1-017]
 gi|300514586|gb|EFK41642.1| phage-associated helicase [Listeria monocytogenes FSL N1-017]
          Length = 451

 Score =  296 bits (757), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 177/463 (38%), Positives = 269/463 (58%), Gaps = 31/463 (6%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           M   PH  Q   +D+I DHK  A+   MG GKTV+ LTA+  +    +  + VL+IAPLR
Sbjct: 2   MKFVPHNYQKYAIDFIKDHKTAALLLDMGLGKTVTTLTAIKDLMHDDFTIQRVLIIAPLR 61

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           V QS W +E+Q+W +   ++ SV+ GT  QR   L+  A +Y+IN ENL WL+ +   T+
Sbjct: 62  VTQSTWPTEIQKWDHLKDLSYSVVLGTPSQRMAALQNNANIYLINRENLDWLINKSGFTF 121

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE +  K+F+    +K   +  K   + +R + LTGTPS NGL+DL+ +   L
Sbjct: 122 DFDMVVIDELSSFKNFK----AKRFTSFMKVRHKVDRIVGLTGTPSSNGLMDLFAEFKVL 177

Query: 177 DKGKRLGRVFQSFVARWF-----NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
           D G+RLG     +  ++F     N  QI S      +  +E A++EI  ++SD  +S+  
Sbjct: 178 DMGERLGYYISRYRDKYFLPDKQNGMQIYS------WKPREDAEQEIYDKISDITISMKS 231

Query: 232 ADYQNIDKPILITKKVPLPQPV--MKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLA 289
            D+  +D P L+  +VP+   +   ++Y +F+ +L   L+   I+A N+A  + K LQ+A
Sbjct: 232 VDF--LDMPELVMNEVPVDMGLKEKQKYDEFKADLVLQLKEATIDAANTAVLSNKLLQMA 289

Query: 290 NGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDK 349
           NGA+ YDE      +HD+K+ ALE +IE  N  PI++AY F  DL R+++ F   +   K
Sbjct: 290 NGAI-YDEFNVSHHIHDQKLDALEDLIEGTNGKPILIAYWFQHDLERIKERFNVRQI--K 346

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
               I +WNEG IP+   HPAS GHGLNLQ GG+ LV+F L W LE + Q   R+   RQ
Sbjct: 347 TSQDIIDWNEGSIPIAVIHPASAGHGLNLQAGGSTLVWFGLTWSLELYLQTNARLW--RQ 404

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            Q+     V ++++IA++TIDE V+  L+ K   Q  L++A+K
Sbjct: 405 GQSD---TVVIHHIIAKDTIDEDVMLALKRKDKTQSCLIDAVK 444


>gi|156603990|ref|YP_001429936.1| hypothetical protein SPTP3102_gp41 [Staphylococcus phage tp310-2]
 gi|154818076|gb|ABS87503.1| hypothetical protein [Staphylococcus phage tp310-2]
          Length = 455

 Score =  295 bits (756), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 173/456 (37%), Positives = 268/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   + +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTEKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNAALNTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  +I    +  ++ ++++I  Q+ D CLS+   DY N+
Sbjct: 182 GERLESSFSRYRERYFKPTHQVSEYI--FNWELRDGSEEKIYEQIEDICLSMKAKDYLNM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
            + I   + V L     K Y + ++    + + E  + A N AS + K LQL+NGAVY D
Sbjct: 240 PERIDTKQTVVLSDKERKLYDELEKHYILESEEEGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +   +E+HD+K++ LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 -DGDVREIHDKKLEKLEEIIEESQGQPILLFYNFKHDKERILERFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGNIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIIHHIMTDNTIDQRVYEALQNKELTQEELMKAIK 448


>gi|258646424|ref|ZP_05733893.1| SNF2 domain protein [Dialister invisus DSM 15470]
 gi|260403827|gb|EEW97374.1| SNF2 domain protein [Dialister invisus DSM 15470]
          Length = 459

 Score =  295 bits (756), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 175/464 (37%), Positives = 266/464 (57%), Gaps = 27/464 (5%)

Query: 1   MNLAPHQTK--IVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE---KSVLVIAPL 55
           MN  PHQ +   ++ I+      ++  MG GKT+  L+A++ +  +G    K VL+IAP 
Sbjct: 1   MNFVPHQYQQYCMNRIVQDPAVGLFLDMGLGKTIITLSAINELK-YGRFQVKKVLIIAPK 59

Query: 56  RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT 115
           +VA++ W  E  +W N SH+ IS + G+  +R + L TPA +Y+IN EN+ WLV   K  
Sbjct: 60  KVAEATWQREAAKWDNVSHLRISTVLGSTSKRIRALHTPADVYIINRENVVWLVDYYKND 119

Query: 116 WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
           WPF  +V DE +  K+ R    +K  +ALA       R + LTGTPSPNGL DLW Q++ 
Sbjct: 120 WPFDMVVADEMSSFKNHR----AKRFKALAAIRSHITRLVGLTGTPSPNGLSDLWSQVYL 175

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           LD+G+RLG+ F  F  R+F   +    +    Y  KE A+K I   +SD C+S+   DY 
Sbjct: 176 LDQGERLGKYFTHFRERYFEPGRRCREV-VYSYDPKEGAEKAIMDAISDICVSMKSEDY- 233

Query: 236 NIDKPILITKKVP--LPQPVMKQYHKFQRELYCDLQGENI-EAFNSASKTVKCLQLANGA 292
            ++ P ++   VP  L     + Y++ ++++  DL  +++ +  ++A+ + K  QLANGA
Sbjct: 234 -LELPEIVYHDVPVALSAKAQRDYNELEKKMVLDLGDDHVLDVTSAAALSNKLQQLANGA 292

Query: 293 VYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQG----RTLD 348
           VY D+   W+E+H++KI+A   +IE+ N    IV Y+F  DL RL+ A  +     R L 
Sbjct: 293 VYTDDGG-WQEIHNDKIEAFMELIEQLNGKHAIVFYNFRHDLDRLRAALQKTNLHIRQLQ 351

Query: 349 KDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTR 408
                + +WN GK+ +L AHPAS  +GLNLQ GGN +V+F L W LE +QQ  +R+    
Sbjct: 352 TSADEL-DWNAGKVDILLAHPASTAYGLNLQDGGNHVVWFGLNWSLELYQQANKRL---- 406

Query: 409 QRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            RQ G K  V V+ LI + T DE + + L  K   Q  ++++LK
Sbjct: 407 HRQ-GQKNRVIVHQLICEGTRDEDLARALLMKDAAQQYVMDSLK 449


>gi|134299061|ref|YP_001112557.1| SNF2-like protein [Desulfotomaculum reducens MI-1]
 gi|134051761|gb|ABO49732.1| SNF2-related protein [Desulfotomaculum reducens MI-1]
          Length = 454

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 179/459 (38%), Positives = 264/459 (57%), Gaps = 20/459 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKS-VLVIAPLR 56
           M   PH  Q   +  I++     ++  MG GKT   LTA +  +H + E S VLV+APLR
Sbjct: 1   MIFKPHEYQGYAIKKIIELPAVGLFMDMGLGKTACALTATAELMHNYFEVSKVLVVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W+ E  +W + +++ I+ + G  K R   L + A +YVIN EN+ WLV+     W
Sbjct: 61  VAEDTWSRETAKWDHLNYLRIAKVLGPEKDRIAALNSKADIYVINRENVKWLVEHFGKKW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +++DE +  KS +    +K  RAL K     +R I LTGTP+PNGL+DLW Q++ L
Sbjct: 121 PFDMVIIDELSSFKSSK----AKRFRALRKVRPLIKRIIGLTGTPAPNGLLDLWPQVYLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYT--AKETAQKEIEAQLSDCCLSLDIADY 234
           D G+RLG+    +  R+F     G    +V +T   K  A+  I  +LSD C+S+  AD+
Sbjct: 177 DLGERLGKTITGYRERYFKP---GKRNRSVIFTWDPKPDAEAAIHNKLSDLCVSMSAADW 233

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
             + + I     V L      QY + +R+L   L   ++ A  +A    K LQ+ANGAV 
Sbjct: 234 LQLPERIDNIIPVNLSLKAWGQYEQLERDLLLPLADGDVVANTAAVLANKLLQMANGAV- 292

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLD-KDPCT 353
           YDE    +E H  K++ALE +IE+A   P++V Y +  DL R+++ F Q +  + K    
Sbjct: 293 YDENGMAQEFHKAKLEALEGVIEEAAGKPVLVFYSYRHDLDRIKEHFKQYKPKELKTAED 352

Query: 354 IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 413
           I+ WN+GK+ ++ AHPAS GHGLNLQ GGNI+ +FS  W LE +QQ   R+     RQ G
Sbjct: 353 IKNWNDGKVQIMLAHPASAGHGLNLQAGGNIIAWFSTPWSLELYQQANARL----HRQ-G 407

Query: 414 FKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            +RAV +++L+A+ TIDE V++ L  K   Q+ LL A+K
Sbjct: 408 QQRAVIIHHLVAKGTIDEDVIRVLGYKERGQNALLEAVK 446


>gi|66395514|ref|YP_239930.1| ORF006 [Staphylococcus phage 42E]
 gi|215401142|ref|YP_002332397.1| putative helicase [Staphylococcus phage phiSauS-IPLA35]
 gi|62636007|gb|AAX91118.1| ORF006 [Staphylococcus phage 42E]
 gi|215260493|gb|ACJ64623.1| gp34 [Staphylococcus phage phiSauS-IPLA35]
          Length = 455

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 171/456 (37%), Positives = 267/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 6   IDFKPHSYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 65

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 66  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNAALTTEADIYVTNKENTKWLCDQYKKEWPF 125

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 126 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 181

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RLG  F  +  R+F  T Q+  H+    +  ++ ++++I  ++ D CLS+   DY ++
Sbjct: 182 GERLGSSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYERIEDICLSMKAKDYLDM 239

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L     K Y + ++    + + +  + A N AS + K LQL+NGAVY D
Sbjct: 240 PDRVDTKQTVVLSDKERKLYDELEKHYILESEEDGTVVAQNGASLSQKLLQLSNGAVYTD 299

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
                +E+HD+K++ LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 300 -NGDVREIHDKKLEKLEEIIEESQGQPILLFYNFKHDKERILQRFKEATTLE-DSNYKER 357

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ   G   
Sbjct: 358 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL--YRQ---GQNH 412

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 413 TTIMHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 448


>gi|256847828|ref|ZP_05553273.1| superfamily II DNA/RNA helicase [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715517|gb|EEU30493.1| superfamily II DNA/RNA helicase [Lactobacillus coleohominis
           101-4-CHN]
          Length = 451

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 173/457 (37%), Positives = 257/457 (56%), Gaps = 20/457 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRV 57
           M   PH  Q     +ILDH   AI   MG GK+V  LTA+  +   GE + VLV+APLRV
Sbjct: 1   MQYKPHEYQQYATQFILDHPIAAILLDMGLGKSVITLTAIKQLINCGEVQRVLVVAPLRV 60

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           A+  W  E+++W +   +  SV+TG+  QR K L+    +Y+IN ENL WL++    ++ 
Sbjct: 61  AKQTWPEEIEKWDHLKGLTYSVVTGSRTQRIKALQQDVNIYIINRENLKWLIESSGTSFD 120

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           +  +V+DE +  KS+R    S+  +AL +     +R + LTGTPS NGL+DLW +   LD
Sbjct: 121 YDMLVIDELSSFKSYR----SQRFKALKRVRPLIKRVVGLTGTPSSNGLMDLWAEFRVLD 176

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
            G+RLGR   S+   +F+  +   +     Y  K  A++ I   + D  +S+   DY N+
Sbjct: 177 MGQRLGRFISSYRMNYFDPDKRNMY-QVFTYKPKPGAEQSIYRAIDDITISMKSKDYLNL 235

Query: 238 DKPILITKKVPLPQPVMKQ--YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
             P L    VP+     +Q  Y +   +L    QG+ I+  N+ S + K  Q+ANG V Y
Sbjct: 236 --PPLTMNTVPVKMSNSEQAIYDELNAQLVVSTQGKQIDVLNATSLSNKLCQMANGCV-Y 292

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355
           D+++   ++H  K+ ALE ++E AN  P++VAY F  DL +++  F + R + K P  IQ
Sbjct: 293 DDQQQIVQIHQRKLDALEDLVEAANGKPVLVAYWFKHDLIQIKSRF-KVREI-KTPRDIQ 350

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           +WN G IPL   HPAS GHGLNLQ GG  L+++ L W LE +QQ   R+    QRQ    
Sbjct: 351 DWNAGNIPLALIHPASAGHGLNLQAGGATLIWYGLTWSLELYQQTNARLWRQGQRQ---- 406

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             V ++++I + TIDE +L  L+ K   Q  L+NA+K
Sbjct: 407 -PVVIHHIITEGTIDENILAALKRKDKTQLALINAVK 442


>gi|312897717|ref|ZP_07757133.1| protein, SNF2 family [Megasphaera micronuciformis F0359]
 gi|310621101|gb|EFQ04645.1| protein, SNF2 family [Megasphaera micronuciformis F0359]
          Length = 463

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 169/457 (36%), Positives = 264/457 (57%), Gaps = 22/457 (4%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLRVAQSVW 62
           P+Q   +D ++   +  ++  MG GKT+  L A+  +  + +  + VL+IAP +VA++ W
Sbjct: 7   PYQAYCIDRVIKQPKIGLFLDMGLGKTIITLQAIYELKYNRFAVQKVLIIAPKKVAEATW 66

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
             E Q+W     + IS + G++ +R K L TPA +Y+IN +N+ WLV   K  WPF  +V
Sbjct: 67  QREAQKWDGVGILRISTVLGSLSKRVKALNTPADIYIINRDNVTWLVDYYKNDWPFDMVV 126

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRL 182
            DES+  K+      +K  ++LA      +R + LTGTP+P GLIDLW QI+ LD+G+ L
Sbjct: 127 ADESSSFKN----HAAKRFKSLAHMYNHIKRMVLLTGTPTPKGLIDLWAQIYLLDRGQSL 182

Query: 183 GRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
           GR + SF   +F   Q  S      Y  K+TA+ ++   +S  C+S+   DY  +  P +
Sbjct: 183 GRTYTSFREHYFIPDQ-RSQTVIYSYKPKDTAEGDVLRAISHLCVSMKSEDYLTL--PPV 239

Query: 243 ITKKVP--LPQPVMKQYHKFQRELYCDL--QGENIEAFNSASKTVKCLQLANGAVYYDEE 298
           I   VP  L     + Y + +  +  +L   GE I A ++A+ + K  QLANGAV YDE 
Sbjct: 240 IEDIVPVQLSPKAQRDYDEMETRMVLELVESGEEITAVSAAALSTKLQQLANGAV-YDEL 298

Query: 299 KHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKD---PCTIQ 355
           ++  E+HD KI+A + +IE+ +  P +V Y+F  DL RL+ A  + + + K+       +
Sbjct: 299 RNVHEIHDCKIEAFKELIEQLSGKPALVFYNFKHDLERLKAALDKSKLIVKELKGATEER 358

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           EWNEGKI +L AHPAS  +GLNLQ GGN +++F L W LE +QQ  +R+     RQ G +
Sbjct: 359 EWNEGKIDVLLAHPASTAYGLNLQDGGNHVIWFGLNWSLELYQQANKRL----HRQ-GQR 413

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             V +++LI+  T DE +++ L  K+  Q+ +L +LK
Sbjct: 414 EKVIIHHLISIGTRDEDMMEALNRKADAQEYVLQSLK 450


>gi|323438429|gb|EGA96184.1| phage helicase [Staphylococcus aureus O11]
          Length = 452

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 171/456 (37%), Positives = 266/456 (58%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 3   IDFKPHNYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNAALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYKQIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + +  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKLYDELEKHYILESEEDGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
            +   + +HD+K++ LE IIE++   PI++ Y+F  D  R+ + F +  TL+ D    + 
Sbjct: 297 -DGDVRGIHDKKLEKLEEIIEESQGQPILLFYNFKHDKERILERFKEATTLE-DSNYKER 354

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I LL AHPAS GHGLNLQ GG+I+V F L W LE +QQ   R+   RQ   G   
Sbjct: 355 WNSGDIKLLIAHPASAGHGLNLQQGGHIIVSFGLTWSLELYQQANARL--YRQ---GQNH 409

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +++L+  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 410 TTIIHHLMTDNTIDQRVYKALQNKELTQEELMKAIK 445


>gi|266623803|ref|ZP_06116738.1| SNF2 domain protein [Clostridium hathewayi DSM 13479]
 gi|288864375|gb|EFC96673.1| SNF2 domain protein [Clostridium hathewayi DSM 13479]
          Length = 457

 Score =  293 bits (750), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 171/461 (37%), Positives = 260/461 (56%), Gaps = 21/461 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           M   PH  Q   ++ IL  K+  ++  MG GKTV+ LTA+  +  + +  + VL+IAP +
Sbjct: 1   MIFKPHAYQQHCIEQILRVKKLGLFLDMGLGKTVTTLTAVKELKYNRFQVRKVLIIAPKK 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  WT E  +W +   + +S + G+  +R + L TPA LY+IN EN+ WLV   +  W
Sbjct: 61  VAEGTWTKEAAKWDHTKMLRVSPVLGSQTKRIRALNTPADLYIINRENVVWLVDYYRNAW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +VVDES+  KS      +K  +ALA      +R +ELTGTPSPNGL D+W Q++ L
Sbjct: 121 PFDMVVVDESSSFKS----HSAKRFKALASVGGYIDRMVELTGTPSPNGLDDVWAQVYLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLG+ +  F  R+F   + G+      Y  K  ++  I  ++SD C+S+   DY  
Sbjct: 177 DGGERLGKRYTQFRERYFQPDKRGADGMIYSYEVKPGSEGSILERISDICISMKAEDYLQ 236

Query: 237 IDKPILITKKVP--LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
           +  P +   ++P  L     K Y++ +RE+   L  E I   ++A+ + K LQLANGAV 
Sbjct: 237 L--PDITYHEIPVELDSKASKAYYEMEREMVLALPEEEISVTSAAALSNKLLQLANGAV- 293

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
           YDE+    EVH+ KI+A   +IE     P +V Y+F  D AR+ KA  +     ++  T 
Sbjct: 294 YDEDHSVHEVHNCKIEAFMELIESLQGKPALVFYNFQHDRARILKALEKTGLRVRELKTT 353

Query: 355 Q---EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
           Q   +WN  KI +L  HPAS  +GLNLQ GGN +++F L W+ E + Q  +R+     RQ
Sbjct: 354 QDEDDWNARKIDILLTHPASSAYGLNLQQGGNHVIWFGLTWNYELYTQANKRL----HRQ 409

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            G +  V +++LI   T DE V++ L+ K  +Q  ++ +LK
Sbjct: 410 -GQEEKVIIHHLICSGTRDEDVMEALKRKDDVQSWVMESLK 449


>gi|269120031|ref|YP_003308208.1| SNF2-related protein [Sebaldella termitidis ATCC 33386]
 gi|268613909|gb|ACZ08277.1| SNF2-related protein [Sebaldella termitidis ATCC 33386]
          Length = 458

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 183/463 (39%), Positives = 268/463 (57%), Gaps = 24/463 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALS---YIHLWGEKSVLVIAPL 55
           M   PH  Q   +D  +  K   +   MG GKT+  LTA++   Y  L  ++ VLVIAP 
Sbjct: 1   MEFIPHNYQKYCIDRAVSDKSLGLLLDMGLGKTIITLTAINELIYSRLDVDR-VLVIAPK 59

Query: 56  RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT 115
           +VA+S W+ E+++W +   + +S + GT+KQR K L TPA +YVIN EN+ WLV+  + +
Sbjct: 60  KVAESTWSKEIEKWEHLRLLRVSKVLGTLKQRIKALNTPADIYVINRENVQWLVEYYQNS 119

Query: 116 WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
           WPF  +V+DE   L SF+  Q SK  ++L     + +R I LTGTP+PNGLID+W QI+ 
Sbjct: 120 WPFDMVVIDE---LSSFKNHQ-SKRFKSLKLVRDKIKRIIGLTGTPAPNGLIDIWTQIYL 175

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           LDKG+RL R   +F  R+FN T+ G       Y  K  ++  I+ ++SD C+S+   DY 
Sbjct: 176 LDKGERLERNITAFRERYFNYTRYGDQAFGT-YDLKTGSEDSIQNKISDICISMKSEDYL 234

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDL--QGENIEAFNSASKTVKCLQLANGAV 293
            +         V L     K Y + ++E+  +L   GE I+  ++A+ T K LQL+NGAV
Sbjct: 235 ELPDINYNRISVELDTKAKKAYDELEKEMILELIETGETIDVTSAAALTNKLLQLSNGAV 294

Query: 294 YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQ----GRTLDK 349
            YDE++   EVH+ KI+A   ++E  N  P +V Y F  D  R++KA  +     R L  
Sbjct: 295 -YDEDRKVHEVHNCKIEAFMELVEALNGQPALVFYSFQHDKDRIKKALSKLKLRVRELKT 353

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
           D   + +WN  +I +L +HPAS  +GLNLQ GGN +++F L W LE +QQ  +R+     
Sbjct: 354 DQ-DVTDWNNREIDILLSHPASSAYGLNLQRGGNHIIWFGLNWSLELYQQANKRL----H 408

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           RQ G    VF+++LI + T D  V+  L  K  IQ+ LLN+LK
Sbjct: 409 RQ-GQTEKVFIHHLITEGTRDTDVMAALGDKGDIQESLLNSLK 450


>gi|325687762|gb|EGD29783.1| SNF2 domain protein [Streptococcus sanguinis SK72]
          Length = 450

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 169/452 (37%), Positives = 267/452 (59%), Gaps = 18/452 (3%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQSVW 62
           P+Q     +I +H+   +   MG GKTV  LTAL  + L  +  + VLVIAPLRVA   W
Sbjct: 7   PYQEVATRFIEEHETACLILDMGLGKTVITLTALWNLILDSFEVRKVLVIAPLRVASHTW 66

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
            +E+ +W +   ++IS+  G+  +R   L   A +Y IN EN+ WL+Q     + F  +V
Sbjct: 67  KNELDKWEHLKGLDISIAIGSESERRAALSRAAFIYTINRENVVWLIQ--NQLFDFDMVV 124

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRL 182
           +DE +  KS++    +K  +AL K  +  +R + LTGTP    ++DL+ +I  LD G+RL
Sbjct: 125 IDELSSFKSYQ----AKRFKALRKVRFRIKRMVGLTGTPG--NIMDLFSEIGILDGGQRL 178

Query: 183 GRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
           GR   +F  ++F+  +    +    Y  K+ A++ I  +++D  +S+   DY N+ + + 
Sbjct: 179 GRFITAFRNQYFDPDKRNGQV-IFSYKPKDGAEEAIYDKIADMTISMKAVDYLNMPERVD 237

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWK 302
               V + +  +  Y +F+ E+   L+G+ ++A NSAS + K LQ+ANG +Y DE +   
Sbjct: 238 NEVLVEMSEQELAVYKEFKAEMVVSLKGQVLDAVNSASLSNKLLQMANGMIY-DENRDTV 296

Query: 303 EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKI 362
            +HD+K+ ALE ++E  N  P++VAY F  DL R+++ FP+ R +  +   I+EWN+GKI
Sbjct: 297 LLHDQKLVALEEMVESMNGRPLLVAYWFQHDLKRIKERFPEARVIQSNQ-DIEEWNKGKI 355

Query: 363 PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
           PL   HPAS GHGLNLQ GG+ + +F L W LE +QQ+  R+   RQ   G K  V V++
Sbjct: 356 PLGLIHPASSGHGLNLQAGGHTICWFGLTWSLELYQQLNARLW--RQ---GQKETVVVHH 410

Query: 423 LIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           +I +NTIDE V++RL+ K   Q  L++A+K E
Sbjct: 411 IITKNTIDEQVMKRLKEKDISQQSLIDAVKYE 442


>gi|157311154|ref|YP_001469199.1| helicase [Streptococcus phage P9]
 gi|119104303|gb|ABL61048.1| helicase [Streptococcus phage P9]
          Length = 440

 Score =  292 bits (747), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 174/457 (38%), Positives = 269/457 (58%), Gaps = 23/457 (5%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGEK-SVLVIAPLRVA 58
           M L  +Q     WI++H  C +   MG GKT++ L+A+  I +++ E   +L++AP +VA
Sbjct: 1   MRLHEYQEYAKTWIVEHPYCGLLLDMGLGKTLTTLSAIDEIQNIFSEDHKILIVAPKKVA 60

Query: 59  QSVWTSEVQRWS-NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           +  W +E+++W  +F++   S + G+  +R + L+T A +Y+IN EN+ WLV+  K  WP
Sbjct: 61  EETWPTEIEKWHFDFTY---SKVLGSEGKRIEALETEADIYLINRENVTWLVEYYKTKWP 117

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F  +V+DE +  KS +    SK  RAL K   + +R + LTGTP+PN LIDLW QI+ +D
Sbjct: 118 FTFVVIDELSSFKSSK----SKRFRALRKVRPKVQRLVGLTGTPAPNSLIDLWPQIYLMD 173

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           +G RL      F  ++F   +    I    +T ++ A+ EI  ++ D C+S+   DY  +
Sbjct: 174 RGDRLETSQTRFKDKYFVPDKRNGPI-VYSWTLRDGAEAEIYNKIEDICVSMKAKDYLKL 232

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
             P      V +    MK Y + + +L  + + + I A NSA    K LQ+ANGA+Y D 
Sbjct: 233 --PPRTNNVVSVKLSNMKAYKQLEADLVLEFKDKEISAANSAVLVNKLLQMANGAIY-DA 289

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEW 357
           +K    +HD+K+ ALE I+E++   PI+V Y +  DL RL+K FPQ   L     ++ +W
Sbjct: 290 DKTTVAIHDDKLDALEDIVEESQGQPILVFYQYQHDLERLKKRFPQAEEL----TSVDKW 345

Query: 358 NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
           N G+IP+L  HP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q      
Sbjct: 346 NSGRIPILLCHPQSAGHGLNLQKGGHIIVWFGLTWSLEYYQQANARLD--RQGQT---EP 400

Query: 418 VFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           V V++++A+NT+DE VL+ L+ K   Q+ LL A+K +
Sbjct: 401 VIVHHIVAENTVDEKVLRILQGKEKNQNALLEAVKAQ 437


>gi|306826832|ref|ZP_07460132.1| SNF2 domain protein [Streptococcus pyogenes ATCC 10782]
 gi|304430850|gb|EFM33859.1| SNF2 domain protein [Streptococcus pyogenes ATCC 10782]
          Length = 440

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 174/457 (38%), Positives = 269/457 (58%), Gaps = 23/457 (5%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGEK-SVLVIAPLRVA 58
           M L  +Q     WI++H  C +   MG GKT++ L+A+  I +++ E   +L++AP +VA
Sbjct: 1   MRLHEYQEYAKTWIVEHPYCGLLLDMGLGKTLTTLSAIDEIQNIFSEDHKILIVAPKKVA 60

Query: 59  QSVWTSEVQRWS-NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           +  W +E+++W  +F++   S + G+  +R + L+T A +Y+IN EN+ WLV+  K  WP
Sbjct: 61  EETWPTEIEKWHFDFTY---SKVLGSEGKRIEALETEADIYLINRENVTWLVEYYKTKWP 117

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F  +V+DE +  KS +    SK  RAL K   + +R + LTGTP+PN LIDLW QI+ +D
Sbjct: 118 FTFVVIDELSSFKSSK----SKRFRALRKVRPKVQRLVGLTGTPAPNSLIDLWPQIYLMD 173

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           +G RL      F  ++F   +    I    +  ++ A+ EI  ++ D C+S+   DY  +
Sbjct: 174 RGDRLETSQTRFKDKYFVPDKRNGPI-IYSWALRDGAEAEIYNKIEDICVSMKAKDYLKL 232

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
             P      V +    MK Y + + +L  + + + I A NSA    K LQ+ANGA+Y D+
Sbjct: 233 --PPRTDNVVSVKLSNMKAYKQLEADLVLEFKNKEISAANSAVLANKLLQMANGAIY-DD 289

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEW 357
           +K    +HD+K+ ALE I+E++   PI+V Y +  DL RL+K FPQ   L     ++ +W
Sbjct: 290 DKATVAIHDDKLDALENIVEESQGQPILVFYQYQHDLERLKKRFPQAEEL----TSVDKW 345

Query: 358 NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
           N GKIP+L  HP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q      
Sbjct: 346 NSGKIPILLCHPQSAGHGLNLQKGGHIIVWFGLTWSLEYYQQANARLD--RQGQT---EP 400

Query: 418 VFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           V V++++A+NT+DE VL+ L+ K   Q+ LL A+K +
Sbjct: 401 VIVHHIVAENTVDEKVLRILQGKEKNQNALLEAVKAQ 437


>gi|323484110|ref|ZP_08089480.1| SNF2-like protein [Clostridium symbiosum WAL-14163]
 gi|323402552|gb|EGA94880.1| SNF2-like protein [Clostridium symbiosum WAL-14163]
          Length = 455

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 174/459 (37%), Positives = 260/459 (56%), Gaps = 25/459 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTA-----LSYIHLWGEKSVLVIA 53
           M   PH  Q    ++I+     A++   G GKT+  LTA     L Y  +   + VLVIA
Sbjct: 1   MKYVPHEYQEYAKEFIVHQNISALFLDCGLGKTIIALTAIWELLLDYFEV---RKVLVIA 57

Query: 54  PLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK 113
           PLRVA+  W  E+++W +   + +S + G+ ++R   L   A +YVIN EN+ WLV    
Sbjct: 58  PLRVARDTWPGELKKWEHLQGLVMSAVLGSERERITALNRKANVYVINRENVEWLVA--Y 115

Query: 114 GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQI 173
           G W F  +V+DE +  KS R    +K  +AL K     +R + LTGTP+PNGLIDLW +I
Sbjct: 116 GGWDFDMVVIDELSSFKSHR----AKRFKALKKVRPCVKRIVGLTGTPAPNGLIDLWAEI 171

Query: 174 WFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD 233
             LD G+RLGR    +  R+F   +    +    Y  +E A++ I   +SD C+S+  AD
Sbjct: 172 GILDMGQRLGRFIGGYRERFFVPDKRSREM-VYSYKPREGAEETIYGLISDICISMKAAD 230

Query: 234 YQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAV 293
           Y  +   I     V + +  M  YH+ ++++    +  +I+A N+A  + K +Q+ANGAV
Sbjct: 231 YLKMPGCIYNRVVVAMSEKEMNLYHQLEKDMLVPYEDGDIDAVNAAGLSNKLMQMANGAV 290

Query: 294 YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCT 353
           Y DE    K +HD K++ALE ++E AN  P++VAY +  DLAR++        LD     
Sbjct: 291 Y-DENGAVKHIHDRKLEALEDLVEAANGKPVLVAYWYKHDLARIRDRLGVAE-LDAAE-D 347

Query: 354 IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 413
            ++WN G+IP+   HPAS GHGLNLQ GG+ L++F L W LE +QQM  R+   RQ Q  
Sbjct: 348 FRKWNAGEIPVAVIHPASAGHGLNLQTGGSTLIWFGLTWSLELYQQMNARL--WRQGQ-- 403

Query: 414 FKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            K  V +++LIA++T+DE V+  L  K   Q  L++A++
Sbjct: 404 -KETVVIHHLIAKDTLDERVMTALEKKDCGQSALVDAVR 441


>gi|227498325|ref|ZP_03928475.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226903787|gb|EEH89705.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 457

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 174/460 (37%), Positives = 265/460 (57%), Gaps = 22/460 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           M   PH  Q   +++I  H   A++  MG GKTV+ LTA+  +    +  + VLV+APLR
Sbjct: 1   MKFMPHEYQKYAIEYIKSHPVTALFLDMGLGKTVTTLTAIRDLMYDTFEVQRVLVVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W  E+++W +   +  SV+ G+V +R + L+  A +Y++N ENL WL +  +   
Sbjct: 61  VARDTWPDEIKKWDHLKCLACSVVVGSVPERRRALQQDADIYIVNRENLVWLYENSR--L 118

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE   L SF+  Q SK  RA+       +R + LTGTPS NGL+DLW +   L
Sbjct: 119 DFDMVVLDE---LSSFKNHQ-SKRFRAMKALRPRVKRIVGLTGTPSGNGLMDLWAEFRIL 174

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKET--AQKEIEAQLSDCCLSLDIADY 234
           D GKRLGR    +   +F   Q     G V Y+ K    A++ I  Q++D  +S+   DY
Sbjct: 175 DMGKRLGRYISQYRNLYF---QPDKRNGMVVYSYKPLPGAEEAIYHQIADITVSMKATDY 231

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
             + + + + K+V L +   ++Y + ++ L  +L G  + A N+AS T+K  Q+ANGA+Y
Sbjct: 232 LKMPELVSVAKEVSLSEKEKERYDELKKYLVLELPGGEVTAANAASLTLKLSQMANGAIY 291

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
            D+ K    +HD K+ ALE ++E AN  P++VAY F  D  R++K   + R L K+    
Sbjct: 292 TDD-KDVVTIHDRKLDALEDLVESANGKPVLVAYWFKHDKDRIRKRM-EAREL-KESQDF 348

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
            +WNEGKIP+   HPAS GHGLNLQ GG+ILV+F L W +E +QQ   R+     RQ   
Sbjct: 349 ADWNEGKIPVALIHPASAGHGLNLQQGGSILVWFGLTWSMELYQQTNARL----WRQGQT 404

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
            + V + +++A++TIDE +L+ L  K   Q  L+ A+K +
Sbjct: 405 DKTVIIQHIVAKSTIDERILKVLEHKDGTQSALIEAVKAD 444


>gi|139473885|ref|YP_001128601.1| SNF2 family phage protein [Streptococcus pyogenes str. Manfredo]
 gi|134272132|emb|CAM30377.1| SNF2 family phage protein [Streptococcus pyogenes str. Manfredo]
          Length = 440

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 174/457 (38%), Positives = 268/457 (58%), Gaps = 23/457 (5%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGEK-SVLVIAPLRVA 58
           M L  +Q     WI++H  C +   MG GKT++ L+A+  I +++ E   +L++AP +VA
Sbjct: 1   MRLHEYQEYAKTWIVEHPYCGLLLDMGLGKTLTTLSAIDEIQNIFSEDHKILIVAPKKVA 60

Query: 59  QSVWTSEVQRWS-NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           +  W +E+ +W  +F++   S + G  ++R + L+T A +Y+IN EN+ WLV+  K  WP
Sbjct: 61  EETWPTEIGKWHFDFTY---SKVLGDERKRIEALETEADIYLINRENVTWLVEYYKTKWP 117

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F  +V+DE +  KS +    SK  RAL K   + +R + LTGTP+PN LIDLW QI+ +D
Sbjct: 118 FTFVVIDELSSFKSSK----SKRFRALRKVRPKVQRLVGLTGTPAPNSLIDLWPQIYLMD 173

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           +G RL      F  ++F   +    I    +  ++ A+ EI  ++ D C+S+   DY  +
Sbjct: 174 RGDRLETSQTRFKDKYFVPDKRNGPI-IYSWALRDGAEAEIYNKIEDICVSMKAKDYLKL 232

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
             P      V +    MK Y + + +L  + + + I A NSA    K LQ+ANGA+Y D+
Sbjct: 233 --PPRTNDVVSVKLSNMKAYKQLEADLVLEFKNKEISAANSAVLANKLLQMANGAIY-DD 289

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEW 357
           +K    +HD+K+ ALE I+E++   PI+V Y +  DL RL+K FPQ   L     ++ +W
Sbjct: 290 DKATVAIHDDKLDALENIVEESQGQPILVFYQYQHDLERLKKRFPQAEEL----TSVDKW 345

Query: 358 NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
           N GKIP+L  HP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q      
Sbjct: 346 NSGKIPILLCHPQSAGHGLNLQKGGHIIVWFGLTWSLEYYQQANARLD--RQGQT---EP 400

Query: 418 VFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           V V++++A+NT+DE VL+ L+ K   Q+ LL A+K +
Sbjct: 401 VIVHHIVAENTVDEKVLRILQGKEKNQNALLEAVKAQ 437


>gi|323693306|ref|ZP_08107524.1| SNF2 domain-containing protein [Clostridium symbiosum WAL-14673]
 gi|323502789|gb|EGB18633.1| SNF2 domain-containing protein [Clostridium symbiosum WAL-14673]
          Length = 447

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 176/456 (38%), Positives = 252/456 (55%), Gaps = 16/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           MN APH  Q   +D+I  H   A+   MG GKTV  LTA++ +    +    +LV+APLR
Sbjct: 1   MNFAPHDYQAYAIDYIETHPVAAVLLDMGLGKTVISLTAIADLLFDSFEAHRILVVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+++W +  H+  +V  GT K+R   L   A + +IN ENL WL++     +
Sbjct: 61  VARDTWPAEIRKWQHLKHLTFAVCVGTPKERKVALMAGADITIINRENLQWLIESSGFPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE   L SF+    SK  ++L K     +R I LTGTPS NGL+DLW +   L
Sbjct: 121 DYDMVVIDE---LSSFK-NHNSKRFKSLLKVRPSVKRIIGLTGTPSSNGLMDLWAEFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D GKRLGR    +   +F   +    I    Y  +  A++ I  Q+SD  +S+   D+  
Sbjct: 177 DLGKRLGRFITEYRNNYFVPDKRNGQI-IYSYKPQPYAEERIYGQISDITISMKSTDHLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + I    +V L    + +Y + ++EL  +L    I A N+AS T K  QLANGA+Y D
Sbjct: 236 MPELISSEYEVHLSDDEVTRYEELKQELVLELPDGEITAANAASLTGKLSQLANGAIYSD 295

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
                 E HD K+ ALE IIE AN  P++VAY F  DL+R++K F       K    I +
Sbjct: 296 TGDTI-EFHDRKLDALEDIIESANGKPVLVAYWFKHDLSRIKKRFDVREI--KSSKDITD 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN GKIP+   HPAS GHGLNLQ GG+ L++F L W LE +QQ   R+     RQ     
Sbjct: 353 WNAGKIPVAVIHPASAGHGLNLQAGGSTLIWFGLTWSLELYQQTNARL----WRQGQTSG 408

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V + ++I + TIDE +L+ L  K   Q+ L++A+K
Sbjct: 409 TVVIEHIITKGTIDERILKALSKKELTQNALIDAVK 444


>gi|71911260|ref|YP_282810.1| phage-related DNA helicase [Streptococcus pyogenes MGAS5005]
 gi|94989079|ref|YP_597180.1| phage-related DNA helicase [Streptococcus pyogenes MGAS9429]
 gi|94992970|ref|YP_601069.1| phage-related DNA helicase [Streptococcus pyogenes MGAS2096]
 gi|71854042|gb|AAZ52065.1| phage-related DNA helicase [Streptococcus pyogenes MGAS5005]
 gi|94542587|gb|ABF32636.1| phage-related DNA helicase [Streptococcus pyogenes MGAS9429]
 gi|94546478|gb|ABF36525.1| phage-related DNA helicase [Streptococcus pyogenes MGAS2096]
          Length = 440

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 173/457 (37%), Positives = 268/457 (58%), Gaps = 23/457 (5%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGEK-SVLVIAPLRVA 58
           M L  +Q     WI++H  C +   MG GKT++ L+A+  I +++ E   +L++AP +VA
Sbjct: 1   MRLHEYQEYAKTWIVEHPYCGLLLDMGLGKTLTTLSAIDEIQNIFSEDHKILIVAPKKVA 60

Query: 59  QSVWTSEVQRWS-NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           +  W +E+++W  +F++   S + G+  +R + L+T A +Y+IN EN+ WLV+  K  WP
Sbjct: 61  EETWPTEIEKWHFDFTY---SKVLGSEGKRIEALETEADIYLINRENVTWLVEYYKTKWP 117

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F  +V+DE +  KS +    SK  RAL K   + +R + LTGTP+PN LIDLW QI+ +D
Sbjct: 118 FTFVVIDELSSFKSSK----SKRFRALRKVRPKVQRLVGLTGTPAPNSLIDLWPQIYLMD 173

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           +G RL      F  ++F   +    I    +  ++ A+ EI  ++ D C+S+   DY  +
Sbjct: 174 RGDRLETSQTRFKDKYFVPDKRNGPI-IYSWALRDGAEAEIYNKIEDICVSMKAKDYLKL 232

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
             P      V +    MK Y + + +L  + + + I A NSA    K LQ+ANGA+Y D+
Sbjct: 233 --PPRTNNVVSVKLSNMKAYKQLEADLVLEFKDKEISAANSAVLANKLLQMANGAIY-DD 289

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEW 357
           +K    +HD+K+ ALE I+E++   PI+V Y +  D  RL+K FPQ   L     ++ +W
Sbjct: 290 DKSTVAIHDDKLDALEDIVEESQGQPILVFYQYQHDFERLKKRFPQAEEL----TSVDKW 345

Query: 358 NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
           N GKIP+L  HP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q      
Sbjct: 346 NSGKIPILLCHPQSAGHGLNLQKGGHIIVWFGLTWSLEYYQQANARLD--RQGQT---EP 400

Query: 418 VFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           V V++++A+NT+DE VL+ L+ K   Q+ LL A+K +
Sbjct: 401 VIVHHIVAENTVDEKVLRILQGKEKNQNALLEAVKAQ 437


>gi|300909460|ref|ZP_07126921.1| SNF2 domain protein [Lactobacillus reuteri SD2112]
 gi|300893325|gb|EFK86684.1| SNF2 domain protein [Lactobacillus reuteri SD2112]
          Length = 451

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 175/457 (38%), Positives = 261/457 (57%), Gaps = 20/457 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRV 57
           M   PH  Q     +ILDH   AI   MG GK+V  LTA+  +   G+ + VLV+APLRV
Sbjct: 1   MQYKPHEYQQYATRFILDHPVAAILLDMGLGKSVITLTAIKQLIQQGKVQRVLVVAPLRV 60

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           A+  W  E+++W +   +N SV+TG+  QR K L+    +Y+IN ENL WL++    ++ 
Sbjct: 61  AKQTWPEEIEKWDHLKGLNYSVVTGSKLQRIKALQQDVDIYIINRENLKWLIESSGNSFD 120

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           +  +V+DE +  KS+R    S+  +AL +     +R + LTGTPS NGL+DLW +   LD
Sbjct: 121 YDMLVIDELSSFKSYR----SQRFKALKRVRPLIKRVVGLTGTPSSNGLMDLWAEFRVLD 176

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
            G+RLGR   S+   +F+  +   +     Y  K  A++ I   + D  +S+   DY ++
Sbjct: 177 MGQRLGRFISSYRMNYFDPDKRNMY-QVFTYKPKPGAEQSIYRAIDDITISMKSKDYLSL 235

Query: 238 DKPILITKKVPLPQPVMKQ--YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
             P L    VP+     +Q  Y +   +L    QG+ I+A N+AS + K  Q+ANG V Y
Sbjct: 236 --PPLTMNTVPVKMSNSEQAIYDELNAQLVVSAQGKQIDALNAASLSNKLCQMANGCV-Y 292

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355
           D+++   ++H  K+ ALE ++E AN  P++VAY F  DL +++  F + R + K P  IQ
Sbjct: 293 DDQQQIIQIHQRKLDALEDLVEAANGKPVLVAYWFKHDLIQIKSRF-KVREI-KTPRDIQ 350

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           +WN GKIPL   HPAS GHGLNLQ GG  L+++ L W LE +QQ   R+    QRQ    
Sbjct: 351 DWNAGKIPLALIHPASAGHGLNLQAGGATLIWYGLTWSLELYQQTNARLWRQGQRQ---- 406

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             V ++++I + TIDE +L  L+ K   Q  L+NA+K
Sbjct: 407 -PVVIHHIITEGTIDENILAALKRKDKTQLALINAVK 442


>gi|313898006|ref|ZP_07831545.1| SNF2 family N-terminal domain protein [Clostridium sp. HGF2]
 gi|312957034|gb|EFR38663.1| SNF2 family N-terminal domain protein [Clostridium sp. HGF2]
          Length = 447

 Score =  290 bits (743), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 176/456 (38%), Positives = 254/456 (55%), Gaps = 16/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           MN  PH  Q   +D+I  H   A+   MG GKTV  LTA++ +    +    +LVIAPLR
Sbjct: 1   MNFVPHDYQAYAIDYIETHPIAAVLLDMGLGKTVISLTAIADLLFDSFEAHRILVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+++W +  H+  +V  GT K+R   L T A + +IN ENL WL++     +
Sbjct: 61  VARDTWPAEIEKWQHLKHLTFAVCVGTPKERKASLMTRADITIINRENLQWLIESSGFPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE   L SF+    SK  ++L K     +R I LTGTPS NGL+DLW +   L
Sbjct: 121 DYDMVVIDE---LSSFK-NHNSKRFKSLLKVRPSVKRIIGLTGTPSSNGLMDLWAEFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D GKRLGR    +   +F   +    I    Y  +  A++ I +Q+SD  +S+   D+  
Sbjct: 177 DLGKRLGRFITEYRNNYFIPDKRNGQI-IYSYKPQPYAEERIYSQISDITISMKSTDHLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + I    +V L +  + +Y + + +L  +L    I A N+AS T K  QLANGA+Y D
Sbjct: 236 MPELISSEYEVHLSEDEVARYEELKSDLVLELPDGEITAANAASLTGKLSQLANGAIYSD 295

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
             +   E HD K+ ALE IIE AN  P++VAY F  DL+R++K F       K    I +
Sbjct: 296 TGE-IIEFHDRKLDALEDIIESANGKPVLVAYWFKHDLSRIKKRFDVREI--KSSKDITD 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN GKIP+   HPAS GHGLNLQ GG+ L++F L W LE +QQ   R+     RQ     
Sbjct: 353 WNAGKIPVAVIHPASAGHGLNLQAGGSTLIWFGLTWSLELYQQTNARL----WRQGQTSG 408

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V + ++I + TIDE +L+ L  K   Q+ L++A+K
Sbjct: 409 TVVIEHIITKGTIDERILKALSKKELTQNALIDAVK 444


>gi|313895516|ref|ZP_07829072.1| SNF2 family N-terminal domain protein [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312975642|gb|EFR41101.1| SNF2 family N-terminal domain protein [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 454

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 177/456 (38%), Positives = 260/456 (57%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGE-KSVLVIAPLR 56
           M   PH  QT   ++IL HK  AI+   G GKTV  LTA+   +H + E   VLVIAPLR
Sbjct: 1   MRYEPHFYQTYAKEFILHHKEAAIFLDCGLGKTVITLTAIEELLHDFFEIGKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W SE+ +W +  ++ +SV+ GT ++RT  L   A +Y+IN EN+ WL++E   + 
Sbjct: 61  VARDTWPSEIAKWEHTRNICVSVVMGTPRERTAALMQHADVYIINRENVKWLIEESGASM 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  IV+DE   L SF+  Q +K  RAL K     +R + LTGTPS NGL+DLW +   L
Sbjct: 121 NFDMIVIDE---LSSFKSHQ-AKRFRALLKLRPTVKRIVGLTGTPSANGLMDLWAEFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D GKRLGR    +   +F   +    +    Y  +E A+ EI  ++ D  +S+   DY  
Sbjct: 177 DMGKRLGRFISHYRNDFFLPDKRNQQM-VFSYKPREGAEDEIYRRIEDITISMRSKDYLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + I  +  V + +     Y + ++++   L G  I+A ++A+ + K LQ+ANGAVY +
Sbjct: 236 MPQIISNSVCVAMEEHERDLYDRMKQDMVVALGGTEIDAVSAAALSGKLLQMANGAVYTE 295

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
             K    +HD K+ ALE ++E AN  P++VAY +  DL R+++  P      +    I+ 
Sbjct: 296 NGKSV-HLHDRKLDALEDLVESANGKPVLVAYWYRHDLERIKERLPVQEI--RSSADIEN 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN  KI +   HPAS GHGLNLQ+GG+ L++F L W LE +QQ   RI   RQ Q G   
Sbjct: 353 WNAEKISVAVIHPASAGHGLNLQFGGSTLIWFGLTWSLELYQQTNARI--YRQGQKG--- 407

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V ++++I   TIDE V+Q L  K+  Q  L++A+K
Sbjct: 408 TVVIHHIITVGTIDENVMQALGRKNKTQTALIDAVK 443


>gi|225871338|ref|YP_002747285.1| SNF2 family phage protein [Streptococcus equi subsp. equi 4047]
 gi|225700742|emb|CAW95382.1| SNF2 family phage protein [Streptococcus equi subsp. equi 4047]
          Length = 440

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 173/457 (37%), Positives = 269/457 (58%), Gaps = 23/457 (5%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGEK-SVLVIAPLRVA 58
           M L  +Q     WI++H  C +   MG GKT++ L+A+  I +++ E   +L++AP +VA
Sbjct: 1   MRLHEYQEYAKTWIVEHPYCGLLLDMGLGKTLTTLSAIDEIQNIFSEDHKILIVAPKKVA 60

Query: 59  QSVWTSEVQRWS-NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           +  W++E+ +W  +F++   S + G+  +R + L+T A +Y+IN EN+ WLV+  K  WP
Sbjct: 61  EETWSTEIGKWHFDFTY---SKVLGSEGKRIEALETEADIYLINRENVTWLVEYYKTKWP 117

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F  +V+DE +  KS +    SK  RAL K   + +R + LTGTP+PN LIDLW QI+ +D
Sbjct: 118 FTFVVIDELSSFKSSK----SKRFRALRKVRPKVQRLVGLTGTPAPNSLIDLWPQIYLMD 173

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           +G RL      F  ++F   +    I    +  ++ A+ EI  ++ D C+S+   DY  +
Sbjct: 174 RGARLETSQTRFKDKYFVPDKRNGLI-IYSWALRDGAEAEIYNKIEDICISMKAKDYLKL 232

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
             P      V +    MK Y + + +L  + + + I A NSA    K LQ+ANGA+Y D+
Sbjct: 233 --PPRTDNVVSVKLSNMKAYKQLEADLVLEFKDKEISAANSAVLANKLLQMANGAIY-DD 289

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEW 357
           +K    +HD+K+ ALE ++E++   PI+V Y +  DL RL+K FPQ   L     ++ +W
Sbjct: 290 DKTTVAIHDDKLDALENVVEESQGQPILVFYQYQHDLERLKKRFPQAEEL----TSVDKW 345

Query: 358 NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
           N GKIP+L  HP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q      
Sbjct: 346 NSGKIPILLCHPQSAGHGLNLQKGGHIIVWFGLTWSLEYYQQANARLD--RQGQT---EP 400

Query: 418 VFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           V V++++A+NT+DE VL+ L+ K   Q+ LL A+K +
Sbjct: 401 VIVHHIVAENTVDEKVLRILQGKEKNQNALLEAVKAQ 437


>gi|209559301|ref|YP_002285773.1| Putative helicase-phage associated [Streptococcus phage NZ131.2]
 gi|209540502|gb|ACI61078.1| Putative helicase-phage associated [Streptococcus phage NZ131.2]
          Length = 440

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 174/457 (38%), Positives = 268/457 (58%), Gaps = 23/457 (5%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGEK-SVLVIAPLRVA 58
           M L  +Q     WI++H  C +   MG GKT++ L+A+  I +++ E   +L++AP +VA
Sbjct: 1   MRLHEYQEYAKTWIVEHPYCGLLLDMGLGKTLTTLSAIDEIQNIFSEDHKILIVAPKKVA 60

Query: 59  QSVWTSEVQRWS-NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           +  W +E+ +W  +F++   S + G  ++R + L+T A +Y+IN EN+ WLV+  K  WP
Sbjct: 61  EETWPTEIGKWHFDFTY---SKVLGDERKRIEALETEADIYLINRENVTWLVEYYKTKWP 117

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F  +V+DE +  KS +    SK  RAL K   + +R + LTGTP+PN LIDLW QI+ +D
Sbjct: 118 FTFVVIDELSSFKSSK----SKRFRALRKVRPKVQRLVGLTGTPAPNSLIDLWPQIYLMD 173

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           +G RL      F  ++F   +    I    +  ++ A+ EI  ++ D C+S+   DY  +
Sbjct: 174 RGDRLETSQTRFKDKYFVPDKRNGLI-IYSWALRDGAEAEIYNKIEDICVSMKAKDYLKL 232

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
             P      V +    MK Y + + +L  + + + I A NSA    K LQ+ANGA+Y D+
Sbjct: 233 --PPRTNNVVSVKLSNMKAYKQLEADLVLEFKNKEISAANSAVLANKLLQMANGAIY-DD 289

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEW 357
           +K    +HD+K+ ALE I+E++   PI+V Y +  DL RL+K FPQ   L     ++ +W
Sbjct: 290 DKATVAIHDDKLDALENIVEESQGQPILVFYQYQHDLERLKKRFPQAEEL----TSVDKW 345

Query: 358 NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
           N GKIP+L  HP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q      
Sbjct: 346 NSGKIPILLCHPQSAGHGLNLQKGGHIIVWFGLTWSLEYYQQANARLD--RQGQT---EP 400

Query: 418 VFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           V V++++A+NT+DE VL+ L+ K   Q+ LL A+K +
Sbjct: 401 VIVHHIVAENTVDEKVLRILQGKEKNQNDLLEAVKAQ 437


>gi|307580244|gb|ADN64213.1| SNF2-related protein [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 330

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 203/309 (65%), Gaps = 4/309 (1%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++ L WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDTLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALA     + ER++ LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALATHVHTKVERYVGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G RLG  F++F+ RWF   QIGS   AVR+     A +EI+ ++ D CLSLD   Y ++ 
Sbjct: 181 GARLGTHFKAFIDRWFRAMQIGSDPHAVRFAPTPHASQEIQDKIRDLCLSLDPQAYFDLR 240

Query: 239 KPILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDE 297
           +PI+ T +V LP    + Y   +++++  L+ G  +EAFN+ASKT+KCLQLANGA+Y D+
Sbjct: 241 QPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNAASKTIKCLQLANGALYTDD 300

Query: 298 EKH-WKEVH 305
            +  W+ VH
Sbjct: 301 TRQAWEVVH 309


>gi|325478705|gb|EGC81816.1| type III restriction enzyme, res subunit [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 448

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 173/458 (37%), Positives = 266/458 (58%), Gaps = 21/458 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q    ++I ++K  A+   MG GKTV  LTA+  +    +    VL++APLR
Sbjct: 1   MEYTPHKYQNYATEFIKENKESALLLDMGLGKTVISLTAIKDLLFDSFEISKVLIVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W  E+++WS+   +  SV  G+ K+R K L   A +Y+IN EN+ WL+ + + T+
Sbjct: 61  VARDTWKEEIEKWSHLDILEYSVAIGSEKERIKALNKQADIYLINRENVDWLINKSELTF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  IV+DE +  KS R    SK  +AL K   + +R + LTGTPS NGL+DLW +   L
Sbjct: 121 NYDMIVIDELSSFKSHR----SKRFKALMKVRPKVKRIVGLTGTPSSNGLMDLWAEFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKET--AQKEIEAQLSDCCLSLDIADY 234
           D G+RLGR    +   +F   +     G + Y+ K    A+  I  ++SD  +S+   DY
Sbjct: 177 DMGQRLGRFIGQYREIYFKPDKRN---GPIIYSYKPLPFAEDAIYEKISDITVSMKAEDY 233

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
             + + I     V L       Y   +++L   ++ ++I+A N+A+ + K LQ+A+G+V 
Sbjct: 234 LKMPEKINNEVFVNLSDKERDIYETLKKDLVVSIKDKDIDAVNAAALSNKLLQMASGSV- 292

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
           YDE+K+   +HD K+ ALE +IE AN  P+++AY + SDL R++  F   R L K     
Sbjct: 293 YDEDKNMIHIHDRKLDALEDLIEGANGKPVLIAYWYKSDLKRIKDRFDL-REL-KTSEDF 350

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
           +EWN+GKIP+   HPAS GHGLNLQ GG+ L++FSL W LE ++Q   R+   RQ   G 
Sbjct: 351 KEWNQGKIPVAIIHPASAGHGLNLQAGGSTLIWFSLTWSLELYEQTNARL--YRQ---GQ 405

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           K  V +++++A+ TIDE V++ L  K+  Q  L++A+K
Sbjct: 406 KETVVIHHILAKGTIDEDVMKALENKNKTQAALIDAVK 443


>gi|167039884|ref|YP_001662869.1| SNF2-like protein [Thermoanaerobacter sp. X514]
 gi|300915304|ref|ZP_07132618.1| SNF2-related protein [Thermoanaerobacter sp. X561]
 gi|307724792|ref|YP_003904543.1| SNF2-like protein [Thermoanaerobacter sp. X513]
 gi|166854124|gb|ABY92533.1| SNF2-related protein [Thermoanaerobacter sp. X514]
 gi|300888580|gb|EFK83728.1| SNF2-related protein [Thermoanaerobacter sp. X561]
 gi|307581853|gb|ADN55252.1| SNF2-related protein [Thermoanaerobacter sp. X513]
          Length = 449

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 173/458 (37%), Positives = 265/458 (57%), Gaps = 21/458 (4%)

Query: 1   MNLAPHQTKI--VDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH+ ++   ++IL+H   A+   MG GK+V  LTA+  + L  +  + VLVIAPLR
Sbjct: 1   MKYKPHEYQVYATEYILNHPIAAVLLDMGLGKSVITLTAIFDLTLDSFLVRKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+++W +   +  ++  G+  +R       A +Y+IN EN+ WL+      +
Sbjct: 61  VARDTWPAEIEKWDHLKGLKYTLAVGSEVKRKTAFMERAQVYIINRENVEWLITRSGIPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE   L SF+  Q +K  ++L +   + +R + LTGTPS NGL+DLW Q   L
Sbjct: 121 DFDMVVIDE---LSSFKSHQ-AKRFKSLMRVRPKVKRIVGLTGTPSSNGLMDLWAQYRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +   +F   +    +    Y  K  A++EI   +SD  +S+   DY  
Sbjct: 177 DMGQRLGRFIGRYREDYFVPDKRNQQV-IFSYKPKPGAEEEIYKLISDITISMKGTDYLK 235

Query: 237 IDKPILITKKVP--LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
           +  P L+  +VP  L +  MK     +R+L  +++GE + A N+A+ + K LQ+ANGAVY
Sbjct: 236 L--PDLVINEVPVKLSEKEMKTLDTMKRDLITNVKGEEVTAANAAALSGKLLQMANGAVY 293

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
            D+      +HD K+ ALE +IE AN  P+++AY F  DL+R+QK F        D  +I
Sbjct: 294 -DDHGTVLYIHDRKLDALEDLIEAANGKPVLIAYWFKHDLSRIQKRFEVEVLSTSD--SI 350

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
           + WN+G+IP+   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+     RQ G 
Sbjct: 351 KRWNDGEIPIAVIHPASAGHGLNLQAGGSTLVWFGLTWSLELYQQTNARL----WRQ-GQ 405

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           K  V +++LI++ TIDE V++ L  K+  Q  L++A+K
Sbjct: 406 KETVVIHHLISKGTIDERVMKALNDKNNTQSALIDAVK 443


>gi|42779467|ref|NP_976714.1| phage-associated helicase [Bacillus cereus ATCC 10987]
 gi|42735383|gb|AAS39322.1| phage-associated helicase [Bacillus cereus ATCC 10987]
          Length = 453

 Score =  289 bits (740), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 170/456 (37%), Positives = 256/456 (56%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  QT   ++IL+H   A++  MG GK+V  LTA+  + L  +    VLVIAPLR
Sbjct: 1   MKYNPHKYQTYATNFILEHPIAAVFLEMGLGKSVITLTAIFDLCLDSFEIGKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+ +W +   +  SV  GT ++R   L+ PA +Y+IN EN+ WLV +    +
Sbjct: 61  VARDTWPAEINKWEHLKGLEFSVAIGTKQERLAALRKPASVYLINRENVDWLVNKSGIPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS+    G+K  ++L K    ++R + LTGTPS NGL+DLW +   L
Sbjct: 121 DYDMVVIDELSSFKSY----GAKRFKSLLKVRPRAKRIVGLTGTPSSNGLMDLWAEFRIL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D GKRLGR    +   +F   +    I    Y     A+  I   +SD  +S++  D+  
Sbjct: 177 DMGKRLGRYITHYRNSFFTPDKRNQQI-VFSYKPLPGAEDAIYQLISDITISMESVDFLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + ++    V L       Y +F+ E+  +   E I+A N+A  + K LQ+ANGA+ YD
Sbjct: 236 MPECMINEVPVYLNDKEQSVYDRFREEMVLEFADEEIDAMNAAVLSGKLLQMANGAI-YD 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           ++K+   +HD K+ ALE +IE AN  P+++AY +N DL R++  F       K    I++
Sbjct: 295 DDKNTHIIHDRKLDALEDLIEGANGKPVLIAYWYNHDLERIKAKFNVREI--KTSKDIKD 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I +   HPAS GHGLNLQ GG+ L++F L W LE +QQ   R+     RQ G   
Sbjct: 353 WNNGDISVAVIHPASAGHGLNLQSGGSTLIWFGLTWSLELYQQTNARL----WRQ-GQNE 407

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V ++++I + TIDE V+  LR K   Q  L+NA+K
Sbjct: 408 TVVIHHIITKGTIDEDVMNALRRKEKTQSDLINAVK 443


>gi|21910976|ref|NP_665244.1| putative helicase - phage associated [Streptococcus pyogenes
           MGAS315]
 gi|28876470|ref|NP_795678.1| putative helicase [Streptococcus pyogenes phage 315.6]
 gi|50913383|ref|YP_059355.1| Phage-related DNA helicase [Streptococcus pyogenes MGAS10394]
 gi|21905184|gb|AAM80047.1| putative helicase - phage-associated [Streptococcus pyogenes
           MGAS315]
 gi|50902457|gb|AAT86172.1| Phage-related DNA helicase [Streptococcus pyogenes MGAS10394]
          Length = 440

 Score =  289 bits (740), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 173/457 (37%), Positives = 268/457 (58%), Gaps = 23/457 (5%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGEK-SVLVIAPLRVA 58
           M L  +Q     WI++H  C +   MG GKT++ L+A+  I +++ E   +L++AP +VA
Sbjct: 1   MRLHEYQEYAKTWIVEHPYCGLLLDMGLGKTLTTLSAIDEIQNIFSEDHKILIVAPKKVA 60

Query: 59  QSVWTSEVQRWS-NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           +  W +E+ +W  +F++   S + G+  +R + L+T A +Y+IN EN+ WLV+  K  WP
Sbjct: 61  EETWPTEIGKWHFDFTY---SKVLGSEGKRIEALETEADIYLINRENVTWLVEYYKTKWP 117

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F  +V+DE +  KS +    SK  RAL K   + +R + LTGTP+PN LIDLW QI+ +D
Sbjct: 118 FTFVVIDELSSFKSSK----SKRFRALRKVRPKVQRLVGLTGTPAPNSLIDLWPQIYLMD 173

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           +G RL      F  ++F   +    I    +  ++ A+ EI  ++ D C+S+   DY  +
Sbjct: 174 RGARLETSQTRFKDKYFVPDKRNGLI-IYSWALRDGAEAEIYNKIEDICVSMKAKDYLKL 232

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
             P      V +    MK Y + + +L  + + + I A NSA    K LQ+ANGA+Y D+
Sbjct: 233 --PPRTNNVVSVKLSNMKAYKQLEADLVLEFKNKEISAANSAVLANKLLQMANGAIY-DD 289

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEW 357
           +K    +HD+K+ ALE ++E++   PI+V Y +  DL RL+K FPQ   L     ++ +W
Sbjct: 290 DKATVAIHDDKLDALENVVEESQGQPILVFYQYQHDLERLKKRFPQAEEL----TSVDKW 345

Query: 358 NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
           N GKIP+L  HP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q      
Sbjct: 346 NSGKIPILLCHPQSAGHGLNLQKGGHIIVWFGLTWSLEYYQQANARLD--RQGQT---EP 400

Query: 418 VFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           V V++++A+NT+DE VL+ L+ K   Q+ LL A+K +
Sbjct: 401 VIVHHIVAENTVDEKVLRILQGKEKNQNALLEAVKAQ 437


>gi|116630100|ref|YP_815272.1| SNF2 family DNA/RNA helicase [Lactobacillus gasseri ATCC 33323]
 gi|116095682|gb|ABJ60834.1| Superfamily II DNA/RNA helicase, SNF2 family [Lactobacillus gasseri
           ATCC 33323]
          Length = 450

 Score =  288 bits (738), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 176/457 (38%), Positives = 256/457 (56%), Gaps = 21/457 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIAPLRV 57
           M   PH  Q     +IL+H   AI   MG GK+V  LTA+   IH      VLV+APLRV
Sbjct: 1   MQYKPHEYQQYATKFILEHPVAAILLDMGLGKSVITLTAIKQLIHQDKVHRVLVVAPLRV 60

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           A+  W  E+ +W +   +  SVITG   QR K  +    +Y+IN ENL WL+ E    + 
Sbjct: 61  AKQTWPEEINKWDHLKDLTYSVITGNKSQRVKAAQKEVDIYIINRENLKWLI-ESSIPFD 119

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           +  +V+DE +  KS+R    S+  +AL +     +R + LTGTPS NGL+DLW +   LD
Sbjct: 120 YDMLVIDELSSFKSYR----SQRFKALKRVRPLIKRIVGLTGTPSSNGLMDLWAEFRVLD 175

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
            GKRLGR    + A +F+  +   +     Y  K  A++ I   + D  +S+   DY  +
Sbjct: 176 MGKRLGRFISYYRANYFDPDKRNMY-QVFTYKPKPGAEQSIYRAIDDITISMKSKDYLQL 234

Query: 238 DKPILITKKVPLPQPVMKQ--YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
             P L    VP+     +Q  Y +   +L    QG+ I+A N+AS + K  Q+ANG VY 
Sbjct: 235 --PPLTMNTVPVKMSPSEQTIYDELNAQLVVSTQGKQIDALNAASLSNKLCQMANGCVY- 291

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355
           D+++   ++H  K+ ALE ++E AN  P+++AY F  DLA++++ F Q R + K    I 
Sbjct: 292 DDQQQVVQIHQRKLDALEDLVEAANGKPVLIAYWFKHDLAQIKQRF-QVREI-KTTQDIN 349

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           +WN GKIPL   HPAS GHGLNLQ GG+ L+++ L W LE +QQ   R+   RQ   G +
Sbjct: 350 DWNAGKIPLALIHPASAGHGLNLQAGGSTLIWYGLTWSLELYQQTNARLW--RQ---GQQ 404

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           + V +Y+LI + TIDE ++  L+ K   Q  L+NA+K
Sbjct: 405 QPVVIYHLITEGTIDENIMTALKQKDKTQLALINAVK 441


>gi|288799809|ref|ZP_06405268.1| SNF2 domain protein [Prevotella sp. oral taxon 299 str. F0039]
 gi|288333057|gb|EFC71536.1| SNF2 domain protein [Prevotella sp. oral taxon 299 str. F0039]
          Length = 458

 Score =  288 bits (738), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 176/462 (38%), Positives = 268/462 (58%), Gaps = 26/462 (5%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLRVAQ 59
           NL  +Q   V+ I+ +   A+   MG GKTVS LTA++ +  + +    VLVIAPLRVA+
Sbjct: 5   NLHGYQRAAVEHIIKNPYSALLLDMGLGKTVSTLTAINRLINYSFEVTKVLVIAPLRVAE 64

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQE---LKGTW 116
             W  E  +W +   + IS + G+ K+R++ L T A +YVIN EN+ WLV     L    
Sbjct: 65  HTWAEECDKWEHLKGLKISKVLGSEKKRSEALSTQADIYVINRENVAWLVATHGYLFHNH 124

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWES--ERFIELTGTPSPNGLIDLWGQIW 174
            F  +V+DE +  KS      SK+ R  A  A      R + LTGTP+PNG IDLW Q++
Sbjct: 125 FFDMVVIDELSSFKS------SKSTRWKALKAVRPFLGRVVGLTGTPAPNGYIDLWAQMY 178

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
            +D G RLG+    +   +F++  IG      RY  +  AQ +I + +SD C+S+   DY
Sbjct: 179 LIDMGDRLGKFITRYRETYFSS--IGRGNVVFRYDLRPEAQNKINSLISDICISMKAEDY 236

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDL---QGENIEAFNSASKTVKCLQLANG 291
             + K +    K+ L +   K Y+KF+R+   +L   + E I A ++A+ + K LQ + G
Sbjct: 237 LQLPKRLDYFNKIDLGK-FKKDYNKFERDCVLELFTEEDETITAASAAALSNKLLQFSGG 295

Query: 292 AVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKD- 350
           A+Y DE+ +   +H +K++ALE ++E AN  PI++ Y F  + +R+ + F   R +  D 
Sbjct: 296 AIY-DEDHNTHVIHTKKLEALEDVVEAANGQPILLFYAFKHEESRIIEHFKNLRVVKLDT 354

Query: 351 PCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 410
           P TI+ WN+G+I +  AHPAS GHGLNLQ+GGNI+V++ L W LE +QQ   R+     R
Sbjct: 355 PETIKAWNKGEIDIAIAHPASVGHGLNLQHGGNIIVWYGLTWSLELYQQANARL----HR 410

Query: 411 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           Q G  + V +Y+LI++ TIDE +++ L  K   Q+ L+ A+K
Sbjct: 411 Q-GQSKPVKIYHLISEGTIDEEIVKALSNKDKTQNGLMQAVK 451


>gi|332983341|ref|YP_004464782.1| SNF2-like protein [Mahella australiensis 50-1 BON]
 gi|332701019|gb|AEE97960.1| SNF2-related protein [Mahella australiensis 50-1 BON]
          Length = 451

 Score =  288 bits (738), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 175/458 (38%), Positives = 260/458 (56%), Gaps = 21/458 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q    ++IL H   AI   MG GK+V  LTA+  + L  +  +  L+IAPLR
Sbjct: 1   MKYEPHEYQEYATNFILSHPIAAILLEMGLGKSVITLTAIFDLTLDSFLIRKALIIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+++W + + +  SV  G+  QR   L   A +Y+IN EN+ WL+ +    +
Sbjct: 61  VARDTWPAEIEKWDHLNGLTYSVAVGSEAQRKAALLQRAQVYLINRENVDWLINDSGLPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS      SK  RAL K     +R + LTGTPS NGL+DLW +I  L
Sbjct: 121 DYDMVVIDELSSFKS----HTSKRFRALRKVRPNVKRIVGLTGTPSSNGLMDLWAEIGIL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D GKRLGR    F   +F   +    +    Y  K  A++ I   +SD  +S+   DY  
Sbjct: 177 DMGKRLGRYISHFRYAYFVPDKRNQQV-IFTYKPKPGAEEAIYRLISDITISMKNTDYLK 235

Query: 237 IDKPILITKKVP--LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
           +  P L+  ++P  L +   + Y   + E+   L+G+ I+A N+A+ + K LQ+ANGAV 
Sbjct: 236 L--PDLVINEIPVHLSKDERQHYEIMKSEMVLSLKGKVIDAVNAAALSNKLLQMANGAV- 292

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
           YD       +HD K+ ALE IIE AN  P+++AY +  DL R+ + FP  R LD +  +I
Sbjct: 293 YDGNGGVVRLHDRKLDALEDIIEAANGKPVLIAYWYKHDLERIMERFPAIR-LD-NAESI 350

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
           + WN+G+IP+   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+    QR    
Sbjct: 351 KRWNDGEIPVAVIHPASAGHGLNLQAGGSSLVWFGLTWSLELYQQTNARLWRQGQRD--- 407

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              V +++++A++TIDE V++ L+ K   Q  L++A+K
Sbjct: 408 --TVIIHHIVAKDTIDEQVMKTLKRKDKTQAALIDAVK 443


>gi|225405817|ref|ZP_03761006.1| hypothetical protein CLOSTASPAR_05038 [Clostridium asparagiforme
           DSM 15981]
 gi|225042657|gb|EEG52903.1| hypothetical protein CLOSTASPAR_05038 [Clostridium asparagiforme
           DSM 15981]
          Length = 459

 Score =  288 bits (738), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 169/464 (36%), Positives = 262/464 (56%), Gaps = 25/464 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           M   PH  Q   +D I++ K+  ++  MG GKTV+ LTA+  +  + +  + VLVIAP +
Sbjct: 1   MIFKPHAYQRHCIDRIIETKKLGLFLDMGLGKTVTTLTAIKELKYNRFRVRKVLVIAPKK 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  WT E  +W + + + +S + G+  +R + L TPA LY+IN EN+ WLV   + +W
Sbjct: 61  VAEGTWTREAAKWDHTNMLRVSPVLGSQAKRIRALNTPADLYIINRENVVWLVDYYRNSW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  ++VDES+  KS      +K  +ALA      +R +ELTGTPSPNGL DLW Q++ L
Sbjct: 121 PFDMVIVDESSSFKS----HSAKRFKALASVGDHIDRLVELTGTPSPNGLADLWSQVYLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLG+ +  F  R+F   + G+      Y AK   +  I  ++SD C+S+   DY  
Sbjct: 177 DSGERLGKRYTHFRERYFQPDKRGADGMIYSYEAKPGTESAILEKISDICVSMKAEDYLQ 236

Query: 237 IDKPILITKKVP--LPQPVMKQYHKFQRELYCDLQGE--NIEAFNSASKTVKCLQLANGA 292
           +  P +   ++P  L    +  Y + +R++  +L  +  +I   ++A+ + K LQLANGA
Sbjct: 237 L--PDVTYHEIPVVLDPKALNAYTELERKMILELPEDESDISVTSAAALSNKLLQLANGA 294

Query: 293 VYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQG----RTLD 348
           V YDE++   E+H  KI+A   +IE     P +V Y++  D  R+ KA        R L 
Sbjct: 295 V-YDEDRTVHEIHGCKIEAFLELIESLQGKPALVFYNYQHDRERILKALAGSKLRIREL- 352

Query: 349 KDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTR 408
           K P    +WN  KI +L  HPAS  +GLNLQ GGN +++F L W+ E + Q  +R+    
Sbjct: 353 KKPQDEDDWNARKIDILLTHPASSAYGLNLQQGGNHVIWFGLTWNYELYTQANKRL---- 408

Query: 409 QRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            RQ G    V +++L+   T DE V+Q L+ K  +Q+ ++ +LK
Sbjct: 409 HRQ-GQTEKVIIHHLVCSGTRDEDVMQALQRKDDVQNWVMESLK 451


>gi|332522526|ref|ZP_08398778.1| SNF2 family N-terminal domain protein [Streptococcus porcinus str.
           Jelinkova 176]
 gi|332313790|gb|EGJ26775.1| SNF2 family N-terminal domain protein [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 458

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 176/466 (37%), Positives = 268/466 (57%), Gaps = 24/466 (5%)

Query: 1   MNLAPHQTKIV--DWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M L  H  ++V  D+I+ H   A+   MG GKT + L+A++ +    +    VLVIAPLR
Sbjct: 1   MKLTLHNYQVVAKDFIMGHPHAAVILDMGMGKTATTLSAVNELMFDRFEVTKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA +VW+ E+++WS   H+  S I GT KQR   L+  A +Y++N ENL WLV+     +
Sbjct: 61  VANTVWSDEIEQWSELRHLRYSKIVGTPKQRMVALQKDADIYIVNRENLPWLVELCSPYF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS++    SK  +A        +R + LTGTPS NGL+DL+ +   +
Sbjct: 121 KWDMVVIDELSSFKSWQ----SKRFKAFMAMRPYMKRIVGLTGTPSSNGLMDLFAEFKVI 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    F +R+F   +   +I    Y   + A+ +I+ ++SD  +S+   DY  
Sbjct: 177 DGGERLGRFIGEFRSRYFEEGRRNGNI-VYEYIPMDYAECQIQDKISDITISMKALDY-- 233

Query: 237 IDKPILITKK--VPLPQPVMKQYHKFQRE-LYCDLQGENIEAFNSASKTVKCLQLANGAV 293
           +D P LI+ K  V +     ++Y +F++E +  +L G  + A N+AS T K +QL+NGAV
Sbjct: 234 LDMPELISTKKLVHMSDKEKEKYSQFKKEYVLSELDGLEVTAANAASLTNKLVQLSNGAV 293

Query: 294 YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLA----RLQKAFPQGRTLDK 349
           Y D+      +H++K+ ALE I+E AN  P++VAY F  DLA    RL+K   + R L K
Sbjct: 294 YSDDHT-VVSLHEQKLDALEDILESANGEPVLVAYWFKHDLARIMSRLEKLKVKSRVL-K 351

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
               I+EWN+G +P+   HPA  GHGLNLQ GG+ LV+F L W LE +QQ   R+     
Sbjct: 352 TEEDIREWNKGNVPVGLLHPAGAGHGLNLQKGGHHLVWFGLTWSLELYQQTNARL----W 407

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKET 455
           RQ      V + +++ + TIDE +L+ L  K   Q+ L+ A+K + 
Sbjct: 408 RQGQESETVVIQHIVTEGTIDEEILKALENKDAQQERLIEAVKAQV 453


>gi|259502599|ref|ZP_05745501.1| SNF2 domain protein [Lactobacillus antri DSM 16041]
 gi|259169414|gb|EEW53909.1| SNF2 domain protein [Lactobacillus antri DSM 16041]
          Length = 451

 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 174/458 (37%), Positives = 255/458 (55%), Gaps = 22/458 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEK--SVLVIAPLR 56
           M   PH  Q     +ILDH   AI   MG GK+V  LTA+  + +  EK   VLV+APLR
Sbjct: 1   MQYKPHEYQQYATQFILDHPVAAILLDMGLGKSVITLTAIKQL-IQEEKVHRVLVVAPLR 59

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W  E+ +W +   +  SV+TG   QR K L+    +Y+IN ENL WL++     +
Sbjct: 60  VAKQTWPEEINKWDHLKDLTYSVVTGPKIQRIKALQQNVDIYIINRENLKWLIESSGAPF 119

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS+R    S+  +AL +     +R + LTGTPS NGL+DLW +   L
Sbjct: 120 NYDMLVIDELSSFKSYR----SQRFKALKRVRPLIKRVVGLTGTPSSNGLMDLWAEFRVL 175

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR   S+   +F+  +   +     Y  K  A++ I   + D  +S+   DY  
Sbjct: 176 DMGQRLGRFISSYRMNYFDPDKRNMY-QVFTYKPKPGAEQSIYRAIDDITISMKSKDYLK 234

Query: 237 IDKPILITKKVPLPQPVMKQ--YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
           +  P L    VP+     +Q  Y +   +L    QG+ I+A N+AS + K  Q+ANG V 
Sbjct: 235 L--PPLTMNTVPVKMSDSEQAIYDELNAQLVVSTQGKQIDALNAASLSNKLCQMANGCV- 291

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
           YD+++   ++H  K+ ALE +IE AN  P++VAY F  DL+++++ F   R + K    I
Sbjct: 292 YDDQQQIVQIHQRKLDALEDLIEAANGKPVLVAYWFKHDLSQIKQRFT-AREI-KTVKDI 349

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
           Q+WN G IPL   HPAS GHGLNLQ GG  L+++ L W LE +QQ   R+    QRQ   
Sbjct: 350 QDWNAGNIPLALIHPASAGHGLNLQAGGATLIWYGLTWSLELYQQTNARLWRQGQRQ--- 406

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              V ++++I + TIDE +L  L+ K   Q  L+NA+K
Sbjct: 407 --TVVIHHIITEGTIDENILAALKRKDKTQLALINAVK 442


>gi|238854134|ref|ZP_04644481.1| superfamily II DNA/RNA helicase, SNF2 family [Lactobacillus gasseri
           202-4]
 gi|238833210|gb|EEQ25500.1| superfamily II DNA/RNA helicase, SNF2 family [Lactobacillus gasseri
           202-4]
          Length = 450

 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 175/457 (38%), Positives = 256/457 (56%), Gaps = 21/457 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIAPLRV 57
           M   PH  Q     +IL+H   AI   MG GK+V  LTA+   IH      VLV+APLRV
Sbjct: 1   MQYKPHEYQQYATKFILEHPVAAILLDMGLGKSVITLTAIKQLIHQDKVHRVLVVAPLRV 60

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           A+  W  E+ +W +   +  SVITG   QR K  +    +Y+IN ENL WL+ E    + 
Sbjct: 61  AKQTWPEEINKWDHLKDLTYSVITGNKSQRVKAAQKEVDIYIINRENLKWLI-ESSIPFD 119

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           +  +V+DE +  KS+R    S+  +AL +     +R + LTGTPS NGL+DLW +   LD
Sbjct: 120 YDMLVIDELSSFKSYR----SQRFKALKRVRPLIKRIVGLTGTPSSNGLMDLWAEFRVLD 175

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
            GKRLGR    + A +F+  +   +     Y  K  A++ I   + D  +S+   DY  +
Sbjct: 176 MGKRLGRFISYYRANYFDPDKRNMY-QVFTYKPKPGAEQSIYRAIDDITISMKSKDYLQL 234

Query: 238 DKPILITKKVPLPQPVMKQ--YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
             P L    VP+     +Q  Y +   +L    QG+ I+A N+AS + K  Q+ANG VY 
Sbjct: 235 --PPLTMNTVPVKMSPSEQTIYDELNAQLVVSTQGKQIDALNAASLSNKLCQMANGCVY- 291

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355
           D+++   ++H  K+ A+E ++E AN  P+++AY F  DLA++++ F Q R + K    I 
Sbjct: 292 DDQQQVVQIHQRKLDAIEDLVEAANGKPVLIAYWFKHDLAQIKQRF-QVREI-KTTQDIN 349

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           +WN GKIPL   HPAS GHGLNLQ GG+ L+++ L W LE +QQ   R+   RQ   G +
Sbjct: 350 DWNAGKIPLALIHPASAGHGLNLQAGGSTLIWYGLTWSLELYQQTNARLW--RQ---GQQ 404

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           + V +Y+LI + TIDE ++  L+ K   Q  L+NA+K
Sbjct: 405 QPVVIYHLITEGTIDENIMTALKQKDKTQLALINAVK 441


>gi|28895337|ref|NP_801687.1| hypothetical protein SPs0425 [Streptococcus pyogenes SSI-1]
 gi|28810583|dbj|BAC63520.1| hypothetical protein (phage associated) [Streptococcus pyogenes
           SSI-1]
          Length = 442

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 172/457 (37%), Positives = 268/457 (58%), Gaps = 23/457 (5%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGEK-SVLVIAPLRVA 58
           + L  +Q     WI++H  C +   MG GKT++ L+A+  I +++ E   +L++AP +VA
Sbjct: 3   VRLHEYQEYAKTWIVEHPYCGLLLDMGLGKTLTTLSAIDEIQNIFSEDHKILIVAPKKVA 62

Query: 59  QSVWTSEVQRWS-NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           +  W +E+ +W  +F++   S + G+  +R + L+T A +Y+IN EN+ WLV+  K  WP
Sbjct: 63  EETWPTEIGKWHFDFTY---SKVLGSEGKRIEALETEADIYLINRENVTWLVEYYKTKWP 119

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F  +V+DE +  KS +    SK  RAL K   + +R + LTGTP+PN LIDLW QI+ +D
Sbjct: 120 FTFVVIDELSSFKSSK----SKRFRALRKVRPKVQRLVGLTGTPAPNSLIDLWPQIYLMD 175

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           +G RL      F  ++F   +    I    +  ++ A+ EI  ++ D C+S+   DY  +
Sbjct: 176 RGARLETSQTRFKDKYFVPDKRNGLI-IYSWALRDGAEAEIYNKIEDICVSMKAKDYLKL 234

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
             P      V +    MK Y + + +L  + + + I A NSA    K LQ+ANGA+Y D+
Sbjct: 235 --PPRTNNVVSVKLSNMKAYKQLEADLVLEFKNKEISAANSAVLANKLLQMANGAIY-DD 291

Query: 298 EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEW 357
           +K    +HD+K+ ALE ++E++   PI+V Y +  DL RL+K FPQ   L     ++ +W
Sbjct: 292 DKATVAIHDDKLDALENVVEESQGQPILVFYQYQHDLERLKKRFPQAEEL----TSVDKW 347

Query: 358 NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
           N GKIP+L  HP S GHGLNLQ GG+I+V+F L W LE +QQ   R+   RQ Q      
Sbjct: 348 NSGKIPILLCHPQSAGHGLNLQKGGHIIVWFGLTWSLEYYQQANARL--DRQGQT---EP 402

Query: 418 VFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           V V++++A+NT+DE VL+ L+ K   Q+ LL A+K +
Sbjct: 403 VIVHHIVAENTVDEKVLRILQGKEKNQNALLEAVKAQ 439


>gi|304436366|ref|ZP_07396342.1| SNF2 domain protein [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304370635|gb|EFM24284.1| SNF2 domain protein [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 447

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 175/458 (38%), Positives = 250/458 (54%), Gaps = 18/458 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q   +D+I  HK  A+   MG GKTV  LTAL+ +    +    VLVIAPLR
Sbjct: 1   MKFIPHDYQQYAIDFIESHKTAAVLLDMGLGKTVITLTALNDLLFDRFEISRVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA++ W  E+ +W + +H+  SV  GT K+R   L+  A LY+IN EN+ WLV+  K  +
Sbjct: 61  VARNTWPQEIGKWEHLNHIRYSVAVGTEKERRDALRKQASLYIINRENVPWLVE--KTDF 118

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  IV+DE +  K++     SK  +AL K    ++R I LTGTPS NGL+DL+ +   L
Sbjct: 119 TYDAIVIDELSSFKNW----SSKRFKALMKVRPLAKRVIGLTGTPSGNGLMDLFAEFKVL 174

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G RLGR    +   +F   +    +    Y     A++ I  ++SD  +S+  AD+ N
Sbjct: 175 DMGARLGRFITKYRQDYFKPDKRNGQV-VFSYAPLPGAEERIYEKISDITISMKAADHLN 233

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + K I     V + +   K Y     +L   ++G+ + A N+   + K  Q+ANG VY D
Sbjct: 234 MPKLIESEYSVRMDEAEKKMYDSMCEQLVLQMKGDEVTAANAGVLSGKLAQMANGTVYTD 293

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +      +HD K+ ALE IIE  N  P++V Y F  D  R++K  P  R LD D   I  
Sbjct: 294 DGSTL-HIHDRKLDALEDIIESMNGKPLLVPYWFRHDAERIEKRLPCVR-LDTDDA-IAR 350

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G+I +   HPAS GHGLNLQ GG+ LV+F + W LE +QQ + R+     RQ     
Sbjct: 351 WNRGEISVALIHPASAGHGLNLQSGGSTLVWFGITWSLELYQQTVARL----YRQGQNSN 406

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
            V V ++IA+ TIDE +L+ L+ K   Q  L+ A+K E
Sbjct: 407 TVVVQHIIAEGTIDERILRALKRKDKTQTALIEAVKAE 444


>gi|327461127|gb|EGF07460.1| SNF2 domain protein [Streptococcus sanguinis SK1057]
          Length = 450

 Score =  286 bits (733), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 167/452 (36%), Positives = 265/452 (58%), Gaps = 18/452 (3%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQSVW 62
           P+Q     +I  H+   +   MG GKTV  LTAL  + L  +  + VLVIAPLRVA   W
Sbjct: 7   PYQEVATRFIEKHETACLILDMGLGKTVITLTALWNLILDSFEVRKVLVIAPLRVASHTW 66

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
            SE+ +W +   ++IS+  G+  +R   L   A +Y IN EN+ WL+Q     + F  +V
Sbjct: 67  KSELDKWEHLKGLDISIAIGSEVERRAALTRAAFIYTINRENVVWLIQ--NQLFDFDMVV 124

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRL 182
           +DE +  KS++    +K  +AL K  ++ +R + LTGTP    ++DL+ +I  LD G+RL
Sbjct: 125 IDELSSFKSYQ----AKRFKALKKVRFKIKRMVGLTGTPG--NIMDLFSEIGILDGGERL 178

Query: 183 GRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
           GR    F  ++F+  +    +    Y  K+ A++ I  ++SD  +S+   DY N+ + + 
Sbjct: 179 GRFITGFRNQYFDPDKRNGQV-IFSYKPKDGAEEVIYDKISDMTISMKAVDYLNMPERVN 237

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWK 302
               V + +P    Y +F+ E+   L+G+ ++A NSAS + K LQ+ANG VY D+ +   
Sbjct: 238 NEVLVEMSEPEFAVYKEFKAEMVVSLKGQVLDAVNSASLSNKLLQMANGMVY-DDNRKTV 296

Query: 303 EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKI 362
            +HD+K+ ALE ++E  N  P+++AY F  DL R+++ +P+ R +  +   I++WN+GKI
Sbjct: 297 LLHDQKLVALEEMVESMNGRPLLIAYCFQHDLRRIKERYPEARVIQSNQ-DIEDWNKGKI 355

Query: 363 PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
            L   HPAS GHGLNLQ GG+ + +F L W LE +QQ+  R+     RQ G K  V V++
Sbjct: 356 VLGLIHPASSGHGLNLQAGGHTICWFGLTWSLELYQQLNARL----WRQ-GQKETVVVHH 410

Query: 423 LIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           +I +N+IDE V++RL+ K   Q  L++A+K E
Sbjct: 411 IITKNSIDEQVMKRLKEKDISQQSLIDAVKYE 442


>gi|153955274|ref|YP_001396039.1| Phage-related DNA helicase [Clostridium kluyveri DSM 555]
 gi|146348132|gb|EDK34668.1| Predicted Phage-related DNA helicase [Clostridium kluyveri DSM 555]
          Length = 453

 Score =  286 bits (733), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 170/456 (37%), Positives = 254/456 (55%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  QT   ++IL+H   A++  MG GK+V  LTA+  + L  +    VLVIAPLR
Sbjct: 1   MKYNPHKYQTYATNFILEHPIAAVFLEMGLGKSVITLTAIFDLCLDSFEIGKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+ +W +   +  SV  GT ++R   L+ PA +Y+IN EN+ WLV +    +
Sbjct: 61  VARDTWPAEINKWEHLKGLEFSVAIGTEQERLAALRKPASVYLINRENVDWLVNKSGIPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS+    G+K  ++L K    ++R + LTGTPS NGL+DLW +   L
Sbjct: 121 DYDMVVIDELSSFKSY----GAKRFKSLLKVRPRAKRIVGLTGTPSSNGLMDLWAEFRIL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D GKRLGR    +   +F   +    I    Y     A+  I   +SD  +S+   D+  
Sbjct: 177 DMGKRLGRYITHYRNSFFTPDKRNQQI-VFSYKPLPGAEDAIYRLISDITISMKSVDFLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + ++    V L       Y  F+ E+  +   E I+A N+A  + K LQ+ANGA+ YD
Sbjct: 236 MPECMINEVPVYLNDKEQSVYDHFREEMVFEFADEEIDAMNAAVLSGKLLQMANGAI-YD 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           ++K+   +HD K+ ALE +IE AN  P+++AY +N DL R++  F       K    I++
Sbjct: 295 DDKNTHIIHDRKLDALEDLIEGANGKPVLIAYWYNHDLERIKAKFNVREI--KTSKDIKD 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G I +   HPAS GHGLNLQ GG+ L++F L W LE +QQ   R+     RQ G   
Sbjct: 353 WNNGDISVAVIHPASAGHGLNLQSGGSTLIWFGLTWSLELYQQTNARL----WRQ-GQNE 407

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V ++++I + TIDE V+  LR K   Q  L+NA+K
Sbjct: 408 TVVIHHIITKGTIDEDVMNALRRKEKTQSDLINAVK 443


>gi|254780129|ref|YP_003064542.1| hypothetical protein CLIBASIA_00040 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039806|gb|ACT56602.1| hypothetical protein CLIBASIA_00040 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 220

 Score =  286 bits (733), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 166/216 (76%), Gaps = 1/216 (0%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVW 62
           L PHQ  +V+W+L H RCA+WASMGSGKTVSVL ALS I +   + VL+IAPLRVAQ VW
Sbjct: 5   LKPHQIVMVNWLLSHDRCALWASMGSGKTVSVLFALSTIKILDPRPVLIIAPLRVAQYVW 64

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
             EV+RWS FS M +S + G+ +QR K L TPA LY+INFEN+ WLV+     W FATIV
Sbjct: 65  KDEVERWSAFSDMTVSSLIGSERQRIKALNTPAHLYIINFENIPWLVKMKLDHWDFATIV 124

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
           VDESTKLKSFR  QG+K  RAL K A+   +RFIELTGTPSPNGLIDLWGQIWFLDKGKR
Sbjct: 125 VDESTKLKSFRTHQGTKQTRALGKVAFSKVKRFIELTGTPSPNGLIDLWGQIWFLDKGKR 184

Query: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKE 217
           LG  F+SFV RWF+T Q+GS IGAV++  K  AQKE
Sbjct: 185 LGLSFKSFVERWFHTQQVGSSIGAVKHIPKINAQKE 220


>gi|297587094|ref|ZP_06945739.1| SNF2 domain protein [Finegoldia magna ATCC 53516]
 gi|297575075|gb|EFH93794.1| SNF2 domain protein [Finegoldia magna ATCC 53516]
          Length = 447

 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 172/458 (37%), Positives = 266/458 (58%), Gaps = 21/458 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q    ++I +++  A+   MG GKTV  LTA+  +    +    VL+IAPLR
Sbjct: 1   MKYTPHKYQKYATEFIKENEESALLLDMGLGKTVISLTAIKDLLFDSFEISKVLIIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W  E+++WS+   +  SV  G+ K+R K L+  A +Y+IN EN+ WL+ + +  +
Sbjct: 61  VARDTWKEEIEKWSHLDILKYSVAIGSEKERIKALEEQADIYLINRENVDWLINKSELPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  IV+DE +  KS R    SK  +AL K   + +R + LTGTPS NGL+DLW +   L
Sbjct: 121 NYDMIVIDELSSFKSHR----SKRFKALMKVRPKVKRIVGLTGTPSSNGLMDLWAEFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKET--AQKEIEAQLSDCCLSLDIADY 234
           D G+RLGR    +   +F   +     G + Y+ K    A+  I  ++SD  +S+   DY
Sbjct: 177 DMGERLGRFIGQYREIYFKPDKRN---GPIIYSYKPLPFAEDAIYEKISDITVSMKAEDY 233

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
             + K I     V L       Y   +++L   ++ ++I+A N+A+ + K LQ+A+G+V 
Sbjct: 234 LKMPKKINNEVFVNLSDKERDIYETLKKDLVVSIKDKDIDAVNAAALSNKLLQMASGSV- 292

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
           YDE+K+   +HD K+ ALE +IE AN  P+++AY + SDL R++  F   R L K    +
Sbjct: 293 YDEDKNMIHIHDRKLDALEDLIEGANGKPVLIAYWYKSDLKRIKDRF-DVREL-KASEDL 350

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
           +EWN+G IP+   HPAS GHGLNLQ GG+ L++FSL W LE ++Q   R+   RQ   G 
Sbjct: 351 KEWNQGNIPVAIIHPASAGHGLNLQAGGSTLIWFSLTWSLELYEQTNARL--YRQ---GQ 405

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           K  V +++++A+ TIDE V++ L  K+  Q  L++A+K
Sbjct: 406 KETVVIHHILAKGTIDEDVMKALENKNKTQAALIDAVK 443


>gi|319757800|gb|ADV69742.1| phage related DNA helicase [Streptococcus suis JS14]
          Length = 458

 Score =  286 bits (732), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 174/466 (37%), Positives = 269/466 (57%), Gaps = 24/466 (5%)

Query: 1   MNLAPHQTKIV--DWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M L  H  ++V  D+I+ H   A+   MG GKT + L+A++ +    +    VLVIAPLR
Sbjct: 1   MKLTLHNYQVVVKDFIIAHPYAAVILDMGMGKTATTLSAVNELMFDRFEVTKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA +VW+ E+++W+   H+  S I GT KQR   L+  A +Y++N ENL WLV++    +
Sbjct: 61  VANTVWSDEIEQWAELRHLRYSKIVGTPKQRKVALQKDADVYIVNRENLPWLVEQCSPYF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS++    SK  +A        +R + LTGTPS NGL+DL+ +   +
Sbjct: 121 KWDMVVIDELSSFKSWQ----SKRFKAFMAMRPYMKRIVGLTGTPSSNGLMDLFAEFKVI 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    F +R+F   +   +I    Y   + A+ +I+ ++SD  +S+   DY  
Sbjct: 177 DGGERLGRFIGEFRSRYFEEGRRNGNI-VYEYIPMDYAECQIQDKISDITISMKALDY-- 233

Query: 237 IDKPILITKK--VPLPQPVMKQYHKFQRE-LYCDLQGENIEAFNSASKTVKCLQLANGAV 293
           +D P LI+ K  V + +    +Y +F++E +  +L G  + A N+AS T K +QL+NGAV
Sbjct: 234 LDMPELISTKKLVRMSEKEKAKYSQFKKEYVMSELDGLEVTAANAASLTNKLVQLSNGAV 293

Query: 294 YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLA----RLQKAFPQGRTLDK 349
           Y D+      +H++K+ ALE I+E AN  P++VAY F  DLA    R++K   + R L K
Sbjct: 294 YSDDHT-VVALHEQKLDALEDILESANGEPVLVAYWFKHDLARIINRIEKLRVKSRVL-K 351

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
               I+EWN+G +P+   HPA  GHGLNLQ GG+ LV+F L W LE +QQ   R+     
Sbjct: 352 TEEDIREWNKGNVPVGLLHPAGAGHGLNLQKGGHNLVWFGLTWSLELYQQTNARL----W 407

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKET 455
           RQ      V + +++ + TIDE +L+ L  K   Q+ L+ A+K + 
Sbjct: 408 RQGQESETVVIQHIVTEGTIDEEILKALENKDAQQERLIEAVKAQV 453


>gi|260161780|emb|CAZ39324.1| phage related DNA helicase [Streptococcus suis]
 gi|313575362|emb|CBR26891.1| hypothetical protein [Streptococcus phage phi-SsUD.1]
          Length = 458

 Score =  286 bits (732), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 175/465 (37%), Positives = 270/465 (58%), Gaps = 24/465 (5%)

Query: 1   MNLAPHQTKIV--DWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M L  H  ++V  D+I+ H   A+   MG GKT + L+A++ +    +    VLVIAPLR
Sbjct: 1   MKLTLHNYQVVAKDFIIGHPYAAVILDMGMGKTATTLSAVNELMFDRFEVTKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA +VW+ E+++W+   H+  S I GT KQR   L+  A +Y++N ENL WLV++    +
Sbjct: 61  VANTVWSDEIEQWAELRHLRYSKIVGTPKQRKVALQKDADIYIVNRENLPWLVEQCSPYF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS++    SK  +A        +R + LTGTPS NGL+DL+ +   +
Sbjct: 121 KWNMVVIDELSSFKSWQ----SKRFKAFMAMRPYMKRVVGLTGTPSSNGLMDLFAEFKVI 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    F +R+F   +   +I    Y   + A+ +I+ ++SD  +S+   DY  
Sbjct: 177 DGGERLGRFIGEFRSRYFEEGRRNGNI-VYEYIPMDYAEYQIQDKISDITISMKALDY-- 233

Query: 237 IDKPILITKK--VPLPQPVMKQYHKFQRE-LYCDLQGENIEAFNSASKTVKCLQLANGAV 293
           +D P LI+ K  V + +   ++Y +F++E +  +L G  + A N+AS T K +QL+NGAV
Sbjct: 234 LDMPDLISTKKLVRMSEKEKEKYIQFKKEYVLSELDGLEVTAANAASLTNKLVQLSNGAV 293

Query: 294 YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLA----RLQKAFPQGRTLDK 349
           Y D+      +H++K+ ALE I+E AN  PI+VAY F  DLA    RL+K   + + L K
Sbjct: 294 YSDDHT-VVSLHEQKLDALEDILESANGEPILVAYWFKHDLARIMSRLEKLKLKSQVL-K 351

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
               I+EWN+G +P+   HPA  GHGLNLQ GG+ LV+F L W LE +QQ   R+     
Sbjct: 352 TEEDIREWNKGNVPVGLLHPAGAGHGLNLQKGGHHLVWFGLTWSLELYQQTNARL----W 407

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           RQ      V + +++ + TIDE +L+ L  K   Q+ L+ A+K +
Sbjct: 408 RQGQESETVVIQHIVTEGTIDEEILKALENKDAQQERLIAAVKAQ 452


>gi|219855697|ref|YP_002472819.1| hypothetical protein CKR_2354 [Clostridium kluyveri NBRC 12016]
 gi|219569421|dbj|BAH07405.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 469

 Score =  285 bits (730), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 169/452 (37%), Positives = 253/452 (55%), Gaps = 17/452 (3%)

Query: 5   PH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQS 60
           PH  QT   ++IL+H   A++  MG GK+V  LTA+  + L  +    VLVIAPLRVA+ 
Sbjct: 21  PHKYQTYATNFILEHPIAAVFLEMGLGKSVITLTAIFDLCLDSFEIGKVLVIAPLRVARD 80

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            W +E+ +W +   +  SV  GT ++R   L+ PA +Y+IN EN+ WLV +    + +  
Sbjct: 81  TWPAEINKWEHLKGLEFSVAIGTEQERLAALRKPASVYLINRENVDWLVNKSGIPFDYDM 140

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           +V+DE +  KS+    G+K  ++L K    ++R + LTGTPS NGL+DLW +   LD GK
Sbjct: 141 VVIDELSSFKSY----GAKRFKSLLKVRPRAKRIVGLTGTPSSNGLMDLWAEFRILDMGK 196

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR    +   +F   +    I    Y     A+  I   +SD  +S+   D+  + + 
Sbjct: 197 RLGRYITHYRNSFFTPDKRNQQI-VFSYKPLPGAEDAIYRLISDITISMKSVDFLKMPEC 255

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
           ++    V L       Y  F+ E+  +   E I+A N+A  + K LQ+ANGA+ YD++K+
Sbjct: 256 MINEVPVYLNDKEQSVYDHFREEMVFEFADEEIDAMNAAVLSGKLLQMANGAI-YDDDKN 314

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEG 360
              +HD K+ ALE +IE AN  P+++AY +N DL R++  F       K    I++WN G
Sbjct: 315 THIIHDRKLDALEDLIEGANGKPVLIAYWYNHDLERIKAKFNVREI--KTSKDIKDWNNG 372

Query: 361 KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFV 420
            I +   HPAS GHGLNLQ GG+ L++F L W LE +QQ   R+     RQ G    V +
Sbjct: 373 DISVAVIHPASAGHGLNLQSGGSTLIWFGLTWSLELYQQTNARL----WRQ-GQNETVVI 427

Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           +++I + TIDE V+  LR K   Q  L+NA+K
Sbjct: 428 HHIITKGTIDEDVMNALRRKEKTQSDLINAVK 459


>gi|220930213|ref|YP_002507122.1| SNF2-related protein [Clostridium cellulolyticum H10]
 gi|220000541|gb|ACL77142.1| SNF2-related protein [Clostridium cellulolyticum H10]
          Length = 453

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 172/458 (37%), Positives = 257/458 (56%), Gaps = 21/458 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  QT   ++IL+H   A++  MG GK+V  LTA+  + L  +    VLVIAPLR
Sbjct: 1   MKYNPHKYQTYATNFILEHPIAAVFLEMGLGKSVITLTAIFDLCLDSFEIGKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+ +W +   +  SV  GT ++R   L+ PA +Y+IN EN+ WLV +    +
Sbjct: 61  VARDTWPAEINKWEHLKGLEFSVAIGTEQERLAALRKPASVYLINRENVDWLVNKSGIPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS+    G+K  ++L K    ++R + LTGTPS NGL+DLW +   L
Sbjct: 121 DYDMVVIDELSSFKSY----GAKRFKSLLKVRPRAKRIVGLTGTPSSNGLMDLWAEFRIL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D GKRLGR    +   +F   +    I    Y     A+  I   +SD  +S+   D+  
Sbjct: 177 DMGKRLGRYITHYRNSFFTPDKRNQQI-VFSYKPLPGAEDAIYRLISDITISMKSIDF-- 233

Query: 237 IDKPILITKKVPLPQPVMKQ--YHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
           +  P  +  +VP+     +Q  Y  F+ E+  +   E I+A N+A  + K LQ+ANGA+ 
Sbjct: 234 LKMPECVINEVPVYLNAKEQSVYDHFREEMVLEFGDEEIDAMNAAVLSGKLLQMANGAI- 292

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
           YD++K    +HD K+ ALE +IE AN  P+++AY +N DL R++  F       K    I
Sbjct: 293 YDDDKKPHIIHDRKLDALEDLIEGANGKPVLIAYWYNHDLERIKAKFNVREI--KTSKDI 350

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
           ++WN G I +   HPAS GHGLNLQ GG+ L++F L W LE +QQ   R+     RQ G 
Sbjct: 351 KDWNNGDISVAVIHPASAGHGLNLQSGGSTLIWFGLTWSLELYQQTNARL----WRQ-GQ 405

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           K  V ++++I + TIDE V+  L+ K   Q  L+NA+K
Sbjct: 406 KETVVIHHIITKGTIDEDVMGALKRKEKTQTDLINAVK 443


>gi|284048430|ref|YP_003398769.1| SNF2-related protein [Acidaminococcus fermentans DSM 20731]
 gi|283952651|gb|ADB47454.1| SNF2-related protein [Acidaminococcus fermentans DSM 20731]
          Length = 449

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 169/460 (36%), Positives = 260/460 (56%), Gaps = 22/460 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           M   PH  Q   +++I  H   A+   MG GKTV+ LTA+  +    +  + VLV+APLR
Sbjct: 1   MKFVPHAYQQYAIEYIKTHPVTALLLDMGLGKTVTTLTAIRDLMQDTFEVQRVLVVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W  E+++W +   +  SV+ GTV +R + L+  A +Y++N ENL WL +  +   
Sbjct: 61  VARDTWPEEIRKWDHLKDLTCSVVVGTVTERRRALQKAADIYIVNRENLVWLSRNCR--L 118

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE   L SF+  Q  +  +A+     + +R + LTGTPS NGL+DLW +   L
Sbjct: 119 DFDMVVLDE---LSSFKNPQAQRF-KAMKALRPKVKRIVGLTGTPSGNGLMDLWAEFRLL 174

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKET--AQKEIEAQLSDCCLSLDIADY 234
           D G+RLG+    +   +F   Q     G V ++ K    A++ I  ++SD  +S+   DY
Sbjct: 175 DMGERLGKYISQYRNTYF---QPDKRNGMVVFSYKHLPGAEEAIYRKISDITVSMKATDY 231

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
             +   + +  +V L +   K+Y  F++ L  +L G  + A N+AS T+K  Q+ANGA+Y
Sbjct: 232 LKMPDLVSVRTEVNLSEAERKRYQDFKKSLVMELPGGEVTAANAASLTLKLTQMANGAIY 291

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
            D+ K    +HD K+ ALE ++E AN  P++VAY F  D  R+ +   + R L K     
Sbjct: 292 TDDGKTI-HLHDRKLDALEDLVESANGRPVLVAYWFRHDKERICQRM-EAREL-KSSQDF 348

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
            +WN GKIP+   HPAS GHGLNLQ GG+IL++F L W LE +QQ + R+     RQ   
Sbjct: 349 ADWNAGKIPVALIHPASAGHGLNLQQGGSILIWFGLTWSLELYQQTVARL----WRQGQE 404

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
            R V V +++ ++TIDE +L+ L  K + Q  L+ A+K +
Sbjct: 405 SRTVIVQHIVTKSTIDERILKALEKKDSSQAALIEAVKAD 444


>gi|322382458|ref|ZP_08056353.1| ATP-binding SNF2 helicase-like protein/protein kinase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321153571|gb|EFX45960.1| ATP-binding SNF2 helicase-like protein/protein kinase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 463

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 180/460 (39%), Positives = 267/460 (58%), Gaps = 19/460 (4%)

Query: 1   MNLAPHQTK--IVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGE-KSVLVIAPLR 56
           M   PHQ +      I++    A++  MG GKTVS LTA+  + H + +   VLVIAPLR
Sbjct: 1   MKYKPHQYQEYATQRIIETPYIALFLEMGLGKTVSTLTAIDLLLHDYFDIDKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W+ EV++W +  H+ IS + G+  QR K L   A +YVIN EN+ WLV EL  +W
Sbjct: 61  VAEDTWSREVEKWDHLQHLKISKVLGSAAQRRKALSAKADIYVINRENVEWLVSELGNSW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F T+V+DE   + SF+  Q SK  RAL +     +R I LTGTP+PN L+DLW  I+ L
Sbjct: 121 DFDTVVIDE---ISSFKNHQ-SKRFRALRRVRPMIKRVIGLTGTPAPNSLMDLWAPIYLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D+G+RLG+    F  ++F   +   HI   ++  K+ A++ I   + D  +S+   D+  
Sbjct: 177 DQGERLGKTITGFRDQYFVPGERSGHI-VYKWHEKKEAEQRIYGAIKDIAVSMKAEDWLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + I  T  + L +   + Y K ++EL  +    ++ A  +A+ + K LQ+A+GAV YD
Sbjct: 236 LPERIDRTVPIRLSEKAAQLYKKLEKELLLEFVDADVVATTAAALSNKLLQMASGAV-YD 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ- 355
           EE+  KE+H+ K+ ALE I+E +   P++V Y++   L R+Q+ FPQ R L K    +Q 
Sbjct: 295 EERGVKEIHEAKLDALEDILEASQGKPVMVFYNYKHSLQRVQQRFPQARILRKGKEGVQD 354

Query: 356 --EWNEGKIPLLFAHPASCGHGLNLQYGG-NILVFFSLWWDLEEHQQMIERIGVTRQRQA 412
             +WN  KIPLL  HP S GHGLNLQ      +++F   W LEE QQ   R  V RQ   
Sbjct: 355 ITDWNTNKIPLLLLHPKSAGHGLNLQESNCQTVIWFDQIWSLEEFQQANAR--VYRQ--- 409

Query: 413 GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           G  R + V  L+A+ T+DE V++ +  K+T Q+ L+ A+K
Sbjct: 410 GQTRKIVVMQLVAEGTMDEEVVEAIDKKATGQEELMQAVK 449


>gi|262113725|emb|CAR95392.1| hypothetical protein [Streptococcus phage phi-m46.1]
          Length = 458

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 174/466 (37%), Positives = 268/466 (57%), Gaps = 24/466 (5%)

Query: 1   MNLAPHQTKIV--DWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M L  H  ++V  D+I+ H   A+   MG GKT + L+A++ +    +    VLVIAPLR
Sbjct: 1   MKLTLHNYQVVAKDFIMGHPHAAVILDMGMGKTATTLSAVNELMFDRFEVTKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA +VW+ E+++WS   H+  S I GT KQR   L+  A +Y++N ENL WLV++    +
Sbjct: 61  VANTVWSDEIEQWSELRHLRYSKIVGTPKQRMVALQKDADIYIVNRENLPWLVEQCSPYF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS++    SK  +A        +R + LTGTPS NGL+DL+ +   +
Sbjct: 121 KWDMVVIDELSSFKSWQ----SKRFKAFMAMRPYMKRIVGLTGTPSSNGLMDLFAEFKVI 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    F +R+F   +   +I    Y   + A+ +I+ ++SD  +S+   DY  
Sbjct: 177 DGGERLGRFIGEFRSRYFEEGRRNGNI-VYEYIPMDYAECQIQDKISDITISMKALDY-- 233

Query: 237 IDKPILITKK--VPLPQPVMKQYHKFQRE-LYCDLQGENIEAFNSASKTVKCLQLANGAV 293
           +D P LI+ K  V + +   ++Y +F++E +  +L G  + A N+AS T K +QL+NGAV
Sbjct: 234 LDMPELISTKKLVRMTEKEKEKYIQFKKEYVLSELDGLEVTAANAASLTSKLVQLSNGAV 293

Query: 294 YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLA----RLQKAFPQGRTLDK 349
           Y D+      +H++K+ ALE I+E AN  P++ AY F  DLA    RL+K   + R L K
Sbjct: 294 YSDDHS-VVALHEQKLDALEDILESANGEPVLGAYWFKHDLARILGRLEKLKVKSRVL-K 351

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
               I+EWN+G + +   HPA  GHGLNLQ GG+ LV+F L W LE +QQ   R+     
Sbjct: 352 TEEDIREWNKGNVSVGLLHPAGAGHGLNLQKGGHHLVWFGLTWSLELYQQTNARL----W 407

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKET 455
           RQ      V + +++ + TIDE +L+ L  K   Q+ L+ A+K + 
Sbjct: 408 RQGQESETVIIQHIVTEGTIDEEILKALENKDAQQERLIAAVKAQV 453


>gi|150391738|ref|YP_001321787.1| phage-associated helicase [Alkaliphilus metalliredigens QYMF]
 gi|149951600|gb|ABR50128.1| phage-associated helicase [Alkaliphilus metalliredigens QYMF]
          Length = 414

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 164/406 (40%), Positives = 239/406 (58%), Gaps = 13/406 (3%)

Query: 47  KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLG 106
           + VL+IAPLRVA+  W SE+++W +   ++ SV  GT K+R   L+  A LY+IN EN+ 
Sbjct: 15  RKVLIIAPLRVARDTWPSEIKKWDHLKGLSYSVAVGTEKERKDALRKRATLYIINRENID 74

Query: 107 WLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGL 166
           WLV +    + F  +V+DE +  KS+     +K  ++L K   + +R + LTGTPS NGL
Sbjct: 75  WLVNKSGIPFDFDMVVIDELSSFKSY----SAKRFKSLLKVRPKVKRIVGLTGTPSSNGL 130

Query: 167 IDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCC 226
           +DLW +   LD G+RLGR    +   +F   +    I    Y     A+++I +Q+SD  
Sbjct: 131 MDLWAEFRILDLGQRLGRYITHYRNTYFIPDKRNGQI-IFSYKLLPGAEEKIYSQISDIT 189

Query: 227 LSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCL 286
           +S+   DY  + + ++ T  V L +     Y  F+ ++   L  E I+A N+A  + K L
Sbjct: 190 ISMKSIDYLKMPECVINTVPVYLNEKERAIYSGFRDDMVASLGAEEIDAVNAAVLSGKLL 249

Query: 287 QLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRT 346
           Q+ANGAV YDE+     +HD K+ ALE +IE AN  P+++AY F  DL R+QK FP  R 
Sbjct: 250 QMANGAV-YDEKNKAHFIHDRKLDALEDLIEGANGKPVLIAYWFKHDLDRIQKRFP-ARQ 307

Query: 347 LDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGV 406
           L K    I+EWNEG+IP+   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+  
Sbjct: 308 L-KSSRDIEEWNEGEIPVAVIHPASAGHGLNLQSGGSTLVWFGLTWSLELYQQTNARL-- 364

Query: 407 TRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              RQ G K  V ++++I ++TIDE V+  L  K   Q  L++A+K
Sbjct: 365 --YRQ-GQKDTVVIHHIITKDTIDEDVMTALTKKEKTQASLIDAVK 407


>gi|304439204|ref|ZP_07399122.1| SNF2 domain protein [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372336|gb|EFM25924.1| SNF2 domain protein [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 448

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 172/458 (37%), Positives = 263/458 (57%), Gaps = 21/458 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q    ++I ++K  A+   MG GKTV  LTA+  +    +    VL+IAPLR
Sbjct: 1   MEYTPHKYQNYATEFIKENKESALLLDMGLGKTVISLTAIKDLLFDSFEISKVLIIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W  E+++WS+   +  SV  G+ K+R K L   A +Y+IN EN+ WL+ + K  +
Sbjct: 61  VARDTWKEEIEKWSHLDILKYSVAIGSEKERIKALNEQADIYLINRENVDWLINKSKQPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  IV+DE +  KS R    SK  +AL K   + +R + LTGTPS NGL+DLW +   L
Sbjct: 121 NYDMIVIDELSSFKSHR----SKRFKALMKVRPKVKRIVGLTGTPSSNGLMDLWAEFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKET--AQKEIEAQLSDCCLSLDIADY 234
           D G+RLGR    +   +F   +     G + Y+ K    A+  I  ++SD  +S+   DY
Sbjct: 177 DMGQRLGRFIGQYREIYFKPDKRN---GPIIYSYKPLPFAEDAIYKKISDITVSMKAEDY 233

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
             + + I     V L       Y   +++L  +++ ++I+A N+A+ + K LQ+A+G+V 
Sbjct: 234 LKMPEKINNEVFVNLSDKERGIYETLKKDLVVNIKDKDIDAVNAAALSNKLLQMASGSV- 292

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTI 354
           YDE K+   +H+ K+ ALE +IE AN  P+++AY + SDL R++  F   R L K     
Sbjct: 293 YDEYKNMIHIHNRKLDALEDLIEGANGKPVLIAYWYKSDLKRIKDRF-DVREL-KTSEDF 350

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
           +EWN+ KIP+   HPAS GHGLNLQ GG+ L++FSL W LE ++Q   R+   RQ   G 
Sbjct: 351 KEWNQSKIPVAVIHPASAGHGLNLQAGGSTLIWFSLTWSLELYEQTNARL--YRQ---GQ 405

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           K  V +++++A+ TIDE V++ L  K+  Q  L+ A+K
Sbjct: 406 KETVVIHHILAKGTIDEDVMKALENKNKTQAALIEAVK 443


>gi|298346380|ref|YP_003719067.1| helicase [Mobiluncus curtisii ATCC 43063]
 gi|298236441|gb|ADI67573.1| helicase [Mobiluncus curtisii ATCC 43063]
          Length = 452

 Score =  282 bits (721), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 176/463 (38%), Positives = 258/463 (55%), Gaps = 20/463 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q     +I +H   A+   MG GKTV  LTA+ ++    +    VLVIAPLR
Sbjct: 1   MQYKPHNYQQLATAFIEEHPAAALLLEMGLGKTVITLTAIQHLLFDSFEAHRVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA++ W +E  +WS+   + ++V  GT +QR   L + A + V+N EN+ WL+      W
Sbjct: 61  VARNTWPAEQAKWSHLRQLRLAVAVGTERQRRGALNSGADITVMNRENVDWLITRSGIKW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +++DE +  K+ R    +K   AL K   + +R + LTGTP+ NGL+DLW Q   L
Sbjct: 121 QWDMVIIDELSSFKNHR----AKRFTALMKIRPQVKRIVGLTGTPASNGLMDLWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +  +WF   +  S +    Y  K  A+ EI   +SD  LS+  +DY  
Sbjct: 177 DLGERLGRYISRYRDKWFVPDK-RSGMQVFTYKPKPGAEDEIYRAISDITLSMRTSDYLT 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           +    + T +V +     K Y +   E+  +L  E I+A N+A    K  QLA+GA+ Y 
Sbjct: 236 LPPLTVTTTEVTMNGRERKVYDRLAAEMVVELGDEVIDAANAAVLAGKLTQLASGAI-YT 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           E      VH  K+ ALE +IE AN  P++VAY +  DLAR+++ FPQ R L K    I+ 
Sbjct: 295 EAGDSIVVHGRKLDALEDLIEAANGNPVLVAYWWQHDLARIRERFPQARQL-KTSADIEA 353

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G+IPL   HPAS GHGLNLQ GG+IL+++SL W LE HQQ   R+   RQ   G  +
Sbjct: 354 WNGGEIPLGLIHPASAGHGLNLQQGGSILIWYSLTWSLELHQQTNARL--YRQ---GQTK 408

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA----LKKET 455
            V + ++  +++ID+ +L+ L +K+  Q  L++A    LK ET
Sbjct: 409 PVTITHIATKDSIDQQILRALESKNMTQSALIDAVAQTLKGET 451


>gi|313896513|ref|ZP_07830064.1| SNF2 family N-terminal domain protein [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312974937|gb|EFR40401.1| SNF2 family N-terminal domain protein [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 447

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 172/458 (37%), Positives = 253/458 (55%), Gaps = 18/458 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q   +D+I  HK  A+   MG GKTV  LTAL+ +    +    VLVIAPLR
Sbjct: 1   MKFIPHDYQQYAIDFIESHKTAAVLLDMGLGKTVITLTALNDLLFDRFEISRVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA++ W  E+ +W +  H+  SV+ GT K+R + L+  A LY+IN EN+ WLV+  K  +
Sbjct: 61  VARNTWPQEISKWEHLKHLRYSVVVGTEKERREALRKQASLYIINRENVPWLVE--KTDF 118

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  IV+DE +  K++     SK  +AL K    ++R I LTGTPS NGL+DL+ +   L
Sbjct: 119 VYDAIVIDELSSFKNW----SSKRFKALMKVRPLAKRVIGLTGTPSGNGLMDLFAEFKVL 174

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +   +F   +    +    Y     A++ I  ++SD  +S+  AD+  
Sbjct: 175 DMGQRLGRFITKYRQDYFMPDKRNGQV-VFSYAPLPGAEERIYEKISDITISMKAADHLG 233

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + I     V + +   K Y +   +L   ++G+ + A N+   + K  Q+ANGAVY D
Sbjct: 234 MPELIESEYSVRMNEAEKKIYTEMCDQLVLQMKGDEVTAANAGVLSGKLAQMANGAVYTD 293

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +      +HD K+ ALE  +E  N  P++VAY F  D  R++K     R LD D   I  
Sbjct: 294 DGTTL-HIHDRKLDALEDFVESMNGKPLLVAYWFRHDAERIEKRVTCVR-LDTDDA-IAR 350

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G+I +   HPAS GHGLNLQ GG+ LV+F + W LE +QQ + R+     RQ    +
Sbjct: 351 WNRGEISVALIHPASAGHGLNLQSGGSTLVWFGITWSLELYQQTVARL----YRQGQTAK 406

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
            V V ++IA+ TIDE +L+ L+ K   Q  L+ A+K E
Sbjct: 407 TVVVQHIIAEGTIDERILRALKRKDKTQAALIEAVKAE 444


>gi|50914495|ref|YP_060467.1| Phage-related DNA helicase [Streptococcus pyogenes MGAS10394]
 gi|40218555|gb|AAR83209.1| phage helicase [Streptococcus pyogenes]
 gi|50261600|gb|AAT72368.1| helicase [Streptococcus pyogenes]
 gi|50903569|gb|AAT87284.1| Phage-related DNA helicase [Streptococcus pyogenes MGAS10394]
          Length = 458

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 174/465 (37%), Positives = 268/465 (57%), Gaps = 24/465 (5%)

Query: 1   MNLAPHQTKIV--DWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M L  H  ++V  D+I+ H   A+   MG GKT + L+A++ +    +    VLVIAPLR
Sbjct: 1   MKLTLHNYQVVAKDFIIGHPYAAVILDMGMGKTATTLSAVNELMFDRFEVTKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA +VW+ E+++WS   ++  S I GT KQR   L+  A +Y++N ENL WLV++    +
Sbjct: 61  VANTVWSDEIEQWSELRNLRYSKIVGTPKQRKVALQKDADIYIVNRENLPWLVEQCSPYF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS++    SK  +A        +R + LTGTPS NGL+DL+ +   +
Sbjct: 121 KWDMVVIDELSSFKSWQ----SKRFKAFMTMRPYMKRVVGLTGTPSSNGLMDLFAEFKVI 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    F +R+F   +   +I    Y   + A+ +I+ ++SD  +S+   DY  
Sbjct: 177 DGGERLGRFIGEFRSRYFEEGRRNGNI-VYEYIPMDYAECQIQDKISDITISMKALDY-- 233

Query: 237 IDKPILITKK--VPLPQPVMKQYHKFQRE-LYCDLQGENIEAFNSASKTVKCLQLANGAV 293
           +D P LI+ K  V + +   ++Y +F++E +  +L G  + A N+AS   K +QL+NGAV
Sbjct: 234 LDMPELISTKKLVRMSEKEKEKYIQFKKEYVLSELDGLEVTAANAASLMNKLVQLSNGAV 293

Query: 294 YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLA----RLQKAFPQGRTLDK 349
           Y D+      +H++K+ ALE I+E AN  P++VAY F  DLA    RL+K     R L K
Sbjct: 294 YSDDHT-VVPLHEQKLDALEDILESANGEPVLVAYWFKHDLARITGRLEKLKVTSRVL-K 351

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
               I+EWN+G +P+   HPA  GHGLNLQ GG+ LV+F L W LE +QQ   R+     
Sbjct: 352 TEEDIREWNKGNVPVGLIHPAGAGHGLNLQKGGHHLVWFGLTWSLELYQQTNARL----W 407

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           RQ      V + +++ + TIDE +L+ L  K   Q+ L+ A+K +
Sbjct: 408 RQGQEAETVVIQHIVTEGTIDEEILKALGNKDAQQERLIEAVKAQ 452


>gi|302876787|ref|YP_003845420.1| SNF2-related protein [Clostridium cellulovorans 743B]
 gi|307687468|ref|ZP_07629914.1| SNF2-related protein [Clostridium cellulovorans 743B]
 gi|302579644|gb|ADL53656.1| SNF2-related protein [Clostridium cellulovorans 743B]
          Length = 456

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 166/462 (35%), Positives = 265/462 (57%), Gaps = 27/462 (5%)

Query: 5   PH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQS 60
           PH  Q   +++I  +   AI   MG GK+   LTA+  +    +    VL+IAPLRVA+ 
Sbjct: 7   PHAYQEYAIEFIKKNPIAAILLDMGMGKSSITLTAIMELMYDSFEVSKVLIIAPLRVAKH 66

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            W+ E+++W +   +  S++ GTV QR K L+  A +Y+IN EN+ WL+++    + +  
Sbjct: 67  TWSGEIEKWEHLKGLRYSIVVGTVAQRKKALQKDADIYIINRENVPWLIEQSGQPFDYDM 126

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           +V+DE +  K+++    SK  R+L K     +R + LTGTPS NG++DL+ +   LD G 
Sbjct: 127 VVIDELSSFKNWQ----SKRFRSLMKVRPMVKRMVGLTGTPSSNGMMDLFAEYKVLDMGA 182

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAK--ETAQKEIEAQLSDCCLSLDIADYQNID 238
           RLGR    +   +F   ++    G + Y+ K    A+++I  ++ D  +S+   DY  ++
Sbjct: 183 RLGRFIGQYRLNYFKPDRVN---GPIVYSYKLLPGAEQQIYEKIDDITISMKATDY--LE 237

Query: 239 KPILITKKVP--LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
            P L++ + P  L    +  Y + +++L   L G  I A N+AS + K  Q+ANGAVY D
Sbjct: 238 MPSLLSTEYPVYLSASELDTYEEMKKDLVLSLPGGEITASNAASLSGKLSQMANGAVYTD 297

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFP----QGRTLDKDPC 352
            +K + E HD+K+ ALE IIE AN  P++VAY +  DL R+++       Q + LD D  
Sbjct: 298 -DKSYIEFHDKKLDALEDIIEAANGQPLMVAYWYKHDLIRIEERLKSLGVQYQRLDSD-A 355

Query: 353 TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQA 412
           +I++WN G++P+   HPAS GHGLNLQ GG+ LV+F + W LE +QQ   R+     RQ 
Sbjct: 356 SIEKWNRGELPVALVHPASAGHGLNLQSGGSTLVWFGITWSLELYQQTNARL----YRQG 411

Query: 413 GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
                V + +LI++ TIDE +++ L  K   Q  L++A+K +
Sbjct: 412 QTASCVKIIHLISKGTIDERIVKALSDKDNTQAALIDAVKAD 453


>gi|317132765|ref|YP_004092079.1| SNF2-related protein [Ethanoligenens harbinense YUAN-3]
 gi|315470744|gb|ADU27348.1| SNF2-related protein [Ethanoligenens harbinense YUAN-3]
          Length = 450

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 169/453 (37%), Positives = 247/453 (54%), Gaps = 14/453 (3%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQ 59
           +L  +Q   V +I  H   AI+   G GKT+  LTA   +    +    +LV+APLRVA+
Sbjct: 6   DLHSYQKYCVSYIETHNTAAIFLDCGLGKTIITLTAAVDLLFDSFEVSRILVVAPLRVAR 65

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
             W +E+++W + S +  +V  GT ++R   L   A + +IN ENLGWL+ +    + + 
Sbjct: 66  DTWPAEIRKWEHLSGLTYAVAVGTARERKAALMQQADITIINRENLGWLIDDSGIPFTYD 125

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKG 179
            +V+DE +  K+ +    SK  RAL K   + +R I LTGTPS NGL+DLW +   LDKG
Sbjct: 126 MVVLDELSSFKNHK----SKRFRALMKVRPKVKRIIGLTGTPSSNGLMDLWAEFKVLDKG 181

Query: 180 KRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK 239
           +RLGR    +   +F   +    I    Y     A+  I  ++SD  +S+   D+  + +
Sbjct: 182 ERLGRFITQYRTAYFMPDKRNGEI-IYSYKPLPYAEDAIYRKISDITISMKSTDHLKMPE 240

Query: 240 PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEK 299
            I    +V L     K+Y + + +L  +L G+ I A N+A+ T K  QLANGA+Y D+ K
Sbjct: 241 LISTQYEVQLSAEERKRYEELKNDLVLELHGDEITAANAATLTGKLSQLANGAIYSDDGK 300

Query: 300 HWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNE 359
              E HD K+ ALE IIE AN  P++VAY F  DL R+++ F       K    I +WN 
Sbjct: 301 -IIEFHDRKLDALEDIIEAANGKPLLVAYWFRHDLERIRRRFDVREI--KSSQDIDDWNA 357

Query: 360 GKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVF 419
           G IP+   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+     RQ    R V 
Sbjct: 358 GNIPVAVIHPASAGHGLNLQSGGSTLVWFGLTWSLELYQQTNARL----WRQGQKSRTVV 413

Query: 420 VYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           + +++  +TID  +L  L+ K   Q  L+ A+K
Sbjct: 414 IQHIVTASTIDGQILNALKHKDKTQSALIAAVK 446


>gi|293401139|ref|ZP_06645283.1| SNF2 domain protein [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305265|gb|EFE46510.1| SNF2 domain protein [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 447

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 170/456 (37%), Positives = 252/456 (55%), Gaps = 16/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           MN +PH  Q+  +D+I  H   A+   MG GKTV  LTA++ +    +    +LV+APLR
Sbjct: 1   MNFSPHNYQSYAIDYIETHPVAAVLLDMGLGKTVIFLTAIADLLFDSFEAHRILVVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+ +W +  H+  +V  GTVK+R   L   A + +IN ENLGWL+      +
Sbjct: 61  VARDTWPAEISKWQHLKHLTYAVAVGTVKERKAALSAGADITIINRENLGWLIDSSGYEF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +++DE +  K+ +    SK  ++L K   + +R I LTGTPS NGL+DLW +   L
Sbjct: 121 DYDMVIIDELSSFKNHK----SKRFQSLMKVRPKVKRIIGLTGTPSSNGLMDLWAEFKLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +   +F   +    I    Y     A+  I  ++SD  +S+   D+  
Sbjct: 177 DFGERLGRFITHYRNNYFIPDKRNGEI-IYSYKPMPYAEDAIYRKISDITISMKSTDHLQ 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + I    +V L +   ++Y + + +   +L    I A N+AS T K  QLANGA+ YD
Sbjct: 236 MPELITSQYEVQLSEEEEQRYEELKADFILELPEGEITAANAASLTGKLSQLANGAI-YD 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +E +  E HD K+ ALE IIE AN  P++VAY F  DL R++K F       K    I +
Sbjct: 295 DESNIVEFHDRKLDALEDIIESANGKPLLVAYWFKHDLQRIKKHFDVREI--KTSKDIID 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G IP+   HPAS GHGLNLQ GG+ L++F L W LE +QQ   R+     RQ     
Sbjct: 353 WNNGDIPVAVIHPASAGHGLNLQAGGSTLIWFGLTWSLELYQQTNARL----WRQGQSSG 408

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V + ++I + TIDE +L+ L  K   Q+ L++A+K
Sbjct: 409 TVVIEHIITKGTIDERILKALSLKEVSQNALIDAVK 444


>gi|300853544|ref|YP_003778528.1| putative phage related DNA helicase [Clostridium ljungdahlii DSM
           13528]
 gi|300433659|gb|ADK13426.1| predicted phage related DNA helicase [Clostridium ljungdahlii DSM
           13528]
          Length = 453

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 169/456 (37%), Positives = 253/456 (55%), Gaps = 17/456 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q  +  +IL +   A+   MG GK+V  LTA+  + L  +    VLVIAPLR
Sbjct: 1   MKYNPHDYQNFVTKFILANPISAVLLDMGLGKSVITLTAMFDLCLDSFEISKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W  E+++W +   +  SV  G+  QR   L     +Y+IN EN+ WL+ E    +
Sbjct: 61  VARDTWPLEIKKWDHLKGLTYSVAVGSEAQRKSALMQKVNIYLINRENVDWLINESGIPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE +  KS+     +K  ++L K   + +R + LTGTPS NGL+DLW +   L
Sbjct: 121 DYDMVVIDELSSFKSY----SAKRFKSLLKVRPKVKRIVGLTGTPSSNGLMDLWAEFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D GKRLGR    +   +F+  +    +    Y  K  A+  I   +SD  +S+   DY  
Sbjct: 177 DMGKRLGRFITHYRNNFFDPDKRNQQM-VFSYKPKAGAEDAIYRLISDITISMKSTDYLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + ++    V L +   K Y   +++L   L+GE I+A N+A+ + K  Q+ANGAV Y 
Sbjct: 236 MPECVINEVIVTLSEKERKAYDGMKQDLVLSLKGEEIDAVNAAALSNKLCQMANGAV-YG 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           E+K    +HD+K+ ALE +IE AN  P++VAY FN DL R++K F       K    I+ 
Sbjct: 295 EDKRVFTIHDKKLDALEDLIESANGKPVLVAYWFNHDLERIKKRFKVREI--KTSKDIKN 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN G+I +   HPAS GHGLNLQ GG+ L++F L W LE +QQ   R+     RQ G   
Sbjct: 353 WNNGEIEVAVIHPASAGHGLNLQAGGSTLIWFGLTWSLELYQQTNARL----WRQ-GQNE 407

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V ++++I + TIDE +++ LR K  +Q  L+ A+K
Sbjct: 408 TVVIHHIITKGTIDEDIMRALRRKEKVQSDLIAAVK 443


>gi|57234142|ref|YP_181811.1| SNF2 domain-containing protein [Dehalococcoides ethenogenes 195]
 gi|57224590|gb|AAW39647.1| SNF2 domain protein [Dehalococcoides ethenogenes 195]
          Length = 448

 Score =  280 bits (715), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 174/463 (37%), Positives = 250/463 (53%), Gaps = 22/463 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE---KSVLVIAPL 55
           MN  PH  Q   + +I  H   A+   MG GKTV  LTA+ Y  L+     + VLV+APL
Sbjct: 1   MNFTPHDYQDYAIRYIEKHPVAAVLLDMGLGKTVISLTAV-YDLLFDSFEVRRVLVVAPL 59

Query: 56  RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT 115
           RVA+  W SE+Q+WS+ + +  SV  GT K+R   L   A + +IN ENL WL+ E    
Sbjct: 60  RVARDTWPSEIQKWSHLAGLTFSVAVGTAKERKAALMQQADITIINRENLQWLIDESGFP 119

Query: 116 WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
           + +  +++DE +  K+ +    SK  ++L K      R I LTGTPS NGL+DLW +   
Sbjct: 120 FDYDMVIIDELSSFKNHK----SKRFKSLMKVRPRLHRIIGLTGTPSSNGLMDLWAEFKV 175

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKET--AQKEIEAQLSDCCLSLDIAD 233
           LD G+RLGR    +   +F   +     G + Y+ K    A+  I  ++SD  +S+   D
Sbjct: 176 LDMGERLGRFITQYRTNYFMPDKRN---GEIIYSYKPLLYAEDAIYRKISDITISMKSTD 232

Query: 234 YQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAV 293
           +  + + +    +V L +    +Y   ++E    L    + A N+AS T K  QLANGA+
Sbjct: 233 HLKMPELVSTAYEVQLSESERDRYEDLKQEFILQLPDGEVTAANAASLTGKLSQLANGAI 292

Query: 294 YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCT 353
           Y D  +   E HD K+ ALE IIE AN  P++VAY F  DL+R++  F       K    
Sbjct: 293 YADTGE-IIEFHDRKLDALEDIIEAANEKPLLVAYWFRHDLSRIKNRFNVREI--KTSRD 349

Query: 354 IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 413
           I +WN GKIP+   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+     RQ  
Sbjct: 350 IADWNAGKIPVAVIHPASAGHGLNLQAGGSTLVWFGLTWSLELYQQTNARL----WRQGQ 405

Query: 414 FKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
               V + ++I + TIDE +++ L  K   Q  L++A+K E +
Sbjct: 406 ESHTVVIQHIITKGTIDERIMRALTKKELTQSALIDAVKAEVV 448


>gi|325690428|gb|EGD32431.1| SNF2 domain protein [Streptococcus sanguinis SK115]
          Length = 450

 Score =  279 bits (714), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 164/452 (36%), Positives = 265/452 (58%), Gaps = 18/452 (3%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQSVW 62
           P+Q     +I +H+   +   MG GKTV  LTAL  + L  +  + VLVIAPLRVA   W
Sbjct: 7   PYQEVATRFIEEHETACLILDMGLGKTVITLTALWNLILDSFEVRKVLVIAPLRVASHTW 66

Query: 63  TSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIV 122
            SE+ +W +   ++IS+  G+  +R   L   A +Y IN EN+ WL+Q     + F  +V
Sbjct: 67  KSELDKWEHLKGLDISIAIGSESERRVALSRVAFIYTINRENIVWLIQ--NHLFDFDMVV 124

Query: 123 VDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRL 182
           +DE +  KS++    +K  +AL K  ++ +R + LTGTP    ++DL+ +I  LD G+RL
Sbjct: 125 IDELSSFKSYQ----AKRFKALQKVRFKIKRMVGLTGTPG--NIMDLFSEIGILDGGERL 178

Query: 183 GRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
           GR    F  ++F+  +    +    Y  K+ A++ I  +++D  +S+   DY N+ + + 
Sbjct: 179 GRFITGFRNQYFDPDKRNGQV-IFSYKPKDGAEEAIYDKIADMTISMKAVDYLNMPERVD 237

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWK 302
               V + +  +  Y +F+ E+   ++G+ ++A NSAS + K LQ++NG VY DE +   
Sbjct: 238 NEVLVEMSEHELAVYKEFKTEMMVSIKGQVLDAVNSASLSNKLLQMSNGMVY-DENRKAV 296

Query: 303 EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKI 362
            +HD+K+ ALE ++E  N  P++VAY F  DL R+++ F + R +  +   I++WN+GKI
Sbjct: 297 LLHDQKLVALEEMVESMNNRPLLVAYWFQHDLKRIKERFSEARVIQSNQ-DIEDWNKGKI 355

Query: 363 PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
            L   HPAS GHGLNLQ GG+ + +F L W LE +QQ+  R+     RQ G K  V V++
Sbjct: 356 VLGLVHPASSGHGLNLQAGGHTICWFGLTWSLELYQQLNARL----WRQ-GQKETVVVHH 410

Query: 423 LIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           +I ++T+DE V++RL+ K   Q  L++A+K E
Sbjct: 411 IITKSTMDEQVMKRLKEKDISQQSLIDAVKYE 442


>gi|237738632|ref|ZP_04569113.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
 gi|229424115|gb|EEO39162.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
          Length = 438

 Score =  279 bits (714), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 163/440 (37%), Positives = 255/440 (57%), Gaps = 20/440 (4%)

Query: 26  MGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
           MG GKT+  L+A++ +    +    VL+IAP +VA++ WT E+ +W + S +  S++ G 
Sbjct: 1   MGLGKTIITLSAIADLKFNRFEVGKVLIIAPKKVAEATWTDEIAKWDHLSLLKTSLVLGG 60

Query: 84  VKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARA 143
           +++R K L   A +YVIN EN+ WLV   K  WPF  +V+DE +  K+ +    SK  ++
Sbjct: 61  LQKRIKALAKTADIYVINRENVTWLVDYYKNAWPFDMVVLDEWSSFKNHQ----SKRFKS 116

Query: 144 LAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHI 203
           L     +  R + LTGTP+PNGLIDLW Q++ LD+G+RL +    F  R+F   Q    +
Sbjct: 117 LKVIRNKITRIVGLTGTPAPNGLIDLWAQLYLLDQGERLEKTIGKFRERYFEPGQRNRTV 176

Query: 204 GAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVP--LPQPVMKQYHKFQ 261
               Y AKE + + I  ++SD C+S+   DY  ++ P +I ++VP  L     K Y + +
Sbjct: 177 -IFNYDAKEGSNEAIHEKISDICISMKAEDY--LELPDIIYEQVPVVLDTKAKKAYDELE 233

Query: 262 RELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANA 321
           ++   +L+   I   N+A+ + K LQLANGA+ YDE +   EVHD KI+    +IE+ N 
Sbjct: 234 KKAILELEDTEITVANAAALSNKLLQLANGAI-YDENRKVFEVHDCKIERFLELIEQLNG 292

Query: 322 APIIVAYHFNSDLARLQKAFPQGR---TLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNL 378
            P +V Y+F  D  R+ +A    +    L K P    +WN+G+I +L AHPAS  +GLNL
Sbjct: 293 KPALVFYNFQHDKDRIIEALKDSKLRIRLLKTPQDQLDWNKGEIDILLAHPASAAYGLNL 352

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
           Q GGN +++F L W LE +QQ  +R+     RQ G    V +++L+ + T DE V++ L+
Sbjct: 353 QAGGNHVIWFGLNWSLELYQQANKRL----HRQ-GQTEKVIIHHLVCKETRDEDVMEALQ 407

Query: 439 TKSTIQDLLLNALKKETIHV 458
            K  +Q+ L+ +LK   + V
Sbjct: 408 NKGDVQEALVESLKVRIMKV 427


>gi|167746056|ref|ZP_02418183.1| hypothetical protein ANACAC_00751 [Anaerostipes caccae DSM 14662]
 gi|167654571|gb|EDR98700.1| hypothetical protein ANACAC_00751 [Anaerostipes caccae DSM 14662]
          Length = 452

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 169/466 (36%), Positives = 262/466 (56%), Gaps = 27/466 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           M   PH  Q    ++I  H   A++  MG GKT   LTAL+ +    +    +LV+APLR
Sbjct: 1   MKYNPHDYQRYATEYIESHPAAAVFLDMGLGKTSITLTALNNLLFDYFDVHRILVVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA++ W+ E+++W +  ++  ++  GT K+R   L   + + +IN ENL WL+++    +
Sbjct: 61  VARNTWSDEIEKWDHLHNLTFAIAVGTEKERIAALTQKSDITMINRENLQWLIEKSGQPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +V+DE   L SF+  Q +K  +AL K   + +R + LTGTPS NGL+DL+ +   L
Sbjct: 121 EYDMVVIDE---LSSFKNHQ-AKRFKALMKVRPKVKRIVGLTGTPSSNGLMDLFAEFKIL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAK--ETAQKEIEAQLSDCCLSLDIADY 234
           D G RLGR    +   +F   ++    G + Y+ K    A+  I  ++SD  +S+  AD+
Sbjct: 177 DMGARLGRFIGQYRNSYFKPDKVN---GPIVYSYKPLPGAEDAIYQKISDITISMKAADH 233

Query: 235 QNIDKPILITKK--VPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGA 292
             +  P LI  K  V L     K+Y   + EL   L    I A N+AS + K  Q+ANGA
Sbjct: 234 --LKMPELINTKYMVHLSDKEKKKYEDMKAELVLALPEGEITAANAASLSNKLSQMANGA 291

Query: 293 VYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRT----LD 348
           VY D+E     VH+ K+ ALE IIE AN  P++VAY F  DL R+++   + +     LD
Sbjct: 292 VYADDESIL-SVHERKLDALEDIIESANGKPLLVAYWFKHDLMRIEQRLNEKKIPFQKLD 350

Query: 349 KDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTR 408
            D  +++ WN+G++P+   HPAS GHGLNLQ GG+ LV+F + W LE +QQ + R+    
Sbjct: 351 TD-ASMKRWNKGELPVALIHPASAGHGLNLQSGGSTLVWFGITWSLELYQQTVARL---- 405

Query: 409 QRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
            RQ    R V + +++ Q T+DE +++ L  K + Q  L++A+K E
Sbjct: 406 YRQGQESRTVTIIHILTQGTVDEKIMKALADKDSTQSALIDAVKAE 451


>gi|227496460|ref|ZP_03926744.1| helicase [Actinomyces urogenitalis DSM 15434]
 gi|226834016|gb|EEH66399.1| helicase [Actinomyces urogenitalis DSM 15434]
          Length = 457

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 165/459 (35%), Positives = 253/459 (55%), Gaps = 18/459 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q   +D+IL H RCA++  MG GKT   LTA+  + L  +    VLVIAPLR
Sbjct: 1   MRFVPHDYQRYAIDFILAHPRCALFLDMGLGKTAITLTAIHSLVLDSFDVSRVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W+ E  +W + + + ++   G+  QR + L++ A +  I  EN+ WLV+     W
Sbjct: 61  VARDTWSDEAAKWDDLNGLEVACAVGSPSQRIRALESGAPVTTIGRENVAWLVRHYADAW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
           PF  +V+DES+  K+ +    S+  +AL        R + LTGTP+ NGL+DLW Q   L
Sbjct: 121 PFDMVVLDESSSFKNHQ----SQRFKALKSVLPRITRMVALTGTPAANGLLDLWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWF-NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           D G+RLG+    +  R+F    + G+ + + R   +  + ++I   +SD  +S+   D+ 
Sbjct: 177 DDGERLGKYITHYRDRFFVPDKRSGAQVFSWRL--RPGSDEQIHHLISDITVSMRSVDHL 234

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
           ++    +    V LP      Y   + ++   L G  ++A N+A  + K LQ+A+G V Y
Sbjct: 235 DLPPVTMTDVVVDLPAAARAHYEALREQMVLGLDGALVDAGNAAGLSNKLLQMASGCV-Y 293

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355
           D+     EVH  KI AL  +IE A+ +P++VAY + SDL RL +A P    L +   +++
Sbjct: 294 DDGGAVVEVHRAKIDALADLIEAASGSPVMVAYWYASDLERLLQAVPGAVEL-RSAESMR 352

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           +WN G IP+   HPAS GHGLNLQ GG+ LV+ +  W LE +QQ   R+   RQ   G  
Sbjct: 353 QWNAGCIPVGLIHPASAGHGLNLQAGGHHLVWLTAPWSLELYQQTNARLA--RQ---GQT 407

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
             V +++LIA  TID  VL+ L  K   Q  L++A++ +
Sbjct: 408 HPVSIHHLIAAGTIDVDVLRALERKDVTQSALVDAVRAQ 446


>gi|57233543|ref|YP_180823.1| SNF2 family helicase [Dehalococcoides ethenogenes 195]
 gi|57223991|gb|AAW39048.1| SNF2 family helicase, putative [Dehalococcoides ethenogenes 195]
          Length = 513

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 173/462 (37%), Positives = 255/462 (55%), Gaps = 19/462 (4%)

Query: 1   MNLAPHQTKI--VDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  +I    +I +H   A+   MG GKT   LTAL+ +    +    +LVIAPLR
Sbjct: 60  MKYEPHNYQIYATRYIEEHPISAVLLDMGLGKTSITLTALNDLLFDSFEAHRILVIAPLR 119

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E  +W +  ++  SV  GT  +R   L  PA +Y+IN EN+ WL++E K  +
Sbjct: 120 VARDTWPAEADKWDHLQNLICSVAVGTEAERRAALIKPADIYIINRENVQWLIEESKLPF 179

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F T+VVDE +  K+++    +K  RAL K   + +R I LTGTPS NGL+DLW +   L
Sbjct: 180 NFDTLVVDELSSFKNYQ----AKRFRALMKVRPKVKRIIGLTGTPSANGLMDLWAEFRLL 235

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G RLGR    +   +F   +    +    Y     A++ I  ++SD  +S+   D   
Sbjct: 236 DMGARLGRFISHYRLDYFQPDKRNGQV-IFSYKPLSGAEQRIYDKISDITISMKSTDLLK 294

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + +     V L     ++Y + +++L   L   +I A N+A+ T K  QLANGA+Y D
Sbjct: 295 MPELVSSEYTVRLSDEERQRYDELKQDLVLQLPDGDITAANAAALTGKLCQLANGAIYTD 354

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLA----RLQKAFPQGRTLDKDPC 352
           +   +  +HD K+ ALE IIE A+  PI+VAY F  DLA    RLQK       LD    
Sbjct: 355 DGDTFT-IHDRKLDALENIIEAASGKPILVAYWFKHDLARITERLQKLHIPFSKLDS-AD 412

Query: 353 TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQA 412
           +I++WN G++P+   HPAS GHGLNLQ GG+ +V+F L W LE +QQ   R+     RQ 
Sbjct: 413 SIRKWNAGELPVALIHPASAGHGLNLQSGGSCIVWFGLTWSLELYQQTNARL----WRQG 468

Query: 413 GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
                V V +++A++TIDE +L+ L  K + Q  L+ A+K +
Sbjct: 469 QNAETVVVQHIVAKDTIDERILKVLSKKDSTQAALIAAVKAD 510


>gi|331090252|ref|ZP_08339139.1| hypothetical protein HMPREF1025_02722 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330401871|gb|EGG81446.1| hypothetical protein HMPREF1025_02722 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 453

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 165/456 (36%), Positives = 262/456 (57%), Gaps = 21/456 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q    ++I+ H  CA+   MG GKTV  LTAL  + L  +    VLVIAP R
Sbjct: 1   MEFRPHKYQDYAREFIIGHPVCALILDMGLGKTVITLTALWELALDYFEVGKVLVIAPFR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W  E+++W +   +++SV+ G+ K+R   L+  A +YVIN EN+ WL +  K  W
Sbjct: 61  VARDTWKEELEKWDHLKGLSVSVVVGSEKERLDALEKKASVYVINRENVVWLCE--KHHW 118

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  IV+DE +  KS++    +K  +AL +   ++ R + LTGTP    L+DLW +I  L
Sbjct: 119 DFDMIVIDELSSFKSYQ----AKRFKALRRYRPKAIRVVGLTGTPG--NLMDLWAEIGIL 172

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR   ++  R+F   +   +I    Y  ++ A++ I   +SD C+S+   DY +
Sbjct: 173 DMGQRLGRYIGAYRDRFFLPDKRNRNI-IYSYKPRDGAEEAIYNLISDICISMKAEDYLS 231

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + +    +V + +   K Y + ++++    +  +++A N+A+ + K LQ+ANGAVY D
Sbjct: 232 MPECLYHRVEVRMDEKEEKLYRQKEKDMLLPFEDGDVDAVNAAALSGKLLQMANGAVY-D 290

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           E    + +HD+K+ ALE +IE AN  P++VAY +  DL R+ + F       K    I++
Sbjct: 291 ENHKVRHIHDKKLDALEDLIEAANGKPVLVAYWYQHDLDRIVERFKAVPL--KAAGDIRK 348

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           W EGKIP+   HPAS GHGLN+Q GG+IL++F L W LE + Q   R+    QR+     
Sbjct: 349 WKEGKIPVAAIHPASAGHGLNIQDGGHILIWFGLTWSLELYMQCNARLWRQGQRE----- 403

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            V +Y++I + T+DE  ++ L  K   Q  +++A+K
Sbjct: 404 TVMIYHIINKGTLDEDAMRSLEQKDCGQSAIIDAVK 439


>gi|297583090|ref|YP_003698870.1| SNF2-like protein [Bacillus selenitireducens MLS10]
 gi|297141547|gb|ADH98304.1| SNF2-related protein [Bacillus selenitireducens MLS10]
          Length = 458

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 162/451 (35%), Positives = 261/451 (57%), Gaps = 15/451 (3%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVAQSVWT 63
           +Q   +D+I   +  ++   MG GKTV  LTAL  + L  +  + VLV+APLRV + VW 
Sbjct: 8   YQQYAIDFICQQRIASLILDMGLGKTVITLTALFDLLLDSFHVRKVLVVAPLRVGRDVWP 67

Query: 64  SEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVV 123
            E+ +W +   +   V  G  ++R   L   A + +IN EN+ WL+++    + F  +V+
Sbjct: 68  EELDKWDHLEPLRYEVAIGNPEERLAALHRSAPITIINRENITWLIEKSGYPFDFDMVVI 127

Query: 124 DESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLG 183
           DE   L SF+  Q SK  +++ K   +  R + LTGTPS NGL+DLW +   LDKG+RLG
Sbjct: 128 DE---LSSFKSHQ-SKRFKSMMKVRSKVTRIVGLTGTPSSNGLMDLWAEYRLLDKGERLG 183

Query: 184 RVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILI 243
           R    +   +F   +    +    Y  K  A+++I  ++ D  +S+  +D+ ++   I+ 
Sbjct: 184 RFISHYRDAFFEPDKRNQQV-IFTYKLKPGAEEQIYERIQDITISMKGSDHLSLPPLIVN 242

Query: 244 TKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKE 303
            + V L +  M +    +R+L   ++GE+I A N+A+ + K LQ+ANGAVY D++     
Sbjct: 243 ERHVQLSEKEMARIEAIKRDLIITVEGEDITASNAAALSGKLLQMANGAVY-DDQGQPIA 301

Query: 304 VHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIP 363
           +H+ K+ ALE ++E AN  P+++AY F  DL R+Q A+ +   L  +  +IQ+WNEG+I 
Sbjct: 302 IHERKLDALEDMVEAANGKPVLIAYWFKHDLDRIQ-AWIEATVL-SNAASIQQWNEGRIQ 359

Query: 364 LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
           +   HPAS GHGLNLQ+GG+ L++F L W LE +QQ   R+   RQ Q     +V +++L
Sbjct: 360 VGLIHPASAGHGLNLQFGGSTLIWFGLTWSLELYQQTNARL--YRQGQT---ESVAIHHL 414

Query: 424 IAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           I + T+DE V++ L+ K   Q   ++A+K E
Sbjct: 415 IGKGTLDERVMKALKKKDVSQTAFIDAVKAE 445


>gi|307317157|ref|ZP_07596598.1| DEAD-like helicase [Sinorhizobium meliloti AK83]
 gi|306897245|gb|EFN27990.1| DEAD-like helicase [Sinorhizobium meliloti AK83]
          Length = 522

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 168/476 (35%), Positives = 253/476 (53%), Gaps = 37/476 (7%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIAPLRVAQSV 61
           L  +Q+ + D I+D       A M  GKT + LT +   +  + +   +++APL VA++ 
Sbjct: 53  LRSYQSYLADCIVDMDYLLGAAEMSLGKTAATLTGVRRLLRKFPKWRCIIVAPLEVAKNT 112

Query: 62  WTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT--WPFA 119
           W  E+  W +   +  +V+ G  +QR   LK  A L +IN ENL WL Q + G   W + 
Sbjct: 113 WPEEIAEWEHLQDLTYTVVCGDEQQRLAALKVDADLTIINRENLQWLWQTIGGDTGWRWH 172

Query: 120 TIVVDESTKLKSFRLRQGSKTAR-----------------ALAKPAWESERFIELTGTPS 162
            +V DES++LK F  R  +K                     LA+     +R IELTGTPS
Sbjct: 173 ILVYDESSRLKGFTFRTPNKKKDPKTGETVKRKPTLTEFGVLAQARKHMKRVIELTGTPS 232

Query: 163 PNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQL 222
           PNG+ DL GQ + LD+GKRLG     F  RWF+  Q    +     T K  A+ EI A +
Sbjct: 233 PNGVRDLGGQAYILDQGKRLGVNKTKFENRWFDKNQFTKAV-----TPKAHAKDEIMALM 287

Query: 223 SDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKT 282
            D  + L   DY ++   +     V L   +MK+Y +F++ L    Q  ++EA +    T
Sbjct: 288 KDVMIGLRSQDYIDLPPQVFNPVYVNLSPKLMKEYREFEKTLVA--QNYDVEAVSRGVLT 345

Query: 283 VKCLQLANGAVY------YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLAR 336
            K LQ ANG +Y      ++ ++    +HD K+KALE I+E+A    ++VAY F  D  R
Sbjct: 346 GKLLQFANGGLYRLDEDVFNAKRETIAIHDYKLKALESIVEEAAGQNVLVAYSFQFDKDR 405

Query: 337 LQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEE 396
           ++K FP+    D++P  +++WN GKI +  AHPAS GHGLNLQ+GG+I V+F L W LE 
Sbjct: 406 IRKKFPKAVFFDEEPNFVKKWNAGKIQMGVAHPASIGHGLNLQHGGHIQVWFGLTWSLEL 465

Query: 397 HQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             Q   R+    Q+      +VF++ +IA+ T+DE   + L+ K   QD ++NA++
Sbjct: 466 WDQFNRRLARPGQKN----HSVFIHVIIAKGTMDEAQYETLQIKGVTQDQIMNAVR 517


>gi|256617084|ref|ZP_05473930.1| phage-associated helicase [Enterococcus faecalis ATCC 4200]
 gi|257088353|ref|ZP_05582714.1| phage-associated helicase [Enterococcus faecalis D6]
 gi|256596611|gb|EEU15787.1| phage-associated helicase [Enterococcus faecalis ATCC 4200]
 gi|256996383|gb|EEU83685.1| phage-associated helicase [Enterococcus faecalis D6]
          Length = 451

 Score =  276 bits (705), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 177/463 (38%), Positives = 270/463 (58%), Gaps = 31/463 (6%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           M   PH  Q   +D+I ++K  A+   MG GKTV+ LTA+  +    +  K VL++APLR
Sbjct: 1   MKFIPHEYQQYSIDFIKNNKIAALLLEMGLGKTVTTLTAIKDLMHDDFSIKKVLIVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VAQS W +E+++W +   +  SV+ GT KQR + L   A LY+IN ENL WL+ +    +
Sbjct: 61  VAQSTWPNEIEKWDHLKDLTYSVVLGTPKQRKEALWKKADLYLINRENLDWLITKSGFDF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE +  K+++    +K   +L +   + +R + LTGTPS NGL+DL+ +   L
Sbjct: 121 DFDMVVIDELSSFKNYK----AKRFTSLMQVRHKVDRIVGLTGTPSSNGLMDLFAEFKVL 176

Query: 177 DKGKRLGRVFQSFVARWF-----NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
           D G+RL      +  ++F     N  QI S      +  +E A++EI  ++SD  +S+  
Sbjct: 177 DMGERLEYYISRYRDKYFLPDKRNGLQIYS------WKPRENAEQEIYDKISDITISMKS 230

Query: 232 ADYQNIDKPILITKKVP--LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLA 289
            D+  +D P L+  +VP  L +    +Y KF+ +L   L+  +I+A N+A  + K LQ+A
Sbjct: 231 VDF--LDMPELVINEVPVSLGETEKHKYDKFKADLVLQLKDADIDAANAAVLSNKLLQMA 288

Query: 290 NGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDK 349
           NGA+ YDE      +HD+K+ ALE +IE AN   I++AY F  DL R+++ F   +   K
Sbjct: 289 NGAI-YDEFNVSHHIHDQKLDALEDLIEGANGKSILIAYWFQHDLERIKERFKVRQI--K 345

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
               I+EWN+G IP+   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+   RQ
Sbjct: 346 TAKDIEEWNKGNIPIGVIHPASAGHGLNLQAGGSTLVWFGLTWSLELYQQTNARLW--RQ 403

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              G    V ++++IA++TIDE V+  L+ K   Q  L++A+K
Sbjct: 404 ---GQNETVVIHHIIAKDTIDEDVMLALKLKDKTQASLIDAVK 443


>gi|77412062|ref|ZP_00788388.1| SNF2 domain protein [Streptococcus agalactiae CJB111]
 gi|77161867|gb|EAO72852.1| SNF2 domain protein [Streptococcus agalactiae CJB111]
          Length = 458

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 167/463 (36%), Positives = 262/463 (56%), Gaps = 20/463 (4%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVA 58
           ++L  +Q    D+I+     A+   MG GKT + L+A++ +    +    VLVIAPLRVA
Sbjct: 3   LSLHDYQEVTKDFIIRTPYAAVILDMGMGKTATTLSAINELMFDRYEVSKVLVIAPLRVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
            +VW+ E+++W    H+  + I GT KQR   L+  A +Y++N ENL WLV++    + +
Sbjct: 63  NTVWSDEIEQWEELRHLRYAKIVGTPKQRRAALEQDADIYIVNRENLPWLVEQCSPYFKW 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS++    SK  +A        +R + LTGTPS NGL+DL+ +   +D 
Sbjct: 123 DMVVIDELSSFKSWQ----SKRFKAFMVMRPYMKRVVGLTGTPSSNGLMDLFAEFKVIDG 178

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAV--RYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           G+RLGR    + +R+F     G+  G V   Y   + A+ +I  ++ D  +S+   DY  
Sbjct: 179 GERLGRFIGEYRSRYFRE---GARNGQVVYNYLPMDYAECQIYDKIDDITISMKAMDYLE 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRE-LYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
           + + I   K V L       Y +F+++ +  DL+   + A N+AS + K LQ+ANGAVY 
Sbjct: 236 MPELISTKKVVHLTDKEKSDYKQFKKDYVLADLENGEVTAANAASLSNKLLQMANGAVYS 295

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGR---TLDKDPC 352
           ++ +    +HD+K+ ALE IIE AN  P++VAY F  D+ R+++   + +   T+ K   
Sbjct: 296 NDHQ-VVSLHDQKLDALEDIIEAANGEPVLVAYWFKHDVQRIEERLVKLKVKGTILKTEE 354

Query: 353 TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQA 412
            I+EWN+GKI +   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+     RQ 
Sbjct: 355 DIREWNKGKISVGLLHPASAGHGLNLQKGGHHLVWFGLIWSLELYQQTNARL----WRQG 410

Query: 413 GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKET 455
                V + +++ Q TIDE +L+ L +K   Q  L+ A+K + 
Sbjct: 411 QQADTVVIQHIVTQGTIDEEILKALESKDAQQSRLIEAVKAQV 453


>gi|304406781|ref|ZP_07388436.1| SNF2-related protein [Paenibacillus curdlanolyticus YK9]
 gi|304344314|gb|EFM10153.1| SNF2-related protein [Paenibacillus curdlanolyticus YK9]
          Length = 467

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 162/430 (37%), Positives = 246/430 (57%), Gaps = 24/430 (5%)

Query: 30  KTVSVLTALSYI--HLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQR 87
           KTV  LTA++ +  + +     LV+AP +VA++ WT+E  +W +  H+ I  + G   +R
Sbjct: 47  KTVITLTAVNDLKYNRFAITKTLVVAPKKVAEATWTTEAAKWEHLKHLRIVPVLGDKNKR 106

Query: 88  TKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKP 147
            + L TPA +YVIN +N+ WL +  +  WPF  +V+DE   L SF+    +K  +AL+  
Sbjct: 107 IRALNTPADIYVINRDNVVWLTEYYRNAWPFDLVVLDE---LSSFK-NHAAKRTKALSWV 162

Query: 148 AWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVR 207
               +R + LTGTP+PNGL+DLW QI+ LD+G+RL +    +  ++F     G       
Sbjct: 163 RPHMKRIVGLTGTPAPNGLLDLWAQIFLLDQGQRLEKNITGYRTKYFEHNYHG-----FG 217

Query: 208 YTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVP--LPQPVMKQYHKFQRELY 265
           YTAK  A + I+ ++ D C+S+   DY  +D P  I   +P  L     K Y K +++L 
Sbjct: 218 YTAKPGADEVIQQKIQDICISMKAEDY--LDLPDAIPNVIPIVLDDKAQKLYDKLEKDLL 275

Query: 266 CDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPII 325
             ++G  I A ++A  T K LQL NGA+ YD ++   E+HD KI+A   +IE+ N    +
Sbjct: 276 LQVEGTEITATSAAVLTGKLLQLCNGAL-YDGDRQVHEIHDNKIEAFMELIEQLNGKSAL 334

Query: 326 VAYHFNSDLARLQKAFPQGRTLDKDPCTIQ---EWNEGKIPLLFAHPASCGHGLNLQYGG 382
           V Y +  DLAR++ A  +     ++  T Q   +WN G++ +L AHPAS  +GLNLQ GG
Sbjct: 335 VFYSYQHDLARIKSALSKSGLRIRELSTPQDQLDWNAGEVDILLAHPASAAYGLNLQDGG 394

Query: 383 NILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKST 442
           N +V+F L W LE +QQ   R+     RQ G K+ V +++L+ Q   DE V+  L  K+ 
Sbjct: 395 NHVVWFGLNWSLELYQQANGRL----HRQ-GQKQKVILHHLVVQGGADEDVMAALEGKAA 449

Query: 443 IQDLLLNALK 452
           +QD LL ALK
Sbjct: 450 MQDKLLEALK 459


>gi|76788487|ref|YP_329361.1| prophage LambdaSa04, SNF2 family helicase [Streptococcus agalactiae
           A909]
 gi|76563544|gb|ABA46128.1| prophage LambdaSa04, helicase, SNF2 family [Streptococcus
           agalactiae A909]
          Length = 458

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 167/462 (36%), Positives = 261/462 (56%), Gaps = 20/462 (4%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLRVA 58
           + L  +Q    D+I+     A+   MG GKT + L+A++ +    +    VLVIAPLRVA
Sbjct: 3   LKLHDYQEVTKDFIIRTPYAAVILDMGMGKTATTLSAINELMFDRYEVYKVLVIAPLRVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
            +VW+ E+ +W   +H+  S I GT KQR   L+  A +Y++N ENL WLV++    + +
Sbjct: 63  TTVWSDEIDQWEELNHLRYSKIVGTPKQRQAALEKDADIYIVNRENLPWLVEQCSPYFKW 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS++    SK  +A        +R + LTGTPS NGL+DL+ +   +D 
Sbjct: 123 DMVVIDELSSFKSWQ----SKRFKAFMAMRPYMKRVVGLTGTPSSNGLMDLFAEFKVIDG 178

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G+RLGR    +  R+F   +   ++    Y   + A+ +I  ++ D  +S+   DY  +D
Sbjct: 179 GERLGRFIGEYRGRYFREGRRNGNV-VYEYLPMDYAECQIYDKIDDITISMKAMDY--LD 235

Query: 239 KPILITKK--VPLPQPVMKQYHKFQRE-LYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
            P LI+ K  V L       Y +F+++ +  DL+   + A N+AS + K +Q+ANGAVY 
Sbjct: 236 MPELISTKKVVRLTDKEKASYSQFKKDYIMADLEDTEVTAANAASLSNKLVQMANGAVYS 295

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGR---TLDKDPC 352
           D+++    +HD+K+ ALE IIE AN  P++VAY F  DL R+++   + +   T+ K   
Sbjct: 296 DDQQ-VVSLHDQKLDALEDIIEAANGEPVLVAYWFKHDLKRIEERLAKLKVKGTVLKTEE 354

Query: 353 TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQA 412
            I+EWN+G + +   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+     RQ 
Sbjct: 355 DIREWNKGNVSVGLLHPASSGHGLNLQKGGHHLVWFGLTWSLELYQQTNARL----WRQG 410

Query: 413 GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
                V + +++ + TIDE +L+ L  K   Q  LL A+K +
Sbjct: 411 QQAETVVIQHIVTECTIDEEILKVLENKDAQQARLLEAVKAQ 452


>gi|238018846|ref|ZP_04599272.1| hypothetical protein VEIDISOL_00706 [Veillonella dispar ATCC 17748]
 gi|237864612|gb|EEP65902.1| hypothetical protein VEIDISOL_00706 [Veillonella dispar ATCC 17748]
          Length = 428

 Score =  273 bits (699), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 156/432 (36%), Positives = 252/432 (58%), Gaps = 17/432 (3%)

Query: 26  MGSGKTVSVLTALSYI--HLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
           MG GKT+S L A+  +    +  K VL+IAP +VA+S W  E Q+WS    + ++ + G+
Sbjct: 1   MGLGKTISTLIAIERLMYDYFDIKKVLLIAPKKVAESTWAQETQKWSATRRLMVAKVLGS 60

Query: 84  VKQRTKVLKTPAVLYVINFENLGWLVQ--ELKGTWPFATIVVDESTKLKSFRLRQGSKTA 141
            K+R + L++ + +YVIN EN+ WL +    K ++PF  +V+DES+  K+ +    +K  
Sbjct: 61  EKERIQALESESDVYVINRENVQWLYEYYRKKKSFPFDMLVIDESSSFKNPQ----AKRF 116

Query: 142 RALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGS 201
           +A+ K     +R + LTGTP+PN L+D+W Q++ LD G+RLG+    +  R+F   +   
Sbjct: 117 KAIRKLRPLFKRIVILTGTPAPNTLLDIWAQMYLLDGGERLGKTITEYRTRYFTPDKTNG 176

Query: 202 HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQ 261
           H+    Y  +    K I +++ D C+SL   DY  + + I     V +     + Y + +
Sbjct: 177 HV-VYSYRLQPGGDKAIFSKMQDICMSLKAKDYLTLPERIENVITVEMNPKEWELYKQME 235

Query: 262 RELYCDL-QGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKAN 320
           RE    L   +++ A N+A+   K LQLANG++Y D+      VH+EKI+ L+ ++E   
Sbjct: 236 REHVLSLASDDDVSALNAAALAGKLLQLANGSIYNDD-GEIVVVHNEKIERLKELVETNE 294

Query: 321 AAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQY 380
             P++V Y+F  DL  +++AFP+   L  D   + +WN+G I +L AHPAS G+GLNLQ 
Sbjct: 295 GKPMLVFYNFKHDLQSIKEAFPKAVELKTDD-DVAKWNKGNIQMLLAHPASAGYGLNLQA 353

Query: 381 GGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK 440
           GGNI+V++ L W LE++QQ   R+     RQ G  + V +++L+ + T+DE V++ L  K
Sbjct: 354 GGNIIVWYGLTWSLEQYQQANARL----HRQ-GQTQPVIIHHLVTKGTMDEQVMKALERK 408

Query: 441 STIQDLLLNALK 452
              QD LL A+K
Sbjct: 409 EAGQDALLEAIK 420


>gi|315654958|ref|ZP_07907863.1| SNF2 domain protein [Mobiluncus curtisii ATCC 51333]
 gi|315490919|gb|EFU80539.1| SNF2 domain protein [Mobiluncus curtisii ATCC 51333]
          Length = 452

 Score =  273 bits (698), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 172/463 (37%), Positives = 256/463 (55%), Gaps = 20/463 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q     +I +H   A+   MG GKTV  LTA+  +    +    VLVIAPLR
Sbjct: 1   MQYKPHNYQQLATAFIEEHPVAALLLGMGLGKTVITLTAIQDLLFDSFEAHRVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA++ W +E  +WS+   + ++V  GT +QR   L + A + V+N EN+ WL+      W
Sbjct: 61  VARNTWPAEQTKWSHLRQLRLAVAVGTERQRRGALNSGADITVMNRENVDWLITRSGIKW 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +++DE +  K+ R    +K   AL K   + +R + LTGTP+ NGL+DLW Q   L
Sbjct: 121 QWDMVIIDELSSFKNHR----AKRFTALMKIRPQVKRIVGLTGTPASNGLMDLWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +  +WF   +  S +    Y  K  A++EI   +SD  LS+  +DY  
Sbjct: 177 DLGERLGRYISRYRDKWFVPDK-RSGMQVFTYKPKPGAEEEIYRAISDITLSMRTSDYLT 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           +    + T +V +     K Y +   E+  +L  E I+A N+A    K  QLA+GA+ Y 
Sbjct: 236 LPPLTVTTTEVTMNGRERKVYDRLAAEMVVELGDEVIDAVNAAVLAGKLTQLASGAI-YT 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           E      VH  K+ ALE +IE AN  P++VAY +  DLAR+++ FPQ   L K    I+ 
Sbjct: 295 EAGDSIVVHGRKLDALEDLIEAANGNPVLVAYWWQHDLARIRERFPQASQL-KTSADIEA 353

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN+G+IP+   HPAS GHGLNLQ G +IL+++SL W LE +QQ   R+     RQ G  +
Sbjct: 354 WNDGEIPIGLIHPASAGHGLNLQQGSSILIWYSLTWSLELYQQTNARL----YRQ-GQTK 408

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA----LKKET 455
            V + ++  +++ID+ +L  L +K+  Q  L++A    LK ET
Sbjct: 409 PVTITHIATKDSIDQRILSALESKNMTQSALIDAVAQTLKGET 451


>gi|291556509|emb|CBL33626.1| Superfamily II DNA/RNA helicases, SNF2 family [Eubacterium siraeum
           V10Sc8a]
          Length = 454

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 170/461 (36%), Positives = 251/461 (54%), Gaps = 21/461 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q   +++I +H   A+   MG GKT   L A++ +    +    VLVIAPLR
Sbjct: 1   MKYEPHEYQRYAINYIEEHPFAAVLLDMGLGKTSITLAAIADLLFDSFEVHKVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W++E+Q+W  F  +  SV  G+  +R   L   A +Y+IN EN+ WL+++ K  +
Sbjct: 61  VARDTWSAELQKWDQFHQLTYSVAVGSEAERKAALTRKADIYIINRENVQWLIEKSKLPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +VVDE   L SF+  Q SK  +AL +     +R + LTGTP+ NGL+DLW +   +
Sbjct: 121 DFDMVVVDE---LSSFKNHQ-SKRFKALMQVRPRIKRVVGLTGTPASNGLMDLWAEFKVI 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D GKRLGR    +   +F        I    Y  K  A++ I  Q+SD  +S+   D+  
Sbjct: 177 DMGKRLGRFITYYRQEYFVPDATNGQI-VYSYRPKLGAEQAIYRQISDITISMKSTDHLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + K I    KV L       Y + +++   DL    I A N+A  + K  Q+ANGA+ YD
Sbjct: 236 MPKLISSEYKVYLSPDEQDAYDEMKKQFILDLPEGEISAANAAVLSGKLSQMANGAI-YD 294

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARL-----QKAFPQGRTLDKDP 351
           +  +   +H++K+ ALE IIE AN  P++VAY +  DL R+     ++  P  + LDK  
Sbjct: 295 DAGNAVSIHEQKLDALEDIIESANGKPLLVAYWYQHDLERIMERLHERHIPFSK-LDK-A 352

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            +I+ WN G+I +   HPAS GHGLNLQ GGN +V+F L W LE + Q I R+     RQ
Sbjct: 353 DSIRRWNNGEISVALIHPASAGHGLNLQAGGNTIVWFGLTWSLELYSQTIARL----WRQ 408

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
              +  V V +++   TIDE +L+ L+ K   Q  L+ A+K
Sbjct: 409 GQTEETVIVQHIVTDGTIDEQILRALKAKDKTQSALIAAVK 449


>gi|225573262|ref|ZP_03782017.1| hypothetical protein RUMHYD_01453 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039394|gb|EEG49640.1| hypothetical protein RUMHYD_01453 [Blautia hydrogenotrophica DSM
           10507]
          Length = 454

 Score =  272 bits (695), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 172/463 (37%), Positives = 254/463 (54%), Gaps = 21/463 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEK--SVLVIAPLR 56
           M  +PH  Q    ++I  H   A++ SMG GKT   LTAL+ +   G +    +VIAPLR
Sbjct: 1   MKYSPHEYQKYATEYIETHPVAAVFLSMGLGKTSITLTALNDLLFDGFEIHKAIVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+++W +   +  SV+ GT  +R   L+  A +Y+IN EN+ WLV+     +
Sbjct: 61  VARDTWPAEIEKWDHLGSLIYSVVVGTEAERLAALRRQADIYIINRENVQWLVEASGIPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +VVDE   L SF+  Q SK  RA+ K   +  R + LTGTPS NGL+DLW +   L
Sbjct: 121 DYDMVVVDE---LSSFKNHQ-SKRFRAMMKVRPKVGRIVGLTGTPSSNGLMDLWAEFKLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +  R+F   +    +    Y     A+++I   +SD  +S+   DY  
Sbjct: 177 DMGQRLGRFIGQYRTRFFLPDKRNGQV-VFSYKPLPGAEEQIYRLISDITISMKSTDYLQ 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + +    +V L +   ++Y  F+R+L   L    I A N+A+ + K  Q+ANGAVY D
Sbjct: 236 MPQFVSSGYEVYLSEEETQRYVSFKRDLLLQLPDGEITAANAAALSGKLSQMANGAVYTD 295

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARL-----QKAFPQGRTLDKDP 351
           E +    +HD K+ ALE IIE     P++VAY F  DL R+     +   P  R LD   
Sbjct: 296 EGETIA-IHDRKLDALEDIIESMGGKPLLVAYWFRHDLERITGRLHKLKIPFSR-LDSSK 353

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            +I+ WN G++P+   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+     RQ
Sbjct: 354 -SIRRWNSGELPVALIHPASAGHGLNLQSGGSTLVWFGLTWSLELYQQTNARL----WRQ 408

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
                 V + ++I + TIDE +++ L  K T Q  L+ A+K +
Sbjct: 409 GQQSDIVVIQHIITKGTIDERIMKALSEKDTTQAALIEAVKAD 451


>gi|218133421|ref|ZP_03462225.1| hypothetical protein BACPEC_01286 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990796|gb|EEC56802.1| hypothetical protein BACPEC_01286 [Bacteroides pectinophilus ATCC
           43243]
          Length = 457

 Score =  269 bits (688), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 164/457 (35%), Positives = 261/457 (57%), Gaps = 34/457 (7%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTAL-----SYIHLWGEKSVLVIAPLRVAQS 60
           +Q    D+I++H    +   MG GKTV  LTAL      Y  +   + +LVIAP RVA++
Sbjct: 8   YQQYATDFIIEHPVSCLILDMGLGKTVITLTALWLLLFDYFEV---RRILVIAPKRVAET 64

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            W +E+++W +   M  +V  GT +QR + L + A + +I  +N+ W+ + +   + F  
Sbjct: 65  TWPAEIKKWEHLYGMTFAVAMGTAEQRKEALLSGADVTIIGRDNVSWMTKNI--FFDFDM 122

Query: 121 IVVDESTKLKSFRLR--QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
           +++DE +  KS + +  +  K  R +AK      R + LTGTP    L+DLW +I  LD 
Sbjct: 123 VIIDELSSFKSPKAQRFKDLKKVRPMAK------RVVGLTGTPG--NLMDLWAEIGILDM 174

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G+RLGR    +  R+F   +    I    Y  +E A+++I   +SD  +S+   DY  +D
Sbjct: 175 GQRLGRYIGGYRDRFFLPDKRNREI-IFSYKPREGAEEKIYELISDISISMKAVDY--LD 231

Query: 239 KPILITKKVPLPQPVMKQ--YHKFQRELYCDL-QGENIEAFNSASKTVKCLQLANGAVYY 295
            P  ++ +V +     +Q  Y +   E+  +  +G++I+A N+A+ + K  Q+ANGAVY 
Sbjct: 232 MPECVSNRVSVSMSESEQGLYDRMADEMILEYGEGQDIDAVNAAALSNKLQQMANGAVY- 290

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355
           DE  + + +HD K+ ALE +IE AN  P++VAY F  D  R+ K FP  R ++     I+
Sbjct: 291 DESGNVRNIHDRKLDALEDLIESANGKPLLVAYWFKHDRERILKRFP-ARDINTKK-DIE 348

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           +WNEGKIP+   HPAS GHGLNLQ GG+ +V+FSL W LE +QQ+  R+   RQ Q   K
Sbjct: 349 DWNEGKIPVALIHPASAGHGLNLQEGGSTIVWFSLTWSLELYQQLNARL--YRQGQ---K 403

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             V + +L+ + T+DE +L+ +  K T Q+ ++ A+K
Sbjct: 404 HTVIIEHLVTEGTVDEDILRAIEKKDTTQNAMIEAVK 440


>gi|317501093|ref|ZP_07959299.1| SNF2 domain-containing protein [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|316897480|gb|EFV19545.1| SNF2 domain-containing protein [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 450

 Score =  269 bits (687), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 168/458 (36%), Positives = 245/458 (53%), Gaps = 16/458 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           MN  PH  Q   + +I  H   A+   MG GKT+  LTA++ +    +    VLV+APLR
Sbjct: 1   MNFNPHDYQDYAIRYIEKHPVAAVLLDMGLGKTIISLTAVNDLLFDSFEVHRVLVVAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+++W +   +  +V  GT K+R   L   A + +IN ENL WL+ E    +
Sbjct: 61  VARDTWPAEIKKWEHLRGLTYAVAVGTPKERKTALMQRADITIINRENLQWLIDESGFPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +++DE +  K+ +    SK  ++L K      R I LTGTPS NGL+DLW +   L
Sbjct: 121 DFDMVIIDELSSFKNHK----SKRFKSLMKVRPRIHRIIGLTGTPSSNGLMDLWAEFKVL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +   +F   +    I    Y     A+  I  ++SD  +S+   D+  
Sbjct: 177 DMGERLGRFITQYRTNYFMPDKRNGEI-IYSYKPLPYAEDAIYRRISDITISMKSTDHLK 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + +    +V L      +Y   ++EL   L    + A N+AS T K  QLANGA+Y D
Sbjct: 236 MPELVSTEYEVQLSDSERSRYEDLKQELILQLPDGEVTAANAASLTGKLSQLANGAIYAD 295

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
             +   E HD K+ ALE IIE AN  P++VAY F  DL+R++  F   R + K    I +
Sbjct: 296 TGE-VIEFHDRKLDALEDIIEAANEKPLLVAYWFRHDLSRIKNRF-NVREI-KTSRDIAD 352

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN GKIP+   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+     RQ     
Sbjct: 353 WNAGKIPVAVIHPASAGHGLNLQAGGSTLVWFGLTWSLELYQQTNARL----WRQGQESG 408

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
            V + ++I + TIDE +++ L  K   Q  L++A+K +
Sbjct: 409 TVVIQHIITKGTIDERIVKALSKKEMTQTALIDAVKAD 446


>gi|154504835|ref|ZP_02041573.1| hypothetical protein RUMGNA_02345 [Ruminococcus gnavus ATCC 29149]
 gi|153794718|gb|EDN77138.1| hypothetical protein RUMGNA_02345 [Ruminococcus gnavus ATCC 29149]
          Length = 457

 Score =  266 bits (681), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 165/457 (36%), Positives = 258/457 (56%), Gaps = 34/457 (7%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTAL-----SYIHLWGEKSVLVIAPLRVAQS 60
           +Q    D+I+ H    +   MG GKTV  LTAL      Y  +   + +LVIAP RVA++
Sbjct: 8   YQQFATDFIIGHPVSCLILDMGLGKTVITLTALWLLLFDYFEV---RRILVIAPKRVAET 64

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            W +E+++W +   M  +V  GT  QR + L + A + +I  +N+ W+ + +   + F  
Sbjct: 65  TWPAEIKKWEHLYGMTFAVAMGTAGQRKEALLSGADVTIIGRDNVSWMTKNI--FFDFDM 122

Query: 121 IVVDESTKLKSFRLR--QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
           +V+DE +  KS + +  +  K  R +AK      R + LTGTP    L+DLW +I  LD 
Sbjct: 123 VVIDELSSFKSPKTQRFKDLKKVRPMAK------RVVGLTGTPG--NLMDLWAEIGILDM 174

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G+RLGR    +  R+F   +    I    Y  +E A+++I   +SD  +S+   DY  +D
Sbjct: 175 GQRLGRYIGGYRDRFFLPDKRNREI-IFSYKPREGAEEKIYELISDISISMKAVDY--LD 231

Query: 239 KPILITKKVPLPQPVMKQ--YHKFQRELYCDL-QGENIEAFNSASKTVKCLQLANGAVYY 295
            P  I+ +V +     +Q  Y +   E+  +  +G++I+A N+A+ + K  Q+ANGAVY 
Sbjct: 232 MPECISNRVTVSMSESEQALYDRMADEMILEYGEGQDIDAVNAAALSNKLQQMANGAVY- 290

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355
           DE  + + +HD K+ ALE +IE AN  P++VAY F  D  R+ K FP  R ++     I+
Sbjct: 291 DESGNVRNIHDRKLDALEDLIESANGKPLLVAYWFKHDRERILKRFP-ARDINTKK-DIE 348

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           +WNEGKIP+   HPAS GHGLNLQ GG+ +V+FSL W LE +QQ+  R+   RQ Q   K
Sbjct: 349 DWNEGKIPVALIHPASAGHGLNLQEGGSTIVWFSLTWSLELYQQLNARL--YRQGQ---K 403

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             V + +L+ + T+DE +L+ +  K   Q+ ++ A+K
Sbjct: 404 HTVIIEHLVTEGTVDEDILRAIEKKDNTQNAMIEAVK 440


>gi|309702945|emb|CBJ02276.1| putative phage protein [Escherichia coli ETEC H10407]
          Length = 286

 Score =  265 bits (678), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 188/286 (65%), Gaps = 11/286 (3%)

Query: 19  RCAIWASMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVWTSEVQRWSNFSHMN 76
           RC IWA MG GKTV+ LT L  + + G ++   LV+APLRVA S W  E  +W +  ++ 
Sbjct: 2   RCNIWAGMGMGKTVATLTTLEDLFMAGAETRPALVLAPLRVAASTWPDEAVKWGHLRNIE 61

Query: 77  ISVITGTVKQRTKVL-KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLR 135
           +  I G  K R+  L  + A ++ IN++NL WLV+EL   WPF T++ DEST+LKSFRLR
Sbjct: 62  MQSIVGNAKARSAALANSNASVFTINYDNLVWLVEELGERWPFGTVIPDESTRLKSFRLR 121

Query: 136 QGSKTARALAKPAWES-ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWF 194
            G K A AL K A +   R+I LTGTP+PNGL+DLWGQ WF+D+G+RLGR + +F +RWF
Sbjct: 122 GGGKRAAALGKVAHKYVRRWINLTGTPAPNGLVDLWGQAWFVDQGQRLGRTYGAFTSRWF 181

Query: 195 NTTQIGSHIGAVRYTAKET---AQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQ 251
           N+ Q         +T  E    +Q EI+  L+D  LSLD AD+ +I  PI    +V +P 
Sbjct: 182 NSMQFPGQ----SWTKLEPFAHSQGEIQRALADVTLSLDAADWFDIKDPIHNVIRVDMPP 237

Query: 252 PVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
              +QY + ++E++ +L GE IEA N+A+KT+KCLQ+A+GAVY D+
Sbjct: 238 KARQQYREMEKEMFLELNGEGIEAPNAAAKTLKCLQIASGAVYTDD 283


>gi|167757891|ref|ZP_02430018.1| hypothetical protein CLOSCI_00222 [Clostridium scindens ATCC 35704]
 gi|167664545|gb|EDS08675.1| hypothetical protein CLOSCI_00222 [Clostridium scindens ATCC 35704]
          Length = 454

 Score =  265 bits (678), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 172/462 (37%), Positives = 249/462 (53%), Gaps = 19/462 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q     +I  H   A+  SMG GKT   LTAL+ +    +     +VIAPLR
Sbjct: 1   MKYEPHEYQKYATGYIETHPIAAVLLSMGLGKTSITLTALNDLLFDRFEIHKAIVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W +E+++W + S++  SV  GT  +R   L+  A +Y+IN EN+ WLV+     +
Sbjct: 61  VARDTWPAEIEKWDHLSNLIYSVAVGTEAERLAALRRQADIYIINRENVQWLVETSGIPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            +  +VVDE   L SF+  Q SK  RA+ K   +  R + LTGTPS NGL+DLW +   L
Sbjct: 121 DYDMVVVDE---LSSFKNHQ-SKRFRAMMKVRPKVGRIVGLTGTPSSNGLMDLWAEFKLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G+RLGR    +  R+F   +    +    Y     A+++I   +SD  +S+   DY  
Sbjct: 177 DMGQRLGRSIGQYRTRFFLPDKRNGQV-VFSYKPLPGAEEQIYWLISDITISMKSTDYLQ 235

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + +    +V L +  +++Y  F+R+L   L    I A N+A+ + K  Q+ANGAVY D
Sbjct: 236 MPQFVSSGYEVYLSEEEVQRYVSFKRDLLLQLPDGEITAANAAALSGKLSQMANGAVYTD 295

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDL----ARLQKAFPQGRTLDKDPC 352
           + +    +HD K+ ALE IIE     P++VAY F  DL     RL K       LD    
Sbjct: 296 DGETIA-IHDRKLDALEDIIESMGGKPLLVAYWFRHDLERIAGRLHKLKIPFSRLDSSE- 353

Query: 353 TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQA 412
           +I  WN G++P+   HPAS GHGLNLQ GG+ LV+F L W LE +QQ   R+     RQ 
Sbjct: 354 SIHRWNAGELPVALIHPASAGHGLNLQSGGSTLVWFGLTWSLELYQQTNARL----WRQG 409

Query: 413 GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
                V V ++I + TIDE +++ L  K T Q  L+ A+K +
Sbjct: 410 QQSDTVVVQHIITKGTIDERIMKALSEKDTTQAALIEAVKAD 451


>gi|153814245|ref|ZP_01966913.1| hypothetical protein RUMTOR_00454 [Ruminococcus torques ATCC 27756]
 gi|145848641|gb|EDK25559.1| hypothetical protein RUMTOR_00454 [Ruminococcus torques ATCC 27756]
          Length = 457

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 162/457 (35%), Positives = 258/457 (56%), Gaps = 34/457 (7%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTAL-----SYIHLWGEKSVLVIAPLRVAQS 60
           +Q    D+I+ H    +   MG GKTV  LTAL      Y  +   + +LVIAP RVA++
Sbjct: 8   YQQYATDFIIRHPVSCLILDMGLGKTVITLTALWLLLFDYFEV---RRILVIAPKRVAET 64

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            W  E+++W +   M  +V  GT +QR + L + A + +I  +N+ W+ + +   + F  
Sbjct: 65  TWPVEIKKWEHLYGMTFAVAMGTAEQRKEALLSGADVTIIGRDNVSWMTKNI--FFDFDM 122

Query: 121 IVVDESTKLKSFRLR--QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
           +++DE +  KS + +  +  K  R +AK      R + LTGTP    L+DLW +I  LD 
Sbjct: 123 VIIDELSSFKSPKAQRFKDLKKVRPMAK------RVVGLTGTPG--NLMDLWAEIGILDM 174

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
           G+RLGR    +  R+F   +    I    Y  +E A+++I   +SD  +S+   DY  +D
Sbjct: 175 GQRLGRYIGGYRDRFFLPDKRNQEI-IFSYKPREGAEEKIYELISDISISMKAVDY--LD 231

Query: 239 KPILITKKVPLPQPVMKQ--YHKFQRELYCDL-QGENIEAFNSASKTVKCLQLANGAVYY 295
            P  ++ +V +     +Q  Y +   E+  +  +G++I+A N+A+ + K  Q+ANGAVY 
Sbjct: 232 MPECVSNRVSVSMSESEQGLYDRMADEMILEYGEGQDIDAVNAAALSNKLQQMANGAVY- 290

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355
           DE  + + +HD K+ ALE ++E AN  P++VAY F  D  R+ K FP  R ++     I+
Sbjct: 291 DESGNVRNIHDRKLDALEDLVESANGKPLLVAYWFKHDRERILKRFP-ARDINTKK-DIE 348

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
           +WNEGKIP+   HPAS GHGLNLQ GG+ +V+FSL W LE +QQ+  R+   RQ Q   K
Sbjct: 349 DWNEGKIPVALIHPASAGHGLNLQEGGSTIVWFSLTWSLELYQQLNARL--YRQGQ---K 403

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             V + +L+ + T+DE +L+ +  K   Q+ ++ A+K
Sbjct: 404 HTVIIEHLVTEGTVDEDILRAIEKKDNTQNAMIEAVK 440


>gi|227872572|ref|ZP_03990908.1| helicase [Oribacterium sinus F0268]
 gi|227841573|gb|EEJ51867.1| helicase [Oribacterium sinus F0268]
          Length = 449

 Score =  259 bits (663), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 163/461 (35%), Positives = 254/461 (55%), Gaps = 27/461 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEK-SVLVIAPLRV 57
           M   PH  QT  +D I+  K   ++  MG GKT+  L+A+  +    +   VLVIAP +V
Sbjct: 1   MEFKPHDYQTMCIDRIVKDKSVGLFLDMGLGKTIITLSAIMELKDRLDIFRVLVIAPKKV 60

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
           A+S WT+E ++W +   + IS + G+ K+R   +   A +Y+ N +N+ WL Q L   W 
Sbjct: 61  AESTWTTESKKWEHTKDLKISKVLGSAKERIAAINQAADIYITNRDNVAWLCQTLGRKWF 120

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F  +VVDES+   SF+  Q  +  +AL +      R I LTGTP+P  + DLW QI+ LD
Sbjct: 121 FDMVVVDESS---SFKNPQAMRF-KALKRTLPFVNRLIALTGTPNPKSMEDLWSQIYLLD 176

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           +G+RLG     +  R+F  T+  S  G   YT K  A++ I  ++SD C+SL   DY  +
Sbjct: 177 RGERLGEYVTHYRTRYF--TKDYSGFG---YTLKPGAKEAITKKISDICISLKAKDY--L 229

Query: 238 DKPILITKKVP--LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
           + P ++  ++P  L +  +K Y + ++ +   L+   I A ++   T K  Q ANGA+ Y
Sbjct: 230 ELPSIVYNEIPVELDKKALKAYQELEKNMVLSLEESEITAVSAGVLTNKLSQCANGAI-Y 288

Query: 296 DEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQG----RTLDKDP 351
           DE+K    +HD K++    ++E+ N    +V Y+F  D  R+ KA  +     R   K P
Sbjct: 289 DEDKVVNHIHDCKLERFTELVEELNGESALVFYNFKHDKDRILKALEKSGLEVREF-KSP 347

Query: 352 CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
              ++WN+GKI +L AHPAS  +G+NLQYGG  +++FSL W  E + Q   R+   RQ  
Sbjct: 348 KDEEDWNKGKIDILLAHPASTAYGINLQYGGRNIIWFSLPWSYELYAQANARL--FRQ-- 403

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            G ++ V V+ L+  +T+D  + + L  K   Q+ +L ALK
Sbjct: 404 -GQEKPVIVHELLCTDTVDHDIKKSLSEKGQNQEDVLRALK 443


>gi|325662084|ref|ZP_08150703.1| hypothetical protein HMPREF0490_01441 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471747|gb|EGC74966.1| hypothetical protein HMPREF0490_01441 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 451

 Score =  256 bits (653), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 169/463 (36%), Positives = 252/463 (54%), Gaps = 26/463 (5%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q    ++IL H   A+   MG GKTV  L A++ +    +    VLVIAPLR
Sbjct: 1   MIYNPHDYQRYATEFILSHPIAAVILQMGLGKTVCTLDAINQLMYDSFEVSRVLVIAPLR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           VA+  W+ E+++W N SH+  SV  GT K+R + LK  A +Y+IN EN+ WLV++ K  +
Sbjct: 61  VAKVTWSDEIKKWDNLSHLRYSVAVGTEKERIEALKKDADIYIINRENVQWLVEKSKVPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE +  K++     SK  +A  +     +R + LTGTPSPNG++DL+ Q   L
Sbjct: 121 EFDMVVIDELSSFKNW----NSKRFKAFMQVRPRVKRIVGLTGTPSPNGMMDLFAQFKCL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           D G RLGR    +  ++F   ++   I    Y  +  A+K+I  ++ D  +S+   D+  
Sbjct: 177 DMGARLGRFITQYRNQYFVPDRMNGQI-VYSYRLRPGAEKQIYDKIDDITISMKAMDH-- 233

Query: 237 IDKPILITKKVP--LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
           +  P LI  + P  + +    QY + + +     + E I A N+A+ + K  Q+ANGA+Y
Sbjct: 234 LKMPELIETRYPVYMDEVEQAQYDEMREDYLLPYKEEAITAANAAALSGKLCQMANGAIY 293

Query: 295 YD--EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPC 352
            D  E  H   +HD K++ALE IIE A   PI++ Y F  DL R+ +   Q +       
Sbjct: 294 SDSGEAVH---IHDRKLEALEDIIEAAQ-GPILLCYWFKHDLERITEKLEQLKVFYSRIV 349

Query: 353 T---IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
           T   I++WNEGK  +   HPAS GHGLNLQ+  N +V+F L W LE +QQ   R+     
Sbjct: 350 TEENIRKWNEGKYDVGLIHPASAGHGLNLQHSSNHIVWFGLTWSLELYQQTNARLW---- 405

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           RQ   +  V V +++   TIDE +L  L  K   Q  L++A+K
Sbjct: 406 RQGQKQDTVVVQHIVTAGTIDEDILDALTHKDASQTRLIDAVK 448


>gi|91214213|ref|NP_919000.2| helicase [Burkholderia phage BcepNazgul]
 gi|88604906|gb|AAQ63367.2| helicase [Burkholderia phage BcepNazgul]
          Length = 522

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 165/510 (32%), Positives = 250/510 (49%), Gaps = 76/510 (14%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS-YIHLWGEKSVLVIAPLRVAQ 59
           + L  +Q K VD++ ++   A++  +G GKTV  LT L   +  +  K  LVIAPLRVA 
Sbjct: 10  IELHAYQDKCVDFLEENPFSALFIDLGMGKTVICLTLLDRLLSRFAYKHCLVIAPLRVAT 69

Query: 60  SVWTSEVQRWSNFSHMNISVITGT-------------------------------VKQRT 88
             W +E+  W + ++M+  +I                                   KQR 
Sbjct: 70  QTWPNEIPLWQHTAYMSHVLIRAEDEKSVELIAEAGRKQRARSDYRAFTTRGDDGRKQRN 129

Query: 89  --------------------KVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTK 128
                               ++ +TPA L++IN E L WL+      WPF  + +DES+ 
Sbjct: 130 PELERDVARAKAEMKEKILQRLARTPASLHIINREQLEWLIDLFGEMWPFDVVFIDESSS 189

Query: 129 LK---SFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRV 185
            K   S R ++  KT R   K      R   LT TP+      L+ Q+W LDKG+RLG  
Sbjct: 190 FKDHNSIRFKK-LKTVRPYIK------RLHLLTATPAAETYEHLFAQMWLLDKGERLGNN 242

Query: 186 FQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITK 245
              +  R+F             Y  +   + EI ++++D CL +   DY  +DKP+L+ +
Sbjct: 243 ITYYRNRYFTYNHYSR-----TYKLRPGCENEILSKIADICLVMKAEDYLKVDKPLLLKR 297

Query: 246 KVPLPQPVMKQYHKFQRELYCDL-QGENIEAFNSASKTVKCLQLANGAVYYDEEK-HWKE 303
            + +       Y KF+R+   DL  G  IEA  +A+   K LQLA+G VY  E+K HW  
Sbjct: 298 AIKMTDEQSAMYKKFERDFILDLPDGTEIEAETAAALNQKLLQLASGCVYDAEKKTHW-- 355

Query: 304 VHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIP 363
           VHD KI+ L  ++E+ N  P++VAY F S L RL+KAFP+ R +D +   + +WN+GKI 
Sbjct: 356 VHDHKIEDLTQLVEELNGEPLLVAYWFKSSLERLKKAFPRARVMDAEGKLVGDWNKGKIK 415

Query: 364 LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
           +L  HPAS  HGLN+Q GG+ L  + +++ LE + Q+I R+    QR       V V++ 
Sbjct: 416 ILLVHPASVAHGLNMQKGGHHLYIYDIFYSLELYLQLIGRLARQGQRH-----VVRVHHA 470

Query: 424 IAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
               T+D++ +  L  K   QD L   L++
Sbjct: 471 TMIGTVDDVAVSSLTRKRNAQDDLFVRLRR 500


>gi|255994014|ref|ZP_05427149.1| SNF2 domain protein [Eubacterium saphenum ATCC 49989]
 gi|255993682|gb|EEU03771.1| SNF2 domain protein [Eubacterium saphenum ATCC 49989]
          Length = 467

 Score =  252 bits (644), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 171/467 (36%), Positives = 251/467 (53%), Gaps = 38/467 (8%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALS----YIHLWGEKSVLVIAPLRVAQSV 61
           +Q + +D +L H    ++  MG GKTV  LTA++    Y  + G    LVIAPL VA S 
Sbjct: 9   YQRECIDRLLTHNSYGLFIDMGLGKTVITLTAVNELIRYRFMVGR--CLVIAPLSVAMST 66

Query: 62  WTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK---GTWP- 117
           W +E+ +W +   + +S + G+   R K L   A +Y+IN EN+ WLV+ L+   G W  
Sbjct: 67  WQTEISKWRHLEGLTVSTVIGSRTARIKALNAKADVYIINRENVVWLVEYLESEAGGWSF 126

Query: 118 -FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DEST  K+ +    +K  +AL K   + +R + LTGTP+PNGL+D+W Q + L
Sbjct: 127 DFDMVVIDESTSFKNPK----AKRFKALCKVRHKIKRLVLLTGTPAPNGLMDVWAQSYLL 182

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAK--ETAQKEIEAQLSDCCLSLDIADY 234
           D GKRL   F  F   +F     G  +  V Y  K    A +EI  +LSD  LSL   DY
Sbjct: 183 DGGKRLYNNFYRFREAYFIP---GRAVNGVVYDYKIRTGAYEEITHRLSDISLSLKSEDY 239

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQ-------GENIEAFNSASKTVKCLQ 287
             +     +   V L     + Y KF+R   C L+         ++ A  +A  + K LQ
Sbjct: 240 LELPDITYVDNLVELDTIARRAYAKFERG--CVLRYLDDTDSASSVMASTAADLSGKLLQ 297

Query: 288 LANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGR-- 345
           LA GA+Y ++ K +  VHD K+KAL  ++E  N   II+ Y+F  + ARL  AF   +  
Sbjct: 298 LAGGAIYQEDSKDYVTVHDTKLKALTELVEPLN-ENIIIFYNFLHEKARLCNAFSDFKGE 356

Query: 346 -TLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERI 404
             + K    I +WN GK+ +L AHPA+ G+GLNLQ GG  +++F L    E++ Q  +R+
Sbjct: 357 VRVFKSGKDIADWNAGKVNILIAHPAAMGYGLNLQQGGRRIIWFGLPQSYEQYAQANKRL 416

Query: 405 GVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNAL 451
                RQ G +  VFV+ L+ + T DE VL  L  K ++Q  LL++L
Sbjct: 417 ----HRQ-GQQDKVFVHRLVCKGTRDEDVLSALAHKDSMQKYLLSSL 458


>gi|320182116|gb|EFW57020.1| DNA polymerase, phage-associated [Shigella boydii ATCC 9905]
          Length = 533

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 160/208 (76%), Gaps = 10/208 (4%)

Query: 249 LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEK 308
           LP+P +KQ          +   E IEA N+A+KT+KCLQ+A+GAVY D+   W E+HD K
Sbjct: 335 LPRPSLKQ----------EQIDEGIEAPNAAAKTLKCLQIASGAVYTDDAGSWSELHDTK 384

Query: 309 IKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAH 368
           ++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN GKIP+LFAH
Sbjct: 385 LQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSGKIPVLFAH 444

Query: 369 PASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNT 428
           PAS GHGLN+Q GG ILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF++++IA +T
Sbjct: 445 PASAGHGLNMQDGGYILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFIHHIIAADT 504

Query: 429 IDELVLQRLRTKSTIQDLLLNALKKETI 456
           +DE+V+++  +K T+QD+LL+A+KK  I
Sbjct: 505 MDEMVMEQRNSKRTVQDILLDAMKKRGI 532


>gi|194432044|ref|ZP_03064333.1| Bbp42 [Shigella dysenteriae 1012]
 gi|194419573|gb|EDX35653.1| Bbp42 [Shigella dysenteriae 1012]
 gi|332089212|gb|EGI94319.1| DNA polymerase [Shigella dysenteriae 155-74]
          Length = 449

 Score =  249 bits (636), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 116/208 (55%), Positives = 160/208 (76%), Gaps = 10/208 (4%)

Query: 249 LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEK 308
           LP+P +KQ          +   E IEA N+A+KT+KCLQ+A+GAVY D+   W E+HD K
Sbjct: 251 LPRPSLKQ----------EQIDEGIEAPNAAAKTLKCLQIASGAVYTDDAGSWSELHDTK 300

Query: 309 IKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAH 368
           ++AL+ I+ +A  AP++VAYH+  DL RL KAFP+GR LD+DP T+++WN GKIP+LFAH
Sbjct: 301 LQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSGKIPVLFAH 360

Query: 369 PASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNT 428
           PAS GHGLN+Q GG ILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF++++IA +T
Sbjct: 361 PASAGHGLNMQDGGYILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFIHHIIAADT 420

Query: 429 IDELVLQRLRTKSTIQDLLLNALKKETI 456
           +DE+V+++  +K T+Q++LL+A+KK  I
Sbjct: 421 MDEMVMEQRNSKRTVQNILLDAMKKRGI 448


>gi|325684273|gb|EGD26446.1| SNF2 domain protein [Lactobacillus delbrueckii subsp. lactis DSM
           20072]
          Length = 633

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 163/479 (34%), Positives = 255/479 (53%), Gaps = 48/479 (10%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQ 59
           + L  +Q   +++I+DH  C I+  +G GKT++ L AL+ +   G K  +LVIAP  VA+
Sbjct: 174 LPLHDYQLYSMNFIMDHPYCGIFLDIGLGKTLTTLAALAKLREEGMKGHILVIAPKTVAK 233

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPA------------------VLYVIN 101
           S W  E+ +W N      S +T    ++ + L TPA                   LY  +
Sbjct: 234 STWQDEIDKW-NLPFKTQSFLT---DEKGRQL-TPAGRQELYEAAAAKAAKGDWQLYFAS 288

Query: 102 FENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTP 161
            + +  LV    G W F  +V+DES   KS      S+  +AL       +R IELTGTP
Sbjct: 289 RDLVSKLVD--LGPWLFKNVVIDESQSFKS----PASQRFKALKSVRGRIQRLIELTGTP 342

Query: 162 SPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQ-IGSHIGAVRYTAKETAQKEIEA 220
           +PN L DLW QI+ LD+G+RLGR   ++  ++F  T  + +H   V++     ++++I  
Sbjct: 343 APNSLQDLWSQIYLLDQGERLGRSITAYRQQYFEPTLLVNNH--PVKWRLLPGSEEKIYR 400

Query: 221 QLSDCCLSLDIADYQNIDKPILITKK--VPLPQPVMKQYHKFQRELYCDLQGENIEAFNS 278
            + D  +S+       +  P L      V +P    K Y + +++   DL G+ I A N+
Sbjct: 401 AIDDIVISMKNT---RLKLPELTESLDWVEMPPRAKKSYQQLKKDQVLDLPGQEISAENA 457

Query: 279 ASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARL- 337
           A    +  QLA+GA+Y ++ +H++E+ DEKI+     +    A P +VAY+F SD +RL 
Sbjct: 458 AVLAGRLRQLASGAIYEEDGEHYQEIFDEKIECC-FYLTSNTATPSLVAYYFKSDASRLL 516

Query: 338 ---QKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDL 394
              +K   +    D  P  I+ WN+GKIP++   PAS G GLNLQ GG+ L++F+L W L
Sbjct: 517 AFYRKNGVKAELFDGSPGMIRRWNKGKIPVMLVQPASAGAGLNLQEGGHTLIWFTLPWSL 576

Query: 395 EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           E++QQM  R+   RQ   G K+ V +++L+ + TID  VL  L+ K   Q  LL A+++
Sbjct: 577 EQYQQMNGRL--YRQ---GQKKPVIIHHLLTKGTIDRHVLDSLKKKDLSQQALLAAVRR 630


>gi|268610658|ref|ZP_06144385.1| SNF2 domain-containing protein [Ruminococcus flavefaciens FD-1]
          Length = 417

 Score =  239 bits (610), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 145/429 (33%), Positives = 236/429 (55%), Gaps = 20/429 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHL--WGEKSVLVIAPLR 56
           M   PH  Q   +D+I  + + A+    G GKT   LTAL+ +    +  + VL+IAP+R
Sbjct: 1   MKYNPHDYQKYAIDFIEKNPQAAVLLECGLGKTSITLTALNDMMFDRFEVRKVLIIAPIR 60

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           V ++ W +E+ +W +   +  S++ G  +QR   L+  A LY+IN EN+ WL++E    +
Sbjct: 61  VCKNSWAAEIGKWDHLKGLTYSLVLGNREQRLAALRKKADLYIINRENVQWLIEETGMPF 120

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  +V+DE   L SF+  Q SK  +AL K     +R + LTGTP  NGL+DLW Q   L
Sbjct: 121 DFDMVVIDE---LSSFKNHQ-SKRFKALRKVRPFVKRIVGLTGTPCSNGLMDLWAQFRLL 176

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
           DKG+RLG+    +   +F     G       Y+ +  A+KEI  +++D  +S+   D+  
Sbjct: 177 DKGERLGKRIGQYRDAYFTPDWNG-----FTYSPRPGAEKEIYGKIADISISMKTTDHLK 231

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
           + + + ++  V + +  +K Y K ++E    L  +++ A N+A    K +QLA+G V YD
Sbjct: 232 MPELVSVSDPVIMSEAEIKAYRKLEKEYTLPLLHDDVSAANAAVLCGKLVQLASGCV-YD 290

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQE 356
           +      +H+ K+ ALE ++E  N  P++VAY +  +  R++  F   R +  D   I +
Sbjct: 291 DGGTPSIIHNRKLDALEDLLEAQNGKPVLVAYWYQHERERIKARF-DVREIKTDQ-DIAD 348

Query: 357 WNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
           WN+GKIP+    P+S GHGLNLQ GG+ +++F++ W LE +QQ   R+     RQ     
Sbjct: 349 WNDGKIPVALIQPSSAGHGLNLQDGGSTIIWFTMPWSLELYQQTNARL----WRQGQNAD 404

Query: 417 AVFVYYLIA 425
            V +++L A
Sbjct: 405 TVVIHHLTA 413


>gi|300812688|ref|ZP_07093097.1| SNF2 family N-terminal domain protein [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|300496315|gb|EFK31428.1| SNF2 family N-terminal domain protein [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
          Length = 636

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 162/479 (33%), Positives = 255/479 (53%), Gaps = 48/479 (10%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQ 59
           + L  +Q   +++I+DH  C I+  +G GKT++ L AL+ +   G K  +LVIAP  VA+
Sbjct: 177 LPLHDYQLYSMNFIMDHPYCGIFLDIGLGKTLTTLAALAKLREEGMKGHILVIAPKTVAK 236

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPA------------------VLYVIN 101
           S W  E+ +W N      S +T    ++ + L TPA                   LY  +
Sbjct: 237 STWQDEIDKW-NLPFKTQSFLT---DEKGRQL-TPAGRKELYEAAAAKAAKGDWQLYFAS 291

Query: 102 FENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTP 161
            + +  LV    G W F  +V+DES   KS      S+  +AL       +R IELTGTP
Sbjct: 292 RDLVSKLVD--LGPWLFKNVVIDESQSFKS----PASQRFKALKSVRGRIQRLIELTGTP 345

Query: 162 SPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQ-IGSHIGAVRYTAKETAQKEIEA 220
           +PN L DLW QI+ LD+G+RLGR   ++  ++F  T  + +H   V++     ++++I  
Sbjct: 346 APNSLQDLWSQIYLLDQGERLGRSITAYRQQYFEPTLLVNNH--PVKWRLLPGSEEKIYQ 403

Query: 221 QLSDCCLSLDIADYQNIDKPILITKK--VPLPQPVMKQYHKFQRELYCDLQGENIEAFNS 278
            + D  +S+       +  P L      V +P    K Y + +++   DL G+ I A N+
Sbjct: 404 AIDDIVISMKNT---RLKLPELTESLDWVEMPPRAKKSYQQLKKDQVLDLPGQEISADNA 460

Query: 279 ASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARL- 337
           A    +  QLA+GA+Y ++ +H++E+  EKI++    +    A P +VAY+F SD +RL 
Sbjct: 461 AVLAGRLRQLASGAIYEEDGEHYQEIFAEKIESC-FYLTSNTATPSLVAYYFKSDASRLL 519

Query: 338 ---QKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDL 394
              +K   +    D  P  I+ WN+GKIP++   PAS G GLNLQ GG+ L++F+L W L
Sbjct: 520 AFYRKNGVKAELFDGSPGMIRRWNKGKIPVMLVQPASAGAGLNLQEGGHTLIWFTLPWSL 579

Query: 395 EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           E++QQM  R+   RQ   G K+ V +++L+ + TID  VL  L+ K   Q  LL A+++
Sbjct: 580 EQYQQMNGRL--YRQ---GQKKPVIIHHLLTKGTIDRHVLDSLKKKDLSQQALLAAVRR 633


>gi|104773892|ref|YP_618872.1| hypothetical protein Ldb0824 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|103422973|emb|CAI97646.1| Hypothetical protein Ldb0824 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
          Length = 638

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 161/479 (33%), Positives = 254/479 (53%), Gaps = 48/479 (10%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQ 59
           + L  +Q   +++I+DH  C I+  +G GKT++ L AL+ +   G K  +LVIAP  VA+
Sbjct: 179 LPLHDYQLYSMNFIMDHPYCGIFLDIGLGKTLTTLAALAKLREEGMKGHILVIAPKTVAK 238

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPA------------------VLYVIN 101
           S W  E+ +W N      S +T    ++ + L TPA                   LY  +
Sbjct: 239 STWQDEIDKW-NLPFKTQSFLT---DEKGRQL-TPAGRQELYEAAAAKAAKGDWQLYFAS 293

Query: 102 FENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTP 161
            + +  LV    G W F  +V+DES   KS      S+  +AL       +R IELTGTP
Sbjct: 294 RDLVSKLVD--LGPWLFKNVVIDESQSFKS----PASQRFKALKSVRGRIQRLIELTGTP 347

Query: 162 SPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQ-IGSHIGAVRYTAKETAQKEIEA 220
           +PN   DLW QI+ LD+G+RLGR   ++  ++F  T  + +H   V++     ++++I  
Sbjct: 348 APNSFQDLWSQIYLLDQGERLGRSITAYRQQYFEPTLLVNNH--PVKWRLLPGSEEKIYQ 405

Query: 221 QLSDCCLSLDIADYQNIDKPILITKK--VPLPQPVMKQYHKFQRELYCDLQGENIEAFNS 278
            + D  +S+       +  P L      V +P    K Y + +++   DL G+ I A N+
Sbjct: 406 AIDDIVISMKNT---RLKLPELTESLDWVEMPPRAKKSYQQLKKDQVLDLPGQEISAENA 462

Query: 279 ASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARL- 337
           A    +  QLA+GA+Y ++ +H++E+  EKI++    +    A P +VAY+F SD +RL 
Sbjct: 463 AVLAGRLRQLASGAIYEEDGEHYQEIFAEKIESC-FYLTSNTATPSLVAYYFKSDASRLL 521

Query: 338 ---QKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDL 394
              +K   +    D  P  I+ WN+GKIP++   PAS G GLNLQ GG+ L++F+L W L
Sbjct: 522 AFYRKNGVKAELFDSSPGMIRRWNKGKIPVMLVQPASAGAGLNLQEGGHTLIWFTLPWSL 581

Query: 395 EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           E++QQM  R+   RQ   G K+ V +++L+ + TID  VL  L+ K   Q  LL A+++
Sbjct: 582 EQYQQMNGRL--YRQ---GQKKPVIIHHLLTKGTIDRHVLDSLKKKDLSQQALLAAVRR 635


>gi|313123514|ref|YP_004033773.1| superfamily ii DNA/RNA helicase, snf2 family [Lactobacillus
           delbrueckii subsp. bulgaricus ND02]
 gi|312280077|gb|ADQ60796.1| Superfamily II DNA/RNA helicase, SNF2 family [Lactobacillus
           delbrueckii subsp. bulgaricus ND02]
          Length = 626

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 161/479 (33%), Positives = 255/479 (53%), Gaps = 48/479 (10%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQ 59
           + L  +Q   +++I+DH  C I+  +G GKT++ L AL+ +   G K  +LVIAP  VA+
Sbjct: 167 LPLHDYQLYSMNFIMDHPYCGIFLDIGLGKTLTTLAALAKLREEGMKGHILVIAPKTVAK 226

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPA------------------VLYVIN 101
           S W  E+ +W N      S +T    ++ + L TPA                   LY  +
Sbjct: 227 STWQDEIDKW-NLPFKTQSFLT---DEKGRQL-TPAGRQELYEAAAAKAAKGDWQLYFAS 281

Query: 102 FENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTP 161
            + +  LV    G W F  +V+DES   KS      S+  +AL       +R IELTGTP
Sbjct: 282 RDLVSKLVD--LGPWLFKNVVIDESQSFKS----PASQRFKALKSVRGRIQRLIELTGTP 335

Query: 162 SPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQ-IGSHIGAVRYTAKETAQKEIEA 220
           +PN L DLW QI+ LD+G+RLGR   ++  ++F  T  + +H   V++     ++++I  
Sbjct: 336 APNSLQDLWSQIYLLDQGERLGRSITAYRQQYFEPTLLVNNH--PVKWRLLPGSEEKIYQ 393

Query: 221 QLSDCCLSLDIADYQNIDKPILITKK--VPLPQPVMKQYHKFQRELYCDLQGENIEAFNS 278
            + D  +S+       +  P L      V +P    K Y + +++   DL G+ + A N+
Sbjct: 394 AIDDIVISMKNT---RLKLPELTESLDWVEMPPRAKKSYQQLKKDQVLDLPGQELSADNA 450

Query: 279 ASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARL- 337
           A    +  QLA+GA+Y ++ +H++E+  EKI++    +    A P +VAY+F SD +RL 
Sbjct: 451 AVLAGRLRQLASGAIYEEDGEHYQEIFAEKIESC-FYLTSNTATPSLVAYYFKSDASRLL 509

Query: 338 ---QKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDL 394
              +K   +    D  P  I+ WN+GKIP++   PAS G GLNLQ GG+ L++F+L W L
Sbjct: 510 AFYRKNGVKAELFDGSPGMIRRWNKGKIPVMLVQPASAGAGLNLQEGGHTLIWFTLPWSL 569

Query: 395 EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           E++QQM  R+   RQ   G K+ V +++L+ + TID  VL  L+ K   Q  LL A+++
Sbjct: 570 EQYQQMNGRL--YRQ---GQKKPVIIHHLLTKGTIDRHVLDSLKKKDLSQQALLAAVRR 623


>gi|116513899|ref|YP_812805.1| SNF2 family DNA/RNA helicase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|116093214|gb|ABJ58367.1| Superfamily II DNA/RNA helicase, SNF2 family [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC BAA-365]
 gi|325125562|gb|ADY84892.1| SNF2 domain protein [Lactobacillus delbrueckii subsp. bulgaricus
           2038]
          Length = 638

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 161/479 (33%), Positives = 254/479 (53%), Gaps = 48/479 (10%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQ 59
           + L  +Q   +++I+DH  C I+  +G GKT++ L AL+ +   G K  +LVIAP  VA+
Sbjct: 179 LPLHDYQLYSMNFIMDHPYCGIFLDIGLGKTLTTLAALAKLREEGMKGHILVIAPKTVAK 238

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPA------------------VLYVIN 101
           S W  E+ +W N      S +T    ++ + L TPA                   LY  +
Sbjct: 239 STWQDEIDKW-NLPFKTQSFLT---DEKGRQL-TPAGRQELYEAAAAKAAKGDWQLYFAS 293

Query: 102 FENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTP 161
            + +  LV    G W F  +V+DES   KS      S+  +AL       +R IELTGTP
Sbjct: 294 RDLVSKLVD--LGPWLFKNVVIDESQSFKS----PASQRFKALKSVRGRIQRLIELTGTP 347

Query: 162 SPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQ-IGSHIGAVRYTAKETAQKEIEA 220
           +PN   DLW QI+ LD+G+RLGR   ++  ++F  T  + +H   V++     ++++I  
Sbjct: 348 APNSFQDLWSQIYLLDQGERLGRSITAYRQQYFEPTLLVNNH--PVKWRLLPGSEEKIYQ 405

Query: 221 QLSDCCLSLDIADYQNIDKPILITKK--VPLPQPVMKQYHKFQRELYCDLQGENIEAFNS 278
            + D  +S+       +  P L      V +P    K Y + +++   DL G+ I A N+
Sbjct: 406 AIDDIVISMKNT---RLKLPELTESLDWVEMPPRAKKSYQQLKKDQVLDLPGQEISAENA 462

Query: 279 ASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARL- 337
           A    +  QLA+GA+Y ++ +H++E+  EKI++    +    A P +VAY+F SD +RL 
Sbjct: 463 AVLAGRLRQLASGAIYEEDGEHYQEIFAEKIESC-FYLTSNTATPSLVAYYFKSDASRLL 521

Query: 338 ---QKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDL 394
              +K   +    D  P  I+ WN+GKIP++   PAS G GLNLQ GG+ L++F+L W L
Sbjct: 522 AFYRKNGVKAELFDGSPGMIRRWNKGKIPVMLVQPASAGAGLNLQEGGHTLIWFTLPWSL 581

Query: 395 EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           E++QQM  R+   RQ   G K+ V +++L+ + TID  VL  L+ K   Q  LL A+++
Sbjct: 582 EQYQQMNGRL--YRQ---GQKKPVIIHHLLTKGTIDRHVLDSLKKKDLSQQALLAAVRR 635


>gi|322691254|ref|YP_004220824.1| phage protein [Bifidobacterium longum subsp. longum JCM 1217]
 gi|320456110|dbj|BAJ66732.1| hypothetical phage protein [Bifidobacterium longum subsp. longum
           JCM 1217]
          Length = 460

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 147/449 (32%), Positives = 237/449 (52%), Gaps = 23/449 (5%)

Query: 20  CAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
           C ++   G GKT++ +  +  +H     +  LVIAP  VA++ W  E++RW     +  +
Sbjct: 23  CGLFLEPGLGKTLTSIAVMDIMHAADPHARFLVIAPALVARNSWPDELERWKGMHSLTWA 82

Query: 79  VITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGS 138
           V  GT +QR++ L   A + VI  +NL WL  ++ G WP+  +VVDE +  K+ R  +G 
Sbjct: 83  VAVGTPRQRSQALDAGADVTVIGQDNLKWLDGKV-GDWPWTGLVVDELSGYKTPRSNRGL 141

Query: 139 KTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQ 198
              R   K  W     + LTGTP+   L+DLWG+I  +D+ + L R    +  RWF  T+
Sbjct: 142 VLRRHARKARWA----LGLTGTPATKNLLDLWGEIAVIDRSETLERSMTRYRERWFTPTR 197

Query: 199 ---IGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKK--VPLPQPV 253
              +G     + YT ++ AQ+EI   +   CLS+  +D +    P LI     + +P+P 
Sbjct: 198 YIDMGGRRQPIDYTPRDGAQQEILDLIEPFCLSMKASD-KLPGLPSLIETDHWLDMPKPT 256

Query: 254 MKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYD---EEKHWKEVHDEKI 309
              Y + +R++  DL  G  +   N+   T K  QL  G +Y D    E   + V D K+
Sbjct: 257 RDTYDRLRRQMVADLDDGTTVTVANAGVLTAKLAQLTCGCLYPDADDPEGTIRHVDDVKL 316

Query: 310 KALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHP 369
            AL  II  A+  P++V Y F  +L R++  FP  R +  +   ++EW  G++PLL AHP
Sbjct: 317 DALADIISAADG-PVLVFYQFTDELERMRARFPGMREV-HEQGVLEEWRNGRVPLLAAHP 374

Query: 370 ASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTI 429
            +  +GLN+Q GG+ +V+ SL W  ++++Q  +R+     RQ G KR V V+ L+  NT+
Sbjct: 375 QAAKYGLNIQDGGHEIVWTSLPWSFDDYRQACDRL----HRQ-GQKRTVRVHRLLESNTV 429

Query: 430 DELVLQRLRTKSTIQDLLLNALKKETIHV 458
           D   L  L  +  + + +++AL+ ET  V
Sbjct: 430 DRRKLDVLTGRMMLHEAVMDALEGETAGV 458


>gi|269975285|gb|ACZ55509.1| helicase [Staphylococcus phage SA1]
          Length = 491

 Score =  232 bits (592), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 149/484 (30%), Positives = 236/484 (48%), Gaps = 47/484 (9%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSV 61
           +  +Q + V +I DH  C ++  +G GKTV   TA+  +   GE   VLV+AP RVA++ 
Sbjct: 1   MHDYQDEGVQFIKDHPYCGMFVDLGLGKTVMTGTAMLDLIADGEINKVLVVAPKRVARTG 60

Query: 62  WTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATI 121
           W +E   W +     +S+I G  K+R          Y ++ +N+ WL +  K  WPF  +
Sbjct: 61  WPTEFDEWGHLCFYKMSIIAGNAKERAAAANKDCHFYTVSVDNIAWLCEHFKTKWPFDAV 120

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
           V+DES+  KS      S+  + L +     +R +ELT TP+  G + ++ QI+ LD+G+R
Sbjct: 121 VLDESSMFKS----HTSQRFKMLRRVRKYIKRIVELTATPAAEGYMGIFAQIYLLDEGER 176

Query: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            G     +   +F   +        ++  +  A+ EI  ++SD CL +   DY ++ +P 
Sbjct: 177 FGSTIGGYQENYFTQNKWN-----FKWKLRPGAEDEIIRKISDICLVMKAEDYLDMHEPN 231

Query: 242 LITKKVPLPQPVMKQYHKFQRELYCDLQGEN----------IEAFNSASKTVKCLQLANG 291
            +   V L     ++Y   + E   ++  E+          IEA  +AS   K LQ+ +G
Sbjct: 232 FVPVPVELDGETAERYRMMEEESLVEIMPEDFDEHLDDPIVIEAEQAASLQSKLLQMCSG 291

Query: 292 AVYYDE------------EKHWKEVHDEKIKALEVIIEKANAAP-IIVAYHFNSDLARLQ 338
            +Y  +            +K    +HD K  ALE ++E   A   +++AYHF   L RL+
Sbjct: 292 FIYDTKIVGITEDDKVIKQKDTYRLHDLKFDALEELLETTLADKNVLIAYHFKPTLERLK 351

Query: 339 KAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQ 398
           + F     +D D   I++WN GKI LL AHP S GHGLNLQ+GG+++V+    W LE   
Sbjct: 352 ERFKDLVVMDDDGKCIKKWNAGKIRLLAAHPQSAGHGLNLQHGGHVIVYIDNPWSLERFL 411

Query: 399 QMIERIGVTRQRQAGFKRAVFVYYLIAQ---------NTIDELVLQRLRTKSTIQDLLLN 449
           Q   R+     RQ G K  V +Y   A           T D++V+Q L  K  +QD    
Sbjct: 412 QFNGRL----HRQ-GQKFPVTIYQFKAMLRTPNGLLAETADDVVIQALVEKEDVQDAFFA 466

Query: 450 ALKK 453
            L++
Sbjct: 467 LLER 470


>gi|320458171|dbj|BAJ68792.1| hypothetical phage protein [Bifidobacterium longum subsp. infantis
           ATCC 15697]
          Length = 460

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 143/448 (31%), Positives = 234/448 (52%), Gaps = 21/448 (4%)

Query: 20  CAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
           C ++   G GKT++ +  +  +H     +  LVIAP  VA++ W  E++RW     +  +
Sbjct: 23  CGLFLEPGLGKTLTSIAVMDIMHAADPHARFLVIAPALVARNSWPDELERWKGMHSLTWA 82

Query: 79  VITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGS 138
              GT +QR+K L   A + VI  +NL WL  ++ G WP+  IVVDE +  K+ R  +G 
Sbjct: 83  AAVGTPRQRSKALDADADVTVIGQDNLKWLDGKV-GDWPWKGIVVDELSGYKTPRSNRGL 141

Query: 139 KTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQ 198
              R   +  W     + LTGTP+   L+DLWG+I  +D+ + L R    +  RWF   +
Sbjct: 142 ILRRHARQAKWT----LGLTGTPATKNLLDLWGEIAVIDRSETLERSMTRYRDRWFTPGR 197

Query: 199 ---IGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD-YQNIDKPILITKKVPLPQPVM 254
              +G     + YT ++ AQ+EI   +   CLS+  +D    +   I     + +P+P  
Sbjct: 198 YIDMGGRRQPIDYTPRDGAQQEILDLIEPFCLSMKASDRLPGLPSMIETDHWLDMPKPTR 257

Query: 255 KQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYD---EEKHWKEVHDEKIK 310
             Y + +R++  DL  G  + A N+   T K  QL  G +Y D    E   + V D K+ 
Sbjct: 258 DTYDRLRRQMVADLDDGTTVTAANAGVLTAKLAQLTCGCLYPDADDPEGTIRHVDDVKLD 317

Query: 311 ALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPA 370
           AL  II  A+  P++V Y F  +L R++  FP  R +  +   ++EW  G++PLL AHP 
Sbjct: 318 ALADIIGAADG-PVLVFYQFTDELERMRARFPGMREV-HEQGVLEEWRNGRVPLLAAHPQ 375

Query: 371 SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTID 430
           +  +GLN+Q GG+ +V+ SL W  ++++Q  +R+     RQ G KR V V+ L+  NT+D
Sbjct: 376 AAKYGLNIQDGGHEIVWTSLPWSFDDYRQACDRL----HRQ-GQKRTVRVHRLLESNTVD 430

Query: 431 ELVLQRLRTKSTIQDLLLNALKKETIHV 458
              L  L  +  + + +++A++ ET  +
Sbjct: 431 RRKLDVLTGRMMLHEAVMDAVEGETTGI 458


>gi|213692059|ref|YP_002322645.1| SNF2-related protein [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|213523520|gb|ACJ52267.1| SNF2-related protein [Bifidobacterium longum subsp. infantis ATCC
           15697]
          Length = 464

 Score =  229 bits (585), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 143/448 (31%), Positives = 234/448 (52%), Gaps = 21/448 (4%)

Query: 20  CAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
           C ++   G GKT++ +  +  +H     +  LVIAP  VA++ W  E++RW     +  +
Sbjct: 27  CGLFLEPGLGKTLTSIAVMDIMHAADPHARFLVIAPALVARNSWPDELERWKGMHSLTWA 86

Query: 79  VITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGS 138
              GT +QR+K L   A + VI  +NL WL  ++ G WP+  IVVDE +  K+ R  +G 
Sbjct: 87  AAVGTPRQRSKALDADADVTVIGQDNLKWLDGKV-GDWPWKGIVVDELSGYKTPRSNRGL 145

Query: 139 KTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQ 198
              R   +  W     + LTGTP+   L+DLWG+I  +D+ + L R    +  RWF   +
Sbjct: 146 ILRRHARQAKWT----LGLTGTPATKNLLDLWGEIAVIDRSETLERSMTRYRDRWFTPGR 201

Query: 199 ---IGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD-YQNIDKPILITKKVPLPQPVM 254
              +G     + YT ++ AQ+EI   +   CLS+  +D    +   I     + +P+P  
Sbjct: 202 YIDMGGRRQPIDYTPRDGAQQEILDLIEPFCLSMKASDRLPGLPSMIETDHWLDMPKPTR 261

Query: 255 KQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYD---EEKHWKEVHDEKIK 310
             Y + +R++  DL  G  + A N+   T K  QL  G +Y D    E   + V D K+ 
Sbjct: 262 DTYDRLRRQMVADLDDGTTVTAANAGVLTAKLAQLTCGCLYPDADDPEGTIRHVDDVKLD 321

Query: 311 ALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPA 370
           AL  II  A+  P++V Y F  +L R++  FP  R +  +   ++EW  G++PLL AHP 
Sbjct: 322 ALADIIGAADG-PVLVFYQFTDELERMRARFPGMREV-HEQGVLEEWRNGRVPLLAAHPQ 379

Query: 371 SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTID 430
           +  +GLN+Q GG+ +V+ SL W  ++++Q  +R+     RQ G KR V V+ L+  NT+D
Sbjct: 380 AAKYGLNIQDGGHEIVWTSLPWSFDDYRQACDRL----HRQ-GQKRTVRVHRLLESNTVD 434

Query: 431 ELVLQRLRTKSTIQDLLLNALKKETIHV 458
              L  L  +  + + +++A++ ET  +
Sbjct: 435 RRKLDVLTGRMMLHEAVMDAVEGETTGI 462


>gi|197303505|ref|ZP_03168544.1| hypothetical protein RUMLAC_02227 [Ruminococcus lactaris ATCC
           29176]
 gi|197297503|gb|EDY32064.1| hypothetical protein RUMLAC_02227 [Ruminococcus lactaris ATCC
           29176]
          Length = 333

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 194/343 (56%), Gaps = 19/343 (5%)

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           +V+DE +  K++     SK  +A  K   + +R I LTGTPS NGL+DL+ +   LD G+
Sbjct: 2   VVLDELSSFKNW----NSKRFKAFMKVRPKVKRVIGLTGTPSSNGLMDLFAEFKCLDMGE 57

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           RLGR    +   +F   Q    I    Y  ++ A+++I  ++SD  +S+   D+  +  P
Sbjct: 58  RLGRFISQYRVNYFVPDQTNGQI-VYSYRLRKGAEEQIYNKISDITISMKALDH--LKMP 114

Query: 241 ILITKKVP--LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEE 298
            LI+ + P  + +     Y   + E++  L+   I A N+A+ + K LQ+ANGAVY D+ 
Sbjct: 115 ELISNEYPVYMSEHEASLYDDMEAEMFLPLRTGEITAANAAALSGKLLQMANGAVYSDDG 174

Query: 299 KHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRT----LDKDPCTI 354
               ++HD+K+ ALE +IE AN  P++VAY F  DL R+++   + +     LD +  +I
Sbjct: 175 DEI-QIHDQKLDALEDLIEAANGKPVMVAYWFKHDLTRIRRRLSERKISFEKLDSEE-SI 232

Query: 355 QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
           ++WN G++P+   HPAS GHGLNLQ GGNIL++F L W LE +QQ + R+     RQ   
Sbjct: 233 RKWNRGELPVALIHPASAGHGLNLQSGGNILIWFGLTWSLELYQQTVARL----WRQGQS 288

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIH 457
              V V ++I   TIDE V++ L  K   Q+ L+ A+K    H
Sbjct: 289 AETVVVQHIITAGTIDEDVMKALANKDMTQNRLIAAVKARVTH 331


>gi|323441317|gb|EGA98982.1| phage helicase [Staphylococcus aureus O46]
          Length = 301

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 108/301 (35%), Positives = 174/301 (57%), Gaps = 10/301 (3%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           ++  PH  Q   +D ++D+++  ++  MG GKTVS LTA S + L   K +LVIAP +VA
Sbjct: 3   IDFKPHNYQKYAIDKVIDNEKYGLFLDMGLGKTVSTLTAFSELQLLDTKKMLVIAPKQVA 62

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +  W  EV +W++ +H+ +S++ GT K+R   L T A +YV N EN  WL  + K  WPF
Sbjct: 63  KDTWVDEVDKWNHLNHLKVSLVLGTPKERNAALNTEADIYVTNKENTKWLCDQYKKEWPF 122

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE +  KS +    S+  +++ K      RFI LTGTPSPN L DLW Q++ +D+
Sbjct: 123 DMVVIDELSTFKSPK----SQRFKSIKKKLPLINRFIGLTGTPSPNSLQDLWAQVYLIDR 178

Query: 179 GKRLGRVFQSFVARWFNTT-QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
           G+RL   F  +  R+F  T Q+  H+    +  ++ ++++I  Q+ D CLS+   DY ++
Sbjct: 179 GERLESSFSRYRERYFKPTHQVSEHV--FNWELRDGSEEKIYKQIEDICLSMKAKDYLDM 236

Query: 238 DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-NIEAFNSASKTVKCLQLANGAVYYD 296
              +   + V L +   K Y + ++    + + +  + A N AS + K LQL+NGAVY D
Sbjct: 237 PDRVDTKQTVVLSEKERKLYDELEKHYILESEEDGTVVAQNGASLSQKLLQLSNGAVYTD 296

Query: 297 E 297
           +
Sbjct: 297 D 297


>gi|309702946|emb|CBJ02277.1| putative phage protein [Escherichia coli ETEC H10407]
          Length = 134

 Score =  189 bits (481), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 85/133 (63%), Positives = 112/133 (84%)

Query: 324 IIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGN 383
           ++VAYH+  DL RL KAFP+GR LD+DP T+++WN GKIP+LFAHPAS GHGLN+Q GGN
Sbjct: 1   MLVAYHWKHDLERLLKAFPRGRHLDQDPQTLRDWNSGKIPVLFAHPASAGHGLNMQDGGN 60

Query: 384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
           ILVFFS WWDLE++QQ+IERIG TRQ QAG  R VF++++IA +T+DE+V++R  +K T+
Sbjct: 61  ILVFFSHWWDLEQYQQIIERIGPTRQIQAGHNRPVFIHHIIAADTMDEMVMERRNSKRTV 120

Query: 444 QDLLLNALKKETI 456
           QD+LL+A+KK  I
Sbjct: 121 QDILLDAMKKRGI 133


>gi|170730321|ref|YP_001775754.1| hypothetical protein Xfasm12_1173 [Xylella fastidiosa M12]
 gi|167965114|gb|ACA12124.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 189

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 121/181 (66%), Gaps = 2/181 (1%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++NL WLV+  +  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQDADIYCINYDNLKWLVEFYQDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAW-ESERFIELTGTPSPNGLIDLWGQIWFLDK 178
            +V DE +KLK FRLRQG++ ARALAK    + ER+I LTGTP+PNGL DLW  +W +D+
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALAKHVHTKVERYIGLTGTPAPNGLQDLWALMWMVDR 180

Query: 179 G 179
            
Sbjct: 181 A 181


>gi|317055081|ref|YP_004103548.1| SNF2-like protein [Ruminococcus albus 7]
 gi|315447350|gb|ADU20914.1| SNF2-related protein [Ruminococcus albus 7]
          Length = 305

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 167/302 (55%), Gaps = 14/302 (4%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALS---YIHLWGEKSVLVIAPL 55
           M   PH  Q+  +++I  H   A+   MG GKTV  LTAL+   +  L   K VLVIAPL
Sbjct: 1   MRFNPHDYQSFCIEYIKTHPVAALLLDMGLGKTVITLTALNDLIFDDLLVSK-VLVIAPL 59

Query: 56  RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQ--ELK 113
           RV++  W +EV++W +   ++ISVI G ++ R   +   A +YVIN EN+ WLV+  E  
Sbjct: 60  RVSRDTWPAEVKKWDHLKDLDISVIVGDLRTRKAAVSASAQVYVINRENIKWLVEYYEKN 119

Query: 114 G-TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQ 172
           G  W F  +V+DE +  K+++    S+  + L K      R+I LTGTP+ NGL+DLW +
Sbjct: 120 GLRWDFDCVVIDELSSFKNYQ----SQRFKWLRKVRPFVHRWIGLTGTPTSNGLMDLWAE 175

Query: 173 IWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAV-RYTAKETAQKEIEAQLSDCCLSLDI 231
           I  LD G+RLGR    F   +F    +    G +  Y  +  A+++I  ++SD  +S+  
Sbjct: 176 IGILDGGERLGRFIGRFRESYFKPGSMNPSTGVLFSYIPRPGAEEQIYDRISDITISMKA 235

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG 291
            DY  +   I +  +V +     + Y + +R+L       +I+A N+AS + K LQ+ANG
Sbjct: 236 LDYLQLPDCIYVNHEVEMNDQERRLYDQMKRDLIIPTDDGDIDAANAASLSNKLLQMANG 295

Query: 292 AV 293
           AV
Sbjct: 296 AV 297


>gi|227544270|ref|ZP_03974319.1| possible helicase [Lactobacillus reuteri CF48-3A]
 gi|227185750|gb|EEI65821.1| possible helicase [Lactobacillus reuteri CF48-3A]
          Length = 224

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 133/230 (57%), Gaps = 8/230 (3%)

Query: 155 IELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETA 214
           + LTGTPS NGL+DLW +   LD G+RLGR   S+   +F+  +   +     Y  K  A
Sbjct: 1   VGLTGTPSSNGLMDLWAEFRVLDMGQRLGRFISSYRMNYFDPDKRNMY-QVFTYKPKPGA 59

Query: 215 QKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ--YHKFQRELYCDLQGEN 272
           ++ I   + D  +S+   DY N+  P L    VP+     +Q  Y +   +L    QG+ 
Sbjct: 60  EQSIYRAIDDITISMKSKDYLNL--PPLTMNTVPVKMSNSEQAIYDELNAQLVVSTQGKQ 117

Query: 273 IEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNS 332
           I+A N+AS + K  Q+ANG VY D+++   ++H  K+ ALE ++E AN  P++VAY F  
Sbjct: 118 IDALNAASLSNKLCQMANGCVY-DDQQQIVQIHQRKLDALEDLVEAANGKPVLVAYWFKH 176

Query: 333 DLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGG 382
           DL +++  F + R + K P  IQ+WN GKIPL   HPAS GHGLNLQ GG
Sbjct: 177 DLIQIKSRF-KVREI-KTPRDIQDWNAGKIPLALIHPASAGHGLNLQAGG 224


>gi|290466810|gb|ADD25740.1| putative helicase [Lactococcus phage 1358]
          Length = 577

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 143/533 (26%), Positives = 239/533 (44%), Gaps = 91/533 (17%)

Query: 1   MNLAPH--QTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRV 57
           +   PH  Q   +D++ +H +  +   MG GKTV+ LT L  +   G  K  L+IAP  V
Sbjct: 4   IKFKPHDYQQIALDFMAEHNKALLILDMGLGKTVTTLTHLRKMMKKGRIKRPLIIAPKIV 63

Query: 58  AQSVWTSEVQRWSNFSHMN-ISVITGTVKQRTKVLK--TPAVLYVINFENLGWLVQEL-- 112
           +++ W +E+ +W +   +  I + +   K+R +        V+ +++   + WLV  L  
Sbjct: 64  SENTWATELAKWQHLRRVRYIEIDSKDTKKRLEQFDRIQDGVITILSESKVQWLVDMLDE 123

Query: 113 ---KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDL 169
              +  W F  IV+DE   +  F+  Q ++      K     +  I LTGTP+PN L DL
Sbjct: 124 IGSEREWTFDAIVIDE---ISMFKNPQSNRFKNLEKKVQKRCKYVIGLTGTPAPNDLGDL 180

Query: 170 WGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVR-----YTAKETAQKEIEAQLSD 224
           W  ++ LD+G RLGR  + F   + +  +I  + G  +     Y  +E    EI   +SD
Sbjct: 181 WAIMFLLDRGARLGRTKRIFNKLYCDEKKIKINSGGNQQYIKAYDIQEAMYNEILDAISD 240

Query: 225 CCLSLDIADY-QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQ--GEN--------- 272
             L++   D+ +N  KP    + V L +    +Y++ +++   ++   G++         
Sbjct: 241 IALAMKAEDWLENYQKPTYHVEPVVLSESGADEYNRMKKDKILEINRLGQDSKDERLRRR 300

Query: 273 ---------IEAFNSASKTVKCL----------------------QLANGAVY------- 294
                    I+A + A+     L                      QLA+GA+Y       
Sbjct: 301 IDRLWARGTIKAQDKANALEARLKPQDGVVKITTEHIFSVINALRQLASGAIYEQLDTTG 360

Query: 295 YDEE-------KHWK-----EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFP 342
            DEE       +H K     EVHD K+ AL  IIE+     + V   +  +  R+++ F 
Sbjct: 361 LDEEEIAERYNEHMKNRKHIEVHDAKLDALADIIEREQ-DNVFVFVSYKHEAERIRQRFE 419

Query: 343 QGRTLDKDPCT--IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM 400
             R L+       +  WN GKIP+L A+PAS   GLN+Q GG+ +V++S+ +  E   Q 
Sbjct: 420 GVRFLNTANAAEVLPLWNAGKIPVLVANPASTKFGLNMQDGGHTIVWYSMGYSFEAFTQS 479

Query: 401 IERIGVTRQRQAGFKRAVFVYYLIA--QNTIDELVLQRLRTKSTIQDLLLNAL 451
             R+   RQ   G K  V VY L +      D+  L+ +    TI   +++A+
Sbjct: 480 NARLA--RQ---GQKHEVKVYMLQSWLAPIQDDTQLEDIMRAQTIDSAIMDAI 527


>gi|71897670|ref|ZP_00679915.1| DEAD/DEAH box helicase [Xylella fastidiosa Ann-1]
 gi|71732573|gb|EAO34626.1| DEAD/DEAH box helicase [Xylella fastidiosa Ann-1]
          Length = 188

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/146 (47%), Positives = 96/146 (65%), Gaps = 1/146 (0%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQ 59
           MNL P+Q  IVD+IL H RC ++  MG GKTV+ LTAL  + +  +   +LVIAPLRVA 
Sbjct: 1   MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVEDIAPILVIAPLRVAA 60

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFA 119
           + W  EV ++ +  H+ +SV+ G+   R   L+  A +Y IN++ L WLV+  K  WPF 
Sbjct: 61  TTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYDTLKWLVEFYKDRWPFR 120

Query: 120 TIVVDESTKLKSFRLRQGSKTARALA 145
            +V DE +KLK FRLRQG++ ARALA
Sbjct: 121 MVVADECSKLKGFRLRQGTRRARALA 146


>gi|223986447|ref|ZP_03636451.1| hypothetical protein HOLDEFILI_03763 [Holdemania filiformis DSM
           12042]
 gi|223961599|gb|EEF66107.1| hypothetical protein HOLDEFILI_03763 [Holdemania filiformis DSM
           12042]
          Length = 471

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 107/445 (24%), Positives = 214/445 (48%), Gaps = 34/445 (7%)

Query: 21  AIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV 79
           A+   MG+GKT++ +     +   G  + VLV++PL +  +VW  E  +++++ +  ++V
Sbjct: 35  ALLMEMGTGKTLTAIGITGALLRSGRIRRVLVVSPLSIT-TVWREEFAKFADYPY-ELAV 92

Query: 80  ITGTVKQRTKVLK----TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLR 135
           ++G+ +++ + L+    T   + V+N+E++ W +++   TW    I+ DE  KLKS    
Sbjct: 93  LSGSTEKKKQTLQELSSTDLSIAVVNYESV-WRMEDAVATWKPDLIICDEGHKLKS---- 147

Query: 136 QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFN 195
             +  ++A+ +    ++  + LTGTP  N  ID++ Q  FL+     G+ F  F  R+F 
Sbjct: 148 HSTSASKAMHRLGVRAKYRLLLTGTPITNKAIDIFSQYKFLNPSI-YGQNFYPFRNRYFF 206

Query: 196 TTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMK 255
            T  G+H        K++ + E  A++      +  A+  ++ +   I + V L    MK
Sbjct: 207 MTGYGNHTP----ITKKSMEAEFTAKMHSVAYRVTKAECLDLPETTDIIRPVQLEPAAMK 262

Query: 256 QYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI 315
            Y     E + +L    + A N  ++ ++  QL  G +  D+    ++V + K+  LE I
Sbjct: 263 LYKNLVDESFAELSDGEVTATNVLTRLLRLNQLTGGFICSDDSSKAEQVSNAKMSVLEDI 322

Query: 316 IEKA--NAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCTIQEWNEGKIPL 364
           ++ +      +++   F  +L  + K   +         G   ++D    Q  N+ ++ +
Sbjct: 323 VDASLQEGKKLVIIARFIPELHAICKMLGKKGIRHSLIMGGVNNRDEQVAQFQNDPEVSV 382

Query: 365 LFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLI 424
                A+ G G+ L    + +VF+SL + +   +Q   RI      +AG K      YL 
Sbjct: 383 FVGQIATAGMGITLT-AASTMVFYSLDYSMSNFEQTKARI-----HRAGQKFPCTYLYLT 436

Query: 425 AQNTIDELVLQRLRTKSTIQDLLLN 449
           A+ TID  VL+ L++K+++   L++
Sbjct: 437 AEGTIDTKVLKALKSKASLAKTLVD 461


>gi|238898768|ref|YP_002924450.1| phage DNA helicase, partial [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466528|gb|ACQ68302.1| phage DNA helicase, partial [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 157

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 93/143 (65%), Gaps = 5/143 (3%)

Query: 312 LEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPAS 371
           +E +I++A   P++VAY++ SDLA ++  FP+   +     TI  WN GKIPLL AHPAS
Sbjct: 1   MEEMIQEAAGQPVLVAYNYQSDLALIKVRFPKAELIGHAADTIDRWNTGKIPLLLAHPAS 60

Query: 372 CGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDE 431
            GHGLNLQ GGNI+V+F L W LE +QQ   R+     RQ G  R VF+++L+  ++ID 
Sbjct: 61  AGHGLNLQSGGNIIVWFGLNWSLELYQQFNARL----HRQ-GQTRPVFIHHLVMNDSIDL 115

Query: 432 LVLQRLRTKSTIQDLLLNALKKE 454
            VL+ L  K   Q  LL+ALKK+
Sbjct: 116 TVLEALENKHITQKALLDALKKD 138


>gi|315926199|ref|ZP_07922399.1| snf2 family helicase [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315620643|gb|EFV00624.1| snf2 family helicase [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 478

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 105/450 (23%), Positives = 216/450 (48%), Gaps = 34/450 (7%)

Query: 20  CAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
           CA    MG+GK+++ +     ++L G  + VL++APL +  SVW  E ++++ F +  ++
Sbjct: 41  CAFLMEMGTGKSLTAIAVTGTLYLSGNIRRVLIVAPLSIL-SVWQEEFEKFAVFPY-TLT 98

Query: 79  VITGTVKQRTKVLKTPAV----LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRL 134
           V+TGT  ++ + L +       + V+N+E+  W +++    W    I+ DE  KLKS + 
Sbjct: 99  VLTGTGAKKKQQLASVGSDGLQIIVVNYES-AWRMEQEICRWRPDLIIADEGHKLKSHK- 156

Query: 135 RQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWF 194
              +  ++++ +    ++  + LTGTP  N  ID++ Q  FL+     G+ F +F  R+F
Sbjct: 157 ---TAASKSMHRMGTLAKYRLLLTGTPVTNKAIDIFSQYKFLNPNI-YGQSFYAFRNRYF 212

Query: 195 NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVM 254
             T  G++   +    K++ + E   ++         A+  ++ +   + +K+ L    +
Sbjct: 213 FMTGYGNYTPVM----KKSMEDEFTRRMHSIAYRATKAECLDLPETTDVIRKIQLEPAAL 268

Query: 255 KQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEV 314
           K Y+    + + +L+ + +   N  +K ++  QL  G +  DE    ++V   K+  LE 
Sbjct: 269 KLYYSLVEDSFAELEEDEVTTTNILTKLLRLSQLTGGFISGDESDVPEQVSTAKLSVLED 328

Query: 315 IIEKA--NAAPIIVAYHFNSDL---------ARLQKAFPQGRTLDKDPCTIQEWNEGKIP 363
           II+ A      +++   F  +L           +  +   G   +++    Q  N+  + 
Sbjct: 329 IIDSAADEGRKLVIIARFVPELHAICSLLDKKGINHSLIMGGVKNREEQISQFQNDPDVT 388

Query: 364 LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
           +     A+ G G+ L    + +VF+SL + +  ++Q   RI      +AG K      +L
Sbjct: 389 VFVGQIATAGLGITLT-ASSTMVFYSLDYSMSTYEQTKARI-----HRAGQKYPCTYIHL 442

Query: 424 IAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
           IA  T+D+ VL+ LR+K+ +   L++  ++
Sbjct: 443 IADGTVDQKVLRALRSKANLAKTLVDDYRR 472


>gi|125974159|ref|YP_001038069.1| SNF2-related protein [Clostridium thermocellum ATCC 27405]
 gi|125714384|gb|ABN52876.1| SNF2-related protein [Clostridium thermocellum ATCC 27405]
          Length = 452

 Score =  124 bits (310), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 109/447 (24%), Positives = 209/447 (46%), Gaps = 44/447 (9%)

Query: 28  SGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK- 85
           +GKT+  +  +  +   G  K VL++APL +   VW  E +R+++F +  I V+ GT++ 
Sbjct: 14  TGKTLVSIAIIGALLAAGRIKRVLIVAPLSIL-GVWEDEFKRFADFPYQLI-VLNGTIQK 71

Query: 86  --QRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTAR 142
             Q+ + L    V + V+N+E+  W +++    W    I+ DE  K+K+      +  ++
Sbjct: 72  KIQQLRFLTGEGVHVVVVNYES-AWRMEKELANWHPDLIIADEGHKIKT----HNTSVSK 126

Query: 143 ALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSH 202
           A+ +    +   + LTGT   N  ID++ Q  FLD  +  G  F +F  R+FN    G+H
Sbjct: 127 AMHRLGLLARYRLLLTGTVITNKAIDVFSQYKFLDP-RIFGNSFYAFRNRYFNMVGYGNH 185

Query: 203 IGAVRYTAKETAQKEI-----EAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQY 257
              ++ + ++   K I      A  ++C   LD+ +  +I       + + L    +K+Y
Sbjct: 186 TPVLKKSMEQDLMKRIHSIAFRATKAEC---LDLPETTDI------IRHIELEPVTLKKY 236

Query: 258 HKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE 317
            +  ++ Y +L    + A N  ++ ++  QL  G +  D+    ++V D K+KALE I+E
Sbjct: 237 KELVKQSYTELSAGEVTATNILTRLLRLSQLTGGFIGSDDGGKIEQVSDAKLKALEDILE 296

Query: 318 KA--NAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCTIQEWNEGKIPLLF 366
            +      ++V   F  ++  + +   +         G T D+     +   +    +  
Sbjct: 297 SSIQEGHKLVVIARFIPEIHAICRLLEKKNIGYACIYGATKDRQEQVNRFQYDPDCMVFV 356

Query: 367 AHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQ 426
              A+ G G+ L    + +VF+SL + +   +Q   RI      + G K      YLIA+
Sbjct: 357 GQIATAGLGITLT-AASTMVFYSLDYSMSNFEQTKARI-----HRVGQKNGCTYIYLIAK 410

Query: 427 NTIDELVLQRLRTKSTIQDLLLNALKK 453
            T+D  +L  LR K+ +  +L++  +K
Sbjct: 411 GTVDSKILTALRNKADLAKMLIDDYRK 437


>gi|167630922|ref|YP_001681421.1| snf2 family helicase [Heliobacterium modesticaldum Ice1]
 gi|167593662|gb|ABZ85410.1| snf2 family helicase [Heliobacterium modesticaldum Ice1]
          Length = 449

 Score =  122 bits (305), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 111/446 (24%), Positives = 208/446 (46%), Gaps = 34/446 (7%)

Query: 20  CAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            A+   MG+GKT++ +     ++  G+ + +LV+APL +   VW  E  ++++F + +++
Sbjct: 6   AALLMEMGTGKTITSIAVAGALYQAGKIRRLLVVAPLSIL-GVWDGEFAKFADFDY-SLA 63

Query: 79  VITGTVKQRTKVLK----TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRL 134
           V+ G+  ++T  L+    +P  + VIN+E+  W +++    W    I+ DE  K+K+  +
Sbjct: 64  VLEGSAAKKTDTLRHMRGSPLQVAVINYES-AWRLEKELAAWNPDLIIADEGHKIKTHNI 122

Query: 135 RQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWF 194
                  R  A+  +     + LTGT   N  ID++ Q  FL      G+ F  F  R+F
Sbjct: 123 AASKAMHRLGARARYR----LLLTGTVITNKAIDVFSQYKFLSPAV-FGQSFYVFRNRYF 177

Query: 195 NTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVM 254
           + T  G+H   +    K++ ++++  +L         A+  ++ K   I + V L    M
Sbjct: 178 DMTGYGNHTPVL----KKSMEQDLMKRLHSVAFRATKAECLDLPKTTDIVRYVELESAAM 233

Query: 255 KQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEV 314
           K Y    R+ Y +L    + A N  ++ ++  Q+  G +   E    + V   K +ALE 
Sbjct: 234 KIYRDLVRDSYAELGKGEVTATNILTRLLRLSQITGGFIGGGEGGPVQRVSTAKEEALED 293

Query: 315 IIE---KANAAPIIVAY---HFNSDLARLQK-----AFPQGRTLDKDPCTIQEWNEGKIP 363
           IIE   ++    +I+A      N+    L+K     +   G   D++       N  ++ 
Sbjct: 294 IIEDVLQSGKKLVIIARFIPEINAICRLLEKKGIRYSLLMGGVKDREEQVSAFQNGPEVQ 353

Query: 364 LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
           +     A+ G G+ L    + +VF+SL + +   +Q   RI      + G K      YL
Sbjct: 354 VFVGQIATAGLGVTLT-AASTMVFYSLDYSMSNFEQARARI-----HRVGQKENCTYLYL 407

Query: 424 IAQNTIDELVLQRLRTKSTIQDLLLN 449
            A+ T+DE VL+ LR K+ +  +L++
Sbjct: 408 TAKGTVDEKVLKALRDKADLARMLVD 433


>gi|66392086|ref|YP_239310.1| possible DNA helicase [Xanthomonas phage Xp15]
 gi|62529196|gb|AAX84879.1| possible DNA helicase [Xanthomonas phage Xp15]
          Length = 587

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 128/466 (27%), Positives = 212/466 (45%), Gaps = 47/466 (10%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTS 64
           HQ +   ++L +KR   ++ +G+GKT+S L    ++ +  + K VL+I PL   +SVW  
Sbjct: 136 HQKRTAVFLLQNKRAYNFSDLGTGKTLSHLWCADFLMVNEKIKKVLIIGPLSTLKSVWGR 195

Query: 65  EVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENL------GWLVQELKGTWPF 118
           E+  + NF H   S+  GT  +R   L+      + N + +      G +++++K +   
Sbjct: 196 EI--FLNFPHRRYSIAHGTQPERLAALRAKVEFVITNHDAVTIPVVEGEIIKQIK-SGEI 252

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD- 177
             +++DE T  K    ++ SK  + +A    +      +TG P+PN   + +GQ   ++ 
Sbjct: 253 GLVIIDELTAYKKHTTKR-SKAMQRIANACGDKVGVHGITGAPTPNRATEAFGQAKVVNP 311

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQK----EIEAQLSDCCLSLDIAD 233
           K + L R ++ F  +     Q+G ++      A E A K     I  +  DC   +DI D
Sbjct: 312 KNRHLPRYYKQF--QMMVEYQVGPYLWLPHEGANEIANKILQPAIRFKRDDC---IDIPD 366

Query: 234 YQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAV 293
            Q       IT+ V       K Y K + +L  + +   I A N+A K +K LQ+A+GAV
Sbjct: 367 CQ------YITQVVEFTPEQKKMYEKMKSDLLVEYEAGEITAVNAAVKAMKLLQIASGAV 420

Query: 294 YYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGR-----TLD 348
             DE +  K     +  AL  I E      +++   F + +  L   F Q R     T++
Sbjct: 421 KDDEGRIVKVDASTREDALWEIFEGTGETKLVIFAAFRATIDHLVGYF-QDRNVKVATIN 479

Query: 349 KD------PCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIE 402
            D         +Q++ +  + +L   P S  HG+ L     I V++SL    E + Q   
Sbjct: 480 GDVPHALRAKHVQDFQDSDLQVLIIQPQSSAHGITLTASCTI-VWYSLVPSGEIYVQANG 538

Query: 403 RIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK-STIQDLL 447
           RI  TR   AG  R   +Y+LI     +  VL  L  K ST Q+LL
Sbjct: 539 RI--TR---AGQSRKQTIYHLIGCRP-ERHVLDILEGKVSTSQNLL 578


>gi|19552947|ref|NP_600949.1| helicase [Corynebacterium glutamicum ATCC 13032]
 gi|62390624|ref|YP_226026.1| superfamily II DNA/RNA helicase [Corynebacterium glutamicum ATCC
           13032]
 gi|21324512|dbj|BAB99136.1| Superfamily II DNA/RNA helicases, SNF2 family [Corynebacterium
           glutamicum ATCC 13032]
 gi|41325962|emb|CAF20125.1| Superfamily II DNA/RNA helicase [Corynebacterium glutamicum ATCC
           13032]
          Length = 613

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 100/201 (49%), Gaps = 17/201 (8%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVW 62
           L P Q  +  +I+D     I+ +MG GKT++ L+AL+YI   G   +LV+APL +++  W
Sbjct: 30  LEPFQKVVRQFIIDRPYSGIFLTMGGGKTLTTLSALTYIQPPGH--ILVVAPLNISRLTW 87

Query: 63  TSEVQRWSNFSHMNISVIT---GTVKQRTKVLK-------TPAVLYVINFENLGWLVQEL 112
             EV++W N     IS+IT   GT   R K LK       TP  LY I    L  +V   
Sbjct: 88  PEEVRKW-NIPVNAISLITNERGTKLTRAKRLKLYEETATTPPTLYYITINLLEDIVNYF 146

Query: 113 KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQ 172
              WPF T+++DES  +        SK  RAL        R I LTGTPS N    ++ Q
Sbjct: 147 GDRWPFWTVIIDESQTISDI----SSKRTRALFSVRPYIGRLILLTGTPSANKFDSIYAQ 202

Query: 173 IWFLDKGKRLGRVFQSFVARW 193
           +  LD G  LG     F ARW
Sbjct: 203 VAVLDYGASLGDNIDVFRARW 223



 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 103/237 (43%), Gaps = 58/237 (24%)

Query: 273 IEAFNSASKTVKCLQLANGAVYYDEEKHWKE----------------------------- 303
           I A ++A+  +K LQ A GAVY D E   +                              
Sbjct: 382 ISAVHAATLRMKLLQYAGGAVYVDPEDSAQSQDLDASTARDVIDATNTAMTTITSRPTMI 441

Query: 304 VHDEKI-KALEVIIEKA------------------NAAPIIVAYHFNSD----LARLQKA 340
           VH  K+ K +E++   A                     P +VAY F SD    L  L +A
Sbjct: 442 VHLHKVRKVIEILCNPALGGEPVNIDQDETGKQVYTPTPTLVAYRFISDKEILLHYLAQA 501

Query: 341 FPQG-RTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQ 399
             QG    D  P  +  WN G+IP+L   PAS GHGLN Q+GG+ LV+++L  + E + Q
Sbjct: 502 GVQGVEVFDGSPDMLSRWNAGRIPVLLLQPASAGHGLNFQHGGHRLVWYNLPDNNEHYMQ 561

Query: 400 MIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
              R+      + G K  V ++ +I  +T D  +   L  K+  Q  L++A++++ +
Sbjct: 562 ANARL-----HRIGQKNPVTIHRIITADTYDANMPAILAGKANRQQRLIDAVRRDPV 613


>gi|158320324|ref|YP_001512831.1| helicase domain-containing protein [Alkaliphilus oremlandii OhILAs]
 gi|158140523|gb|ABW18835.1| helicase domain protein [Alkaliphilus oremlandii OhILAs]
          Length = 419

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 114/425 (26%), Positives = 185/425 (43%), Gaps = 41/425 (9%)

Query: 38  LSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--- 93
           +  I+L G+ + VL++AP  V  SVW  E+Q ++ F    + V+ G+ KQ+ K L +   
Sbjct: 1   MGRIYLEGKARKVLIVAPTSVV-SVWPKEIQEYAAFD-CEVRVLDGSSKQKVKELHSFTK 58

Query: 94  PAVL--YVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWES 151
             VL   VIN+E+   ++ EL   W    I+ DES ++KS      +K ++AL K     
Sbjct: 59  DKVLKIAVINYESTWRILDELI-QWKADLIIADESQRIKS----PTAKQSKALHKLGDSV 113

Query: 152 ERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAK 211
              + L+GTP  N  +DLW Q  FLDK +  G  + SF AR       G +         
Sbjct: 114 RYKLILSGTPVQNAPLDLWSQYRFLDK-RIFGTSYYSFRARHAIMGGYGKYQVIGYKNMD 172

Query: 212 ETAQKEIEAQLSDCCLSLDIADYQNIDKPILIT--KKVPLPQPVMKQYHKFQRELYCDLQ 269
           E  QK          ++L +   + +D P      +   L     K Y +  ++ Y  L+
Sbjct: 173 ELIQKT-------HSVALRVTKEEALDLPETTDEIRYCSLEPDSAKLYKRILKDSYVQLE 225

Query: 270 GENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAA------- 322
              + A N  +K ++  QL  G +  D +   K++   K+ AL+ IIE    A       
Sbjct: 226 KGEVTAQNLLTKLLRLSQLTGGFIGAD-DGTIKQISKAKLDALKEIIEDMKDAGKKLVVF 284

Query: 323 ----PIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNL 378
               P I A     D   +  ++  G   D+     +   E  + +  A   + G G+ L
Sbjct: 285 ARFLPEINAIKNMLDEMEISYSYITGEVKDRGEEVRKFQEEDGVRVFIAQIQTAGLGITL 344

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
            +  + +VF+SL ++   + Q   RI      + G K      +LIA  T+DE +L+ L 
Sbjct: 345 -HAADTVVFYSLDFNYANYSQARARI-----HRIGQKNTCTYIHLIAPGTVDEKILKALE 398

Query: 439 TKSTI 443
            K  I
Sbjct: 399 KKENI 403


>gi|325661424|ref|ZP_08150050.1| hypothetical protein HMPREF0490_00784 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325472373|gb|EGC75585.1| hypothetical protein HMPREF0490_00784 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 493

 Score = 99.0 bits (245), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 108/458 (23%), Positives = 199/458 (43%), Gaps = 48/458 (10%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVW 62
           L  HQ ++V+  L+     ++   G GKT+  +    ++        LV+ PL + ++ W
Sbjct: 63  LYKHQKEVVNKALNENGYGLFLDTGCGKTLCGIEIAKHLG-----KTLVLCPLSIIETAW 117

Query: 63  TSEVQRWSNFSHMNISVITGTVKQ-RTKVLKTPAVLYVINFENLGWLVQELKGTWPFATI 121
             +  ++  +  + I    G  KQ R +VL   A +YV+N+E+   +  E++    F  +
Sbjct: 118 IDDCNKF--YPELKIVNCWGNSKQKRLEVLNIEADIYVMNYESFKIIKNEIRKK-DFKCM 174

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
           +VDES+ +K+ +      T   L+   +   R++ L+G P+PN  ++++ QI   +    
Sbjct: 175 IVDESSVMKNMK---SQITTDILSCVDFIPRRYV-LSGCPTPNHNLEIFPQIKLCN-SDM 229

Query: 182 LGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            G  +  F A +F+      H+    +   +  +     +LS C + ++  D   +   I
Sbjct: 230 FGNNYLGFQASYFHQDLENPHV----WYQTQDDKDRFFRKLSQCSVFVNKEDCVELPDKI 285

Query: 242 LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASK---TVKCLQLANGAVYYDEE 298
              K+  L         K QR+ Y D+  +  E  N  SK   T K ++L      +  +
Sbjct: 286 FSIKEFDLD--------KNQRKYYNDILNDIKEHINEWSKFEFTAKLMKLREVVSGFVIQ 337

Query: 299 KHWK--EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFP----QGRTLDKDPC 352
           K+    +    K   LE  + +     +IV   F  ++ +L + F       +T ++D  
Sbjct: 338 KNGDVTDFKTNKDNILEDTLNEIGDKQVIVWCQFIHEIEKLAEKFDGTALTSKTKNRDD- 396

Query: 353 TIQEWNEGKIPLLFAHPASCGHG---LNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
            I+ +  G I LLFAHP   G G    N  Y     +++SL +  EE +Q  +RI     
Sbjct: 397 IIRSFKNGDIKLLFAHPKLLGKGATFTNCTYN----IYYSLSFSYEEFKQSQDRI----H 448

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLL 447
           R     +  ++  L  +NTID+ +   L+ K    D L
Sbjct: 449 RIGQANKCTYI-ILQGKNTIDKRIYNSLQRKGNAVDEL 485


>gi|160944098|ref|ZP_02091328.1| hypothetical protein FAEPRAM212_01600 [Faecalibacterium prausnitzii
           M21/2]
 gi|158444774|gb|EDP21778.1| hypothetical protein FAEPRAM212_01600 [Faecalibacterium prausnitzii
           M21/2]
          Length = 562

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 108/462 (23%), Positives = 205/462 (44%), Gaps = 52/462 (11%)

Query: 18  KRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMN 76
           K  A    MG GKT++ +  +  ++   +   VLV+AP  V  SVW  ++Q+++ F + +
Sbjct: 119 KGFAFLFEMGCGKTLTAIATMGALYQMHKIDRVLVVAPSSVC-SVWPHDLQQFAAFPY-H 176

Query: 77  ISVITGTVKQRTKVLKTPAV-------LYVINFENL--GWLVQELKGTWPFATIVVDEST 127
              + G  K+R + L    V       + VIN+E+     + + L+   P   I+ DES 
Sbjct: 177 CEPLLGEKKKRLEALDALEVWPFAQLKIAVINYESTHRDGIFEALQEYDP-DLIICDESQ 235

Query: 128 KLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQ 187
           ++K+    Q    ++AL K   +++  + L+GTP  N  +DL+ Q  FLD     G  F 
Sbjct: 236 RIKNHTAAQ----SKALHKLGDKAQYKLALSGTPVQNNAVDLYSQYRFLDPAV-FGSNFY 290

Query: 188 SFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP--ILITK 245
           +F  R+      G H         +  Q+E         ++  +   + +D P    I +
Sbjct: 291 AFRNRYCLMGGYGQHQIVGYRNMDQLVQRE-------HSIAYRVTKAECLDLPPQTFINR 343

Query: 246 KVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEV 304
            V       K Y + +R  + +L  G++I A    +K ++ +QL  G    D+    ++V
Sbjct: 344 YVKFSPADRKLYEQLRRSSFAELDSGDSITATTVLTKMLRLMQLTGGFTQTDDGTRPQQV 403

Query: 305 HDEKIKALEVIIEK---ANAAPIIVAYHFNSDLARLQ-----KAFPQGRTLDKDPCT--- 353
           +  K+ ALE I++       + +++   F +++A ++     K  P G      P     
Sbjct: 404 NTAKLDALEDILDDYVLETGSKLVIFARFRAEIAAIENALRKKGIPYGSIYGDVPQAERG 463

Query: 354 -----IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTR 408
                 Q+  E K+    A   + G G+ L +  ++ VF+S+ ++   + Q + RI    
Sbjct: 464 KIVDDFQQNPEAKV--FVAQIQTAGLGITL-HAASMAVFYSIDYNYANYAQALARI---- 516

Query: 409 QRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
             + G    V   +L+ +++ID+ VL  L  K  I   ++++
Sbjct: 517 -HRIGQHNPVTYIHLLVEDSIDDKVLAALENKEDIAKSIVDS 557


>gi|323441318|gb|EGA98983.1| phage helicase [Staphylococcus aureus O46]
          Length = 128

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 74/125 (59%), Gaps = 6/125 (4%)

Query: 328 YHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVF 387
           Y+F  D  R+ + F +  TL+ D    + WN G I LL AHPAS GHGLNLQ GG+I+V+
Sbjct: 3   YNFKHDKERILERFKEATTLE-DSNYKERWNSGNIKLLIAHPASAGHGLNLQQGGHIIVW 61

Query: 388 FSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLL 447
           F L W LE +QQ   R+   RQ   G      +++L+  NTID+ V + L+ K   Q+ L
Sbjct: 62  FGLTWSLELYQQANARL--YRQ---GQNHTTIIHHLMTDNTIDQRVYKALQNKELTQEEL 116

Query: 448 LNALK 452
           + A+K
Sbjct: 117 MKAIK 121


>gi|260549505|ref|ZP_05823723.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
 gi|260407298|gb|EEX00773.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
          Length = 72

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 58/68 (85%)

Query: 386 VFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
           +FFS WWDLE++QQ+IERIG TRQ QAG+ R V++Y++IA++T+DE+V++R  +K  +QD
Sbjct: 1   MFFSHWWDLEQYQQIIERIGPTRQAQAGYDRPVYIYHIIAKDTMDEIVMERRESKREVQD 60

Query: 446 LLLNALKK 453
           LL+ A+KK
Sbjct: 61  LLMEAMKK 68


>gi|255282163|ref|ZP_05346718.1| domain protein, SNF2 family [Bryantella formatexigens DSM 14469]
 gi|255267111|gb|EET60316.1| domain protein, SNF2 family [Bryantella formatexigens DSM 14469]
          Length = 454

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 104/456 (22%), Positives = 202/456 (44%), Gaps = 58/456 (12%)

Query: 26  MGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
           MG GKT++ +  +   +  G  K+VL+IAP  V  SVW  E   +++F + N++V+ G  
Sbjct: 19  MGCGKTLTAIATMGAAYEMGAIKTVLIIAPTSVC-SVWPKEFDEYADFKY-NVAVLLGDK 76

Query: 85  KQRTKVLKTPAV-------LYVINFENLGWL--VQELKGTWPFATIVVDESTKLKSFRLR 135
           ++R   L++ A        + VIN+E+  W   + E    W    I+ DES ++K  + +
Sbjct: 77  QKRLAALRSLAAFPFEALRVAVINYEST-WREGIFEALLDWHPDMIICDESQRIKEPKAK 135

Query: 136 QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARW-- 193
           Q    +RA+ +    ++  + L+GTP  N  IDL+ Q  FLD     G  F +F  R+  
Sbjct: 136 Q----SRAMHELGDAAKYKLILSGTPIQNNAIDLYSQYRFLDP-TVFGTNFFAFRNRYAI 190

Query: 194 ---FNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP--ILITKKVP 248
              F+  QI  +    +   KE +            ++  +   + +D P    +T+ + 
Sbjct: 191 MGGFDRRQIVGYKDLDKLIQKEHS------------VAYRVTKEEALDLPEQTFLTQYIT 238

Query: 249 LPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDE 307
           L     + Y++ +R+ + +L+ G  I A    +K ++  Q   G +  DE    + V   
Sbjct: 239 LEGKDKQLYNQIKRDSFAELEDGGQITAPTVLTKLLRLQQFTGGFIQADEGIKPEFVFKG 298

Query: 308 KIKALEVIIEK---ANAAPIIVAYHFNSDLA-----------RLQKAFPQGRTLDKDPCT 353
           KI ALE I++    +    +++   F  ++            R    +   +  D+ P  
Sbjct: 299 KINALEDILDDYVISAGKKLVIFCRFRPEIDLISDSLKKKKIRFASIYGDIKIEDRGPIV 358

Query: 354 IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 413
                  +  +  A   + G G+ L    +  V++S  ++   + Q + RI    Q+   
Sbjct: 359 EDFQKNPETKVFLAQIDTAGLGITLT-AADTCVYYSENFNYAAYSQSLARIHRIGQKN-- 415

Query: 414 FKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN 449
             R  ++ +L+ +++IDE +L+ L  K  +   +++
Sbjct: 416 --RCTYI-HLVVEHSIDETILKALARKEDLAKTVVD 448


>gi|301321598|gb|ADK68988.1| Superfamily II DNA/RNA helicase, SNF2 family [Gordonia sp. KTR9]
          Length = 735

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 100/211 (47%), Gaps = 28/211 (13%)

Query: 267 DLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWK--------------EVHDEKIKAL 312
           D     IEA N      K LQ A GAVY D +K                 ++H  K   +
Sbjct: 512 DASAHYIEAVNGGVLRNKLLQFAAGAVYIDLDKGADGYAKATSLTSRPTLQLHSAKFDKV 571

Query: 313 EVIIEK----ANAAPIIVAYHFNSD----LARLQKA-FPQGRTLDKDPCTIQEWNEGKIP 363
             I ++         +++AY F+ +    + RL++A +   R  +  P T + WN G+IP
Sbjct: 572 IDICDQHFATGGDGSVLIAYRFDFEKTILIDRLRRAGYLGARAYNGMPDTKKAWNRGEIP 631

Query: 364 LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
           ++  HPAS GHGLNLQ+GG+ L++ +L    E + Q   R+      + G  + V V+ +
Sbjct: 632 VMLVHPASAGHGLNLQFGGHTLIWTTLPDSNEHYGQTPARLN-----RLGQTKPVVVHTI 686

Query: 424 IAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
           + +NTID  +   L  K   Q+ L+ A + E
Sbjct: 687 LTENTIDMAMPGALSDKQASQERLMQATRSE 717



 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 5/148 (3%)

Query: 116 WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
           WPF T+++DE+   K+ +    S   +A+        R IEL+GTP+P G  ++W QI+ 
Sbjct: 286 WPFPTVIIDEAQGFKNPQ----SLRWKAMIAVRPHIRRLIELSGTPTPEGAHEIWPQIFL 341

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           LD+G   G  +   +A WF   Q+  +    R+      + ++   +S   +S +  +  
Sbjct: 342 LDQGDTFGTSYTDHLATWFTPEQVVQN-QVTRWQISRWNETQLHQAISHLAISAENTELH 400

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRE 263
            +     IT +VPL   +M  Y  F R+
Sbjct: 401 LMGFGPPITHRVPLSADLMNAYQAFARD 428



 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 2  NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSV 61
           L P Q ++ D+I      A+W +MGSGKT+  L+ALSY+   G   +LV+AP  +A   
Sbjct: 23 TLKPFQKQVRDFIRTRHASAVWMTMGSGKTLVTLSALSYLREPGH--ILVVAPRNIAVDT 80

Query: 62 WTSEVQRW 69
          W  E+  W
Sbjct: 81 WPEELFDW 88


>gi|313895657|ref|ZP_07829213.1| SNF2 family N-terminal domain protein [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312975783|gb|EFR41242.1| SNF2 family N-terminal domain protein [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 403

 Score = 90.5 bits (223), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 86/330 (26%), Positives = 156/330 (47%), Gaps = 28/330 (8%)

Query: 21  AIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV 79
           A+   MG GKT+  +     +    + K VLV+APL +   VW  E  R+++F H  ++V
Sbjct: 44  ALLLEMGCGKTLCSVAITGALRRADKVKRVLVVAPLSIL-GVWEEEFSRFADFPH-TVTV 101

Query: 80  ITGTVKQRTKVLKTPAV------LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFR 133
           + GT  ++ + L T AV      + V+N+E+   L  ELK  +    I+ DE+ KLK  R
Sbjct: 102 LKGTSVKKKEQLLTAAVQGEHLQIVVVNYESAWRLENELKA-YDADLIIADEAHKLKEGR 160

Query: 134 LRQGSKTARALAKPAWESERF-IELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVAR 192
             Q SK    L   A    R+ + LTGT   N  +D++ Q  FL+K +  G  F +F   
Sbjct: 161 TAQ-SKAMHHLGDAA----RYKLLLTGTVITNKELDVFSQYRFLNK-EIFGTSFFAFRNC 214

Query: 193 WFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILI--TKKVPLP 250
           +F+    G ++   + + ++   + + A      ++  +   + +D P +    + V L 
Sbjct: 215 FFDMAGYGGYVPVFKESMRDDFLQRLHA------IAYRVTKTECLDLPEITEEVRSVALE 268

Query: 251 QPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIK 310
           +  +K Y   +RE Y +L    +   N  +K ++  QL  G +  D++     +   K+ 
Sbjct: 269 EKAVKVYKNLERESYAELACGEVSTVNVLTKLLRLSQLTGGFI-TDDDGSAHPISTAKLD 327

Query: 311 ALEVIIEK--ANAAPIIVAYHFNSDLARLQ 338
           AL  II+   ++   +++   F ++L  +Q
Sbjct: 328 ALSDIIDTVMSDGKKLVIMARFVAELDAIQ 357


>gi|283796858|ref|ZP_06346011.1| protein, SNF2 family [Clostridium sp. M62/1]
 gi|291075264|gb|EFE12628.1| protein, SNF2 family [Clostridium sp. M62/1]
          Length = 449

 Score = 89.7 bits (221), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 109/459 (23%), Positives = 200/459 (43%), Gaps = 58/459 (12%)

Query: 17  HKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHM 75
           HK   +   MG GKT++ +      +  G+ + VLV+AP  V  SVW  +   +++F   
Sbjct: 5   HKGFGLLFEMGCGKTLTAIMIAGTAYQMGKVEKVLVVAPTSVC-SVWPKDFAEFADFK-A 62

Query: 76  NISVITGTVKQRTKVLKT-------PAVLYVINFENLGWL--VQELKGTWPFATIVVDES 126
           NI V+ G   +R K+L            + VIN+E+  W   + +    W    I+ DES
Sbjct: 63  NIKVLLGDKNRRLKLLNDLDNFPFKALKVAVINYEST-WREGIFDALYEWNADMIICDES 121

Query: 127 TKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVF 186
            ++KS    Q    ++A+ K   +++  + L+GTP  N  IDL+ Q  FLD     G  F
Sbjct: 122 QRIKSHDAEQ----SKAMHKLGDQAKYKLILSGTPVQNNAIDLYSQYRFLDP-TIFGTNF 176

Query: 187 QSFVARW-----FNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP- 240
             F  R+     FN  QI  +    +   KE +            ++  +   + +D P 
Sbjct: 177 YQFRNRYAIMGGFNRHQIVGYKDLDQLIQKEHS------------IAYRVTKDEALDLPE 224

Query: 241 -ILITKKVPLPQPVMKQYHKFQRELYCDLQ-GENIEAFNSASKTVKCLQLANGAVYYDEE 298
              + + + +       Y + +RE + +L+ G  I A    +K ++  Q   G +  D E
Sbjct: 225 QTFLQRYITMSAKEKNIYDRIKRESFAELESGGQISATTVLTKLLRLQQFTGGFLVADGE 284

Query: 299 KHWKEVHDEKIKALEVIIEK--ANAAPIIVAY-HFNSDLARLQKAFPQGR---------- 345
           +  + V   K+ ALE I++    +A   +V +  F  ++  + +   + +          
Sbjct: 285 EKPELVSKGKLNALEEIVDDYVVDAGKKLVIFARFRPEIDIIGQMLKKKKLRYGEIYGDV 344

Query: 346 TLDKDPCTIQEWNEGKIPLLF-AHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERI 404
            L+     ++++      ++F A   + G G+ L    +  V++S+ ++   + Q + RI
Sbjct: 345 KLEDRGDIVKDFQTNPETMVFLAQIDTAGLGITLT-AADTCVYYSVNFNYAAYSQSLARI 403

Query: 405 GVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
                 + G K A    +LI + TIDE+VL+ L  K  +
Sbjct: 404 -----HRIGQKNACTYIHLITEGTIDEVVLKALAKKEDL 437


>gi|12719426|ref|NP_075497.1| hypothetical protein phiSLTp35 [Staphylococcus phage phiSLT]
 gi|12697856|dbj|BAB21728.1| unnamed protein product [Staphylococcus phage phiSLT]
          Length = 116

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 65/107 (60%), Gaps = 6/107 (5%)

Query: 347 LDKDP-CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIG 405
           L+KD     + WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+ 
Sbjct: 8   LEKDSKAKERRWNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL- 66

Query: 406 VTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             RQ   G      +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 67  -YRQ---GQNHTTIIHHIMTDNTIDQKVYEALQNKELTQEELMKAIK 109


>gi|57651290|ref|YP_185255.1| hypothetical protein SACOL0363 [Staphylococcus aureus subsp. aureus
           COL]
 gi|57285476|gb|AAW37570.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           COL]
          Length = 116

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 65/107 (60%), Gaps = 6/107 (5%)

Query: 347 LDKDP-CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIG 405
           L+KD     + WN G I LL AHPAS GHGLNLQ GG+I+V+F L W LE +QQ   R+ 
Sbjct: 8   LEKDSKAKERRWNSGDIKLLIAHPASAGHGLNLQQGGHIIVWFGLTWSLELYQQANARL- 66

Query: 406 VTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             RQ   G      +++++  NTID+ V + L+ K   Q+ L+ A+K
Sbjct: 67  -YRQ---GQNHTTIIHHIMTDNTIDQRVYKALQNKELTQEELMKAIK 109


>gi|42766595|gb|AAS45429.1| prophage-encoded helicase [Selenomonas ruminantium]
          Length = 126

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 61/99 (61%), Gaps = 5/99 (5%)

Query: 354 IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 413
           I +WN GKIP+   HPAS GHGLNLQ GG+IL++FSL W LE +QQ   R+   RQ   G
Sbjct: 25  IADWNAGKIPVALIHPASAGHGLNLQEGGSILIWFSLTWSLELYQQTNARL--YRQ---G 79

Query: 414 FKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
            K  V + ++  + TID  V++ L  K   Q  L+ A+K
Sbjct: 80  QKDTVSIIHITTEGTIDGDVMKALERKDKTQTALIEAVK 118


>gi|228904537|ref|ZP_04068620.1| hypothetical protein bthur0014_56750 [Bacillus thuringiensis IBL
           4222]
 gi|228855101|gb|EEM99677.1| hypothetical protein bthur0014_56750 [Bacillus thuringiensis IBL
           4222]
          Length = 413

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 109/455 (23%), Positives = 194/455 (42%), Gaps = 60/455 (13%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAP--LRVA 58
           M L PHQ + ++    H R A +  MG GKT           +  EK   +  P  L + 
Sbjct: 3   MQLFPHQDRALNDTYKHSRVAYYLDMGLGKTF----------VGSEKMWELNTPYNLLIC 52

Query: 59  QSVWTSEVQRWSNF--SHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           Q    S++  W      H +  VI    +Q   +   P  + +IN++ + W   ELK   
Sbjct: 53  QK---SKIDDWKEHFEQHYDYKVIVFDKQQLEHI--PPESVLIINYDKV-WRRDELKKLK 106

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F TI++DES+ +K+       K+ R+       +E  I L+GTP+     +LW Q+  L
Sbjct: 107 DF-TIMLDESSMIKN------EKSNRSKFILGLNAENVILLSGTPTGGKYEELWSQLHLL 159

Query: 177 --DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
             +  K+L  + Q  V  W +  Q    +    Y   E  + +++   +    + ++ D 
Sbjct: 160 GWNISKKLF-LKQFVVQEWDDKNQ---QMKITGYKNVERLKAKLKKHGAVFMKTEEVFDL 215

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVY 294
            N       T ++P+  PV K Y++F++    ++  E +     A+K +   QLA     
Sbjct: 216 PN-------TNEIPVKIPVTKMYNEFKKHHIIEIGEELLIGDTPAAKKLYLRQLAGS--- 265

Query: 295 YDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQG-RTLDKDPCT 353
           Y+E          K++ ++ +IE  N   II+ Y+F  +   L     +   T++ D   
Sbjct: 266 YNE---------HKLQYIKDLIESTNDR-IIIFYNFKKEYMALVDLIERPIATINGDIKD 315

Query: 354 IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 413
           +  + +    +      +   GLNLQ   N +V+F+    L +  ++ E+    R  + G
Sbjct: 316 LSAYEKHDNSVTLIQYQAGAMGLNLQ-KANKIVYFT----LTDKSELFEQ-SKKRTHRIG 369

Query: 414 FKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
            KR  F YYL+   +I+  +L  L+ +    D L 
Sbjct: 370 QKRPCFYYYLLTDGSIEWRMLDVLKERRDYTDALF 404


>gi|315650300|ref|ZP_07903372.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
 gi|315487411|gb|EFU77721.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
          Length = 449

 Score = 79.7 bits (195), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 105/457 (22%), Positives = 194/457 (42%), Gaps = 60/457 (13%)

Query: 26  MGSGKTVSVLTALSYIH-LWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
           MG GKT++ +  L   + L   + VL+IAP  V  SVW  E   +++F  + + V+ G  
Sbjct: 14  MGCGKTLTAIATLGTAYKLEKIEKVLIIAPTSVC-SVWPKEFDDYADFKTI-VKVLLGDK 71

Query: 85  KQRTKVLKT-------PAVLYVINFENLGWL--VQELKGTWPFATIVVDESTKLKSFRLR 135
            +R K L            + VIN+E+  W   + E    W    I+ DES ++K+    
Sbjct: 72  DKRIKALSDLNSFPFKALKVAVINYEST-WREDIFEALYEWDSDMIICDESQRIKTHDAE 130

Query: 136 QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARW-- 193
           Q    ++A+ K   ++   + L+GTP  N  IDL+ Q  FLD     G  F  F  R+  
Sbjct: 131 Q----SKAIHKLGDQARYKLILSGTPVQNNAIDLYSQYRFLDP-TIFGTNFYQFRNRYAI 185

Query: 194 ---FNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP--ILITKKVP 248
              FN  QI  +    +   KE +            ++  +   + +D P    + +++ 
Sbjct: 186 MGGFNRHQIVGYRDLDQLIQKEHS------------IAYRVTKEEALDLPEQTFLERRIT 233

Query: 249 LPQPVMKQYHKFQRELYCDLQGEN-IEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDE 307
           L       Y K +RE + +L G   +      +K ++  Q   G +  D  +  + V   
Sbjct: 234 LSAKEKNIYSKIKRESFAELDGGGKVTVTTVLTKLLRLQQFTGGFLVADGSEKAELVSKG 293

Query: 308 KIKALEVIIE----KANAAPIIVAYHFNSDLARLQKAFPQGRT----------LDKDPCT 353
           K+ ALE II+     A+   +I A  F  ++  + +   + +           L+     
Sbjct: 294 KLNALEEIIDDYVVDADKKLVIFA-RFRPEIDLIGQMLTKKKIKYGAIYGDVKLEDRGGI 352

Query: 354 IQEWNEGKIPLLF-AHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQA 412
           ++++   +   +F A   + G G+ L    +  V++S+ ++   + Q + RI      + 
Sbjct: 353 VKDFQTNENTKVFLAQIDTAGLGITLT-AADTCVYYSVNFNYAAYTQSLARI-----HRI 406

Query: 413 GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN 449
           G K      +LI + T+DE +L+ L  K  +   +++
Sbjct: 407 GQKNICTYIHLITEGTVDETILKALARKEDLAKTIVD 443


>gi|229542511|ref|ZP_04431571.1| SNF2-related protein [Bacillus coagulans 36D1]
 gi|229326931|gb|EEN92606.1| SNF2-related protein [Bacillus coagulans 36D1]
          Length = 933

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 112/499 (22%), Positives = 194/499 (38%), Gaps = 99/499 (19%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHL--WGEKSVLVIAPL 55
           +L P+Q   ++W+   + C   A     MG GKTV ++  L ++      EK  L+I P 
Sbjct: 464 DLRPYQQLGLNWLAFLRDCGFGAVLADDMGLGKTVQLIAYLLHVKYTKQPEKPALIICPT 523

Query: 56  RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKV----LKTPAVLYVINFENLGWLVQE 111
            V  + W  E++++ N   +N+++  G  +++ K+         VL      NL +   E
Sbjct: 524 SVLGN-WQREIEKFGN--SLNVALHYGPNREKEKLGDYYQHADVVLTSYGIANLDF---E 577

Query: 112 LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWG 171
                 ++TI +DE+  +K+   +Q S+  R L     +   +I LTGTP  N L +LW 
Sbjct: 578 ALSAVEWSTIALDEAQNIKNAETKQ-SRAIRKL-----KGRHYIALTGTPMENRLSELWA 631

Query: 172 QIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
              F +KG                      ++G  R       QK   A +        I
Sbjct: 632 IFDFTNKG----------------------YLGTFR-----QFQKRFIAPIEKDGSKEKI 664

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFN 277
            + + + +P L+ +    P   +    K +++ YC L  E               I+  +
Sbjct: 665 RELKRLIQPFLLRRTKKDPDVELNLPEKLEQKEYCPLTAEQAALYEETVQNAFKGIDQLS 724

Query: 278 SASKTVKCLQLAN--------GAVYYDEEK--HWKE--VHDEKIKAL-EVIIEKANAAPI 324
              +    LQ+ N         A++  EEK  H  E     EK+  L E I+    +  I
Sbjct: 725 GLGRRALILQMLNRLKQLCNHPALFLKEEKPAHLLERSFKLEKLATLTEAILNTGESCLI 784

Query: 325 IVAY-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPAS 371
              Y              F  D+  L  + P+     K    I+++     P+      +
Sbjct: 785 FTQYIGMGQMIRQMMKELFGLDVPFLNGSMPKA----KRDQLIRDFQNKAFPVFLLSLKA 840

Query: 372 CGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDE 431
            G GLNL    N ++ +  WW+       +E     R  + G +R V V+ LIA  T++E
Sbjct: 841 GGTGLNLT-AANHVIHYDRWWN-----PAVENQATDRAHRIGQQRFVHVHKLIATGTLEE 894

Query: 432 LVLQRLRTKSTIQDLLLNA 450
            +   L  K  + D ++ +
Sbjct: 895 KIDAMLEKKQALNDEIIQS 913


>gi|71274979|ref|ZP_00651267.1| hypothetical protein XfasaDRAFT_2287 [Xylella fastidiosa Dixon]
 gi|71898395|ref|ZP_00680568.1| hypothetical protein XfasoDRAFT_3433 [Xylella fastidiosa Ann-1]
 gi|71164711|gb|EAO14425.1| hypothetical protein XfasaDRAFT_2287 [Xylella fastidiosa Dixon]
 gi|71731918|gb|EAO33976.1| hypothetical protein XfasoDRAFT_3433 [Xylella fastidiosa Ann-1]
          Length = 104

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/61 (55%), Positives = 48/61 (78%)

Query: 393 DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           DLE +QQ++ERIG TRQ QAG KR VF+++++A  T+DELV+ R  +K  +QDLLL A+K
Sbjct: 29  DLEHYQQIVERIGPTRQAQAGHKRPVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVK 88

Query: 453 K 453
           +
Sbjct: 89  R 89


>gi|325270384|ref|ZP_08136989.1| helicase [Prevotella multiformis DSM 16608]
 gi|324987328|gb|EGC19306.1| helicase [Prevotella multiformis DSM 16608]
          Length = 1326

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 108/440 (24%), Positives = 195/440 (44%), Gaps = 48/440 (10%)

Query: 26   MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK 85
            MG GKT+  +T L  +    + + LV+AP  V  + W +E++R++    + +   +G   
Sbjct: 900  MGLGKTLQTITLL--LEQQEKGASLVVAPASVVPN-WRNELRRFAPTLQVTVLNQSGDRP 956

Query: 86   QRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
               K  K+  V+ +I +  L     +L     +  + +DE+  +K+      +K ++A  
Sbjct: 957  GDIKAAKSGEVI-IITYALLNIQQDDLTDR-EWNVVCLDEAHTIKN----ANTKMSKAAM 1010

Query: 146  KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGA 205
            K   +++R + LTGTP  N L +LW    F++ G  LG   Q F  ++         I  
Sbjct: 1011 K--LQAQRKVILTGTPIQNHLAELWNLFQFINPG-LLGSAEQ-FKKKF---------ILP 1057

Query: 206  VRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK-PILITKKVP--LPQPVMKQYHKFQR 262
            +     ++ Q ++   +S   L    ++   ID+ P     ++P  L    M  Y   +R
Sbjct: 1058 IEGDNDKSRQSQLRKLISPFLLRRTKSEV--IDELPAKNEIRLPVELSSDEMAMYEVRRR 1115

Query: 263  ELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAA 322
            E    ++    +  ++ ++  +  Q+A      D  + WK +   K+ A   + E  N +
Sbjct: 1116 ETEEKVRANAADKVSTLAEITRLRQMACSCSLVD--RKWK-LPSSKVLAFIDLAESLNDS 1172

Query: 323  P--IIVAYHFNSDLARLQKAFPQGRT--LDKDPCT--------IQEWNEGKIPLLFAHPA 370
                +V   F S L  +++A  + R   L  D  T        +Q++  G+ P       
Sbjct: 1173 GNRALVFSQFTSFLDEVRRAMDKARLPYLYLDGSTPMAQREKLVQDFQTGRCPFFLISLK 1232

Query: 371  SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTID 430
            + G GLNL  G N ++    WW+       IE+    R  + G K+ V VY+LI+Q+TI+
Sbjct: 1233 AGGLGLNLT-GANYVIHLDPWWN-----PAIEQQATDRAYRIGQKQEVTVYHLISQHTIE 1286

Query: 431  ELVLQRLRTKSTIQDLLLNA 450
            E +L+  RTK  + D LL  
Sbjct: 1287 EKILRLHRTKRNLSDSLLEG 1306


>gi|162455821|ref|YP_001618188.1| SNF2 family helicase [Sorangium cellulosum 'So ce 56']
 gi|161166403|emb|CAN97708.1| helicase, Snf2 family [Sorangium cellulosum 'So ce 56']
          Length = 944

 Score = 76.6 bits (187), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 117/488 (23%), Positives = 193/488 (39%), Gaps = 80/488 (16%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQS 60
           + L P+Q + V  +  + R  +   MG GKT+  + A   +   GE   ++I      + 
Sbjct: 234 LPLFPYQREGVLHLFRNGRALLADDMGLGKTLQAIAACELLRRRGEARRVLIVTAASLKH 293

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
            W  E+ RW+       +V+ G+  QRT  L   A   V+++E L W  +EL      A 
Sbjct: 294 QWAQEIARWTG---ERAAVLGGSPAQRTGALAMEAAYTVLSYE-LTW--RELSRLKALAA 347

Query: 121 --IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DE+ + K+FR    +KTA  L   A  S     LTGTP  N L DL+  +  +D 
Sbjct: 348 DVLVLDEAQRAKNFR----TKTAATLR--AIPSRFLFVLTGTPVENRLDDLYALLQLVDP 401

Query: 179 GKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNID 238
              LG +++ F A +    + G  +G            E+  +++   L  + A+   +D
Sbjct: 402 AL-LGPLWR-FNADFHRQDERGRIVGYRNLG-------ELRRRVAPVALRRERAEVL-LD 451

Query: 239 KPILI--TKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKT-------------- 282
            P L+  T+  PL         + QREL  D + +       A +               
Sbjct: 452 LPPLLEQTRYTPL--------TREQRELEADYRAQAARLLAIAERRALRKEELDRLMMML 503

Query: 283 VKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNS---------- 332
           +K  Q  N     D  +  K     K+  LE +I +  A P      F+           
Sbjct: 504 MKARQACNALELCDPRRRKKA--SPKLDELEALIAEVTAQPRNKVIVFSEWVGMLELASE 561

Query: 333 --DLARLQKAFPQGRT-LDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFS 389
             D  R+  A   G    D+ P  +  + +     +     + G GLNLQ   + +V   
Sbjct: 562 RLDRLRVGHAMLHGDVPTDRRPALLDRFRDDPAVRVLLSTDAGGVGLNLQ-AASYVVHLD 620

Query: 390 LWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTID-----------ELVLQRLR 438
           L W+     Q        R  + G  R+V V YL A+  I+           ++++  LR
Sbjct: 621 LPWNPARLDQR-----TARAHRLGQGRSVSVTYLCAEEGIERGIEGILSEKRKVLVASLR 675

Query: 439 TKSTIQDL 446
             ST+++L
Sbjct: 676 ADSTVEEL 683


>gi|138894942|ref|YP_001125395.1| Patative DNA/RNA helicase [Geobacillus thermodenitrificans NG80-2]
 gi|196248491|ref|ZP_03147192.1| Non-specific serine/threonine protein kinase [Geobacillus sp.
           G11MC16]
 gi|134266455|gb|ABO66650.1| Patative DNA/RNA helicase SNF2 family [Geobacillus
           thermodenitrificans NG80-2]
 gi|196212216|gb|EDY06974.1| Non-specific serine/threonine protein kinase [Geobacillus sp.
           G11MC16]
          Length = 874

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 101/462 (21%), Positives = 204/462 (44%), Gaps = 59/462 (12%)

Query: 3   LAPHQTKIVDWIL---DHKRCAIWAS-MGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRV 57
           L PHQ +  +W+    + +R  + A  MG GKT+ V+  L +    G  K  L++ P+ +
Sbjct: 417 LFPHQMEGFEWLCHLAEQERGGLLADDMGLGKTIQVIAFLLHQKANGSLKPTLIVLPIAL 476

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
            ++ W +E+++++     ++ +  G+ +  +  L +   + + +++ L  + Q L G   
Sbjct: 477 IEN-WVAEIEKFAPSLLDSLYIHKGSERLASSQLISQFDIILTSYDTLK-IDQLLLGKIE 534

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERF-IELTGTPSPNGLIDLWGQIWFL 176
           F  I+ DE+  +KS    Q S+  RA+        RF + +TGTP  N L +LW  + F+
Sbjct: 535 FQAIICDEAQNIKS-HTSQRSRAIRAMQG------RFRLAMTGTPVENSLDELWAIMDFV 587

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVR-YTAKETAQKEIEAQLSDCCLSLDIADYQ 235
             G  LG + + F  R+  T+   + + A++ Y  + T Q+ ++ +L            +
Sbjct: 588 QPGA-LGSL-KEFRFRYTETSDYDALLMAIQPYYLRRTKQQILDGRLPK----------K 635

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYY 295
           ++  PI +        P+ K+     R +    +   +   N  ++  +        +  
Sbjct: 636 HLVPPIYVEAS-----PIQKE---IARSMLATKESGQVAILNMITRLRQLYGHPGAIIPK 687

Query: 296 DEEKHWKEVH--DEKIKALEVIIEKANAAPIIVAY---HFNSDLARLQKAFPQGRTLDKD 350
            E+  +KEV    E +  +E I +K   A I   +   HF      ++        +D D
Sbjct: 688 YEQLSYKEVPKLKETMHIIEAIRQKGEKALIFTEFRKLHFLLKRIFMETYGISVPVIDGD 747

Query: 351 P----CTIQEWNEGK-IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIG 405
                  +Q +NE +   ++   P + G GL +    N ++ ++ WW+       +E   
Sbjct: 748 TKNRQLIVQHFNETQGFGIMILSPKAAGVGLTIT-SANHVIHYTRWWN-----PAVENQA 801

Query: 406 VTRQRQAGFKRAVFVYYLIA-------QNTIDELVLQRLRTK 440
             R  + G ++ V+VY++I        Q T++EL+ + L +K
Sbjct: 802 TDRAYRIGQQKDVYVYHIITRDSSHFPQGTVEELMHELLESK 843


>gi|224541793|ref|ZP_03682332.1| hypothetical protein CATMIT_00965 [Catenibacterium mitsuokai DSM
            15897]
 gi|224525290|gb|EEF94395.1| hypothetical protein CATMIT_00965 [Catenibacterium mitsuokai DSM
            15897]
          Length = 1067

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 100/436 (22%), Positives = 181/436 (41%), Gaps = 70/436 (16%)

Query: 25   SMGSGKTVSVLTAL-SYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
             MG GKT+ +++ L S  H +     ++I P  +  + W  E  ++S  SH+ ++ + G+
Sbjct: 638  DMGLGKTIQIMSLLESNEHHFS----VIICPASLILN-WLDEFNKFS--SHLKVTCVMGS 690

Query: 84   VKQRTKVLKTPAVLYVI--NFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTA 141
             K+R +++K+     V+  +++ +    ++ KG   F  IV+DE+  +K+       KT 
Sbjct: 691  AKERKEIIKSYKQFDVMITSYDYIRKDYEQYKGI-TFDFIVLDEAQYIKN------QKTK 743

Query: 142  RALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGS 201
             A+A  + E ++   LTGTP  N L +LW    FL+K               +N     S
Sbjct: 744  NAIAVKSLEGKQRFALTGTPIENSLAELWSIFDFLNKD------------YLYNYRYFKS 791

Query: 202  HIGA-VRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKF 260
            H  A +     E  Q +++  +S   L       +     +L      +   V+  + + 
Sbjct: 792  HYEAPIVKDHDEETQTQLQKMISPFVL-------RRTKNEVLKDLPDKIENTVLVDFSED 844

Query: 261  QRELY-CDLQGEN--IEAFNSASKTVKCLQL--------ANGAVYYDEEKHWKEVHDEKI 309
            +++LY   L   N  ++  + +   ++ L +            + +D+ KH       K+
Sbjct: 845  EKKLYLAHLAQANQLLKTLDGSKDRIQILAMLTKLRQICCEPRIVFDDVKHKS----SKM 900

Query: 310  KALEVIIE--KANAAPIIVAYHFNSDLARLQKAFPQGRTL----------DKDPCTIQEW 357
            +A   II+  K N   IIV   F S L  L K   + +T           +K    +  +
Sbjct: 901  EACLNIIQTYKDNNKKIIVFSSFKSLLNLLAKELDKSKTSYYMLTGDTEKEKRKGLVDAY 960

Query: 358  NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
                  +      + G GLNL     + V F  WW++    Q        R  + G K  
Sbjct: 961  QNDDTTVFLISLKAGGTGLNLTAAEGV-VHFDPWWNMSAQNQ-----ATDRAYRIGQKNK 1014

Query: 418  VFVYYLIAQNTIDELV 433
            VFVY LI  ++I+E +
Sbjct: 1015 VFVYKLIMADSIEEKI 1030


>gi|302345308|ref|YP_003813661.1| SNF2 family N-terminal domain protein [Prevotella melaninogenica ATCC
            25845]
 gi|302150135|gb|ADK96397.1| SNF2 family N-terminal domain protein [Prevotella melaninogenica ATCC
            25845]
          Length = 1343

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 108/438 (24%), Positives = 190/438 (43%), Gaps = 48/438 (10%)

Query: 26   MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK 85
            MG GKT+  +T L  +      + L++AP  V  + W +E+QR++    +N++++  +  
Sbjct: 917  MGLGKTIQTITLL--LEQSENGASLIVAPASVVPN-WRNELQRFA--PTLNLTILNQSED 971

Query: 86   QRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
            +   + +  A   +I    L  + Q+      +  + +DE+  +K+   +  SK A  L 
Sbjct: 972  RSKDIKEAKAGDVIITTYGLLNIQQDDLTGREWNVVCLDEAHTIKNANTKM-SKAAMLL- 1029

Query: 146  KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGA 205
                +++  + LTGTP  N L +LW    F++ G  LG   Q F  ++         I  
Sbjct: 1030 ----KAQHKVILTGTPIQNHLAELWNLFQFINPG-LLGSAEQ-FRKKF---------ILP 1074

Query: 206  VRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK-PILITKKVP--LPQPVMKQYHKFQR 262
            +     +  Q ++   +S   L    A+   ID+ P     K+P  L    M  Y   +R
Sbjct: 1075 IEGDNDKARQSQLRRLISPFLLRRTKAEV--IDELPAKNEIKLPVELSSEEMAMYEVKRR 1132

Query: 263  ELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAA 322
            E    +     +  ++ ++     Q+A      D  K WK +   K+ A   + E  N +
Sbjct: 1133 ETEAKILENKADKVSTLAELTHLRQMACSCSLVD--KKWK-LPSSKVLAFIDLAESLNDS 1189

Query: 323  P--IIVAYHFNSDLARLQKAFPQGRT--LDKDPCT--------IQEWNEGKIPLLFAHPA 370
                +V   F S    ++KA  + +   L  D  T        ++E+  GK P       
Sbjct: 1190 DNRALVFSQFTSFFEEVRKAMDKAKLPYLYLDGSTSMAMREKLVKEFQTGKCPFFLISLK 1249

Query: 371  SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTID 430
            + G GLNL  G N +V    WW+       IE+    R  + G ++ V VY+LI+Q+TI+
Sbjct: 1250 AGGLGLNLT-GANYVVHLDPWWN-----PAIEQQATDRAYRIGQQQDVTVYHLISQHTIE 1303

Query: 431  ELVLQRLRTKSTIQDLLL 448
            E +L+  +TK  + D LL
Sbjct: 1304 EKILRLHKTKRNLSDSLL 1321


>gi|225867216|ref|YP_002752594.1| putative helicase [Bacillus cereus 03BB102]
 gi|225786779|gb|ACO26996.1| putative helicase [Bacillus cereus 03BB102]
          Length = 918

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 106/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + K  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRTKGKSFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|229187464|ref|ZP_04314606.1| Helicase, SNF2/RAD54 [Bacillus cereus BGSC 6E1]
 gi|228595985|gb|EEK53663.1| Helicase, SNF2/RAD54 [Bacillus cereus BGSC 6E1]
          Length = 855

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 106/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + K  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRTKGKSFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA---LEVI--------------- 315
           +         K  Q+ N    Y +E   K++ +  +K    +E+I               
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKNQNESCLIFTQ 711

Query: 316 -IEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
            I   N    ++  HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 822 EMLERKQSLNNAVITS 837


>gi|323138387|ref|ZP_08073457.1| SNF2-related protein [Methylocystis sp. ATCC 49242]
 gi|322396334|gb|EFX98865.1| SNF2-related protein [Methylocystis sp. ATCC 49242]
          Length = 828

 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 121/483 (25%), Positives = 202/483 (41%), Gaps = 74/483 (15%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGEKSVLVIAPLRVAQSV 61
           L P+Q +   +++   R  I   MG GKT+  + A   +   +G   VLV+ P  + +  
Sbjct: 235 LYPYQAEGALFVVRAGRALIGDDMGLGKTIQAIAATEILARHFGVSKVLVVCPTSL-KYQ 293

Query: 62  WTSEVQRWSNFSHMNIS-VITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFAT 120
           W SE+ R+S     N + VI+G   QR K         + N+E L   + +L   W    
Sbjct: 294 WQSEIMRFSGRQGENAARVISGGRAQRQKDYALDDFCKITNYEKLSPDL-DLIAAWGPEL 352

Query: 121 IVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           ++VDE+ ++K++     +  ARAL +   +S   I LTGTP  N L +L   + F+D+  
Sbjct: 353 VIVDEAQRVKNW----NTIAARALKR--VDSPYAIVLTGTPLENKLEELISIVQFVDQ-H 405

Query: 181 RLG-----------RVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQL---SDCC 226
           RLG           R     V  +    +IG  +  +    +++   E+  QL   +D  
Sbjct: 406 RLGPTWKLLHEHQVRDEAGRVTGYTGLEKIGQTLAPIMIRRRKS---EVLKQLPSRTDQN 462

Query: 227 LSLDIADYQNI---DKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNS----- 278
           L + + + Q +   +   ++ + V   +       K QR L C LQ   +   ++     
Sbjct: 463 LLVPMTEMQMLYHQENADVVARIVNRWRKTGFLADKDQRRLTCALQNMRMSCNSTYLLDQ 522

Query: 279 -ASKTVKCLQLANGAVYYD-----EEK-----HWKEVHDEKIKALEVIIEKANAAPIIVA 327
                VK  +LA  A++ D     E K      W   HD  I+ LE  + K       V+
Sbjct: 523 QTDHGVKADELA--ALFEDLFAEPEAKAVVFSQWTRTHDIIIRRLE--MRKLG----YVS 574

Query: 328 YHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVF 387
           +H              G   DK P  ++ + +     +F    +   GLNLQ+  + LV 
Sbjct: 575 FH-------------GGVPSDKRPELVERFRDDPACRVFLSTDAGSTGLNLQH-ASTLVN 620

Query: 388 FSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLL 447
             L W+    +Q I RI      + G  R V V   +A+ TI+E +L  L  K ++   +
Sbjct: 621 MDLPWNPAILEQRIARI-----HRMGQIRPVRVINFVAKGTIEEGMLSVLAFKRSLSAGI 675

Query: 448 LNA 450
           L+ 
Sbjct: 676 LDG 678


>gi|255038325|ref|YP_003088946.1| Non-specific serine/threonine protein kinase [Dyadobacter
           fermentans DSM 18053]
 gi|254951081|gb|ACT95781.1| Non-specific serine/threonine protein kinase [Dyadobacter
           fermentans DSM 18053]
          Length = 982

 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 111/491 (22%), Positives = 190/491 (38%), Gaps = 93/491 (18%)

Query: 3   LAPHQTKIVDWI--LDHKRCA--IWASMGSGKTVSVLTALSYIHLWG-EKSVLVIAPLRV 57
           L P+Q    DW+  L   R    +   MG GKTV  L  L      G ++  ++I P  +
Sbjct: 524 LRPYQKTGYDWLRFLKQYRFGGCLADDMGLGKTVQTLALLQSEKEGGADRPSILIMPTSL 583

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
             + W  E  +++    + + + TGT +++         L + ++  +  L  +L   + 
Sbjct: 584 LYN-WQLEASKFT--PDLRVLLYTGTNREKDTAQFDHYDLILTSY-GIIRLDIDLMEDYR 639

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F  +++DES  +K+      S   +A+ +    S   + LTGTP  N  +DLW Q+ F++
Sbjct: 640 FNYVILDESQAIKN----PSSIITKAVRR--LNSAHRLVLTGTPIENNTLDLWSQMSFVN 693

Query: 178 KGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNI 237
            G  LG   Q+F    F           +     E   K +                 N+
Sbjct: 694 PG-LLGS--QTFFRDEFQV--------PIEKKGDEEKTKRL----------------YNL 726

Query: 238 DKPILITK-----KVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCL------ 286
            KP ++ +        LP+ V       +   YCD+ GE  +A+  A    + L      
Sbjct: 727 IKPFILRRLKSQVATDLPEKV-------ESIQYCDMSGEQEKAYEEAKAYYRNLILQSID 779

Query: 287 -------------------QLANGAVYYDEE-KHWKEVHDEKIKALEVIIEKANAAPIIV 326
                              QLAN  V  D E  H     ++ +  L+ ++ + +   I  
Sbjct: 780 SEGMSKSQLVVLQGLTRLRQLANHPVMVDPEYAHDSGKFEDVLYKLQTVMSEDHKILIFS 839

Query: 327 AYHFNSDLAR-------LQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQ 379
            Y  + DL R       +  A+  G T D+        N+  I +      + G GLNL 
Sbjct: 840 QYIKHLDLFRHYLDEKEINYAYLDGATRDRQEQVESFQNDENIKIFLISLKAGGLGLNLT 899

Query: 380 YGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRT 439
               + +    WW+       IE   V R  + G  R VF Y  I +N+++E +L   R+
Sbjct: 900 AADYVFIL-DPWWN-----PAIEAQAVDRAHRIGQDRTVFTYKFITKNSVEEKILALQRS 953

Query: 440 KSTIQDLLLNA 450
           K  + D L+++
Sbjct: 954 KKQLADDLISS 964


>gi|326407578|gb|ADZ64649.1| DNA/RNA helicase, SWF/SNF family [Lactococcus lactis subsp. lactis
            CV56]
          Length = 1034

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 103/476 (21%), Positives = 204/476 (42%), Gaps = 66/476 (13%)

Query: 2    NLAPHQTKIVDWI--LDHKRCA--IWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRV 57
            +L  +Q   V W+  L H      +   MG GKTV  +T +   +L  ++SVL+ AP  +
Sbjct: 589  SLRSYQETGVRWMSMLSHYNLGGILADDMGLGKTVQAITFI-LSNLKKDESVLITAPASL 647

Query: 58   AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
              + W SE +++++   ++ +VI GT  +R+K ++    +Y+ ++   G  +++ +    
Sbjct: 648  TYN-WASEFEKFTD--EIDFAVIDGTKAERSKEIQEKHQIYITSY---GSFLKDFEDYQD 701

Query: 118  --FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWG--QI 173
                 +++DE+  +K++     SKT ++L+  A   E    L+GTP  N + ++W   Q+
Sbjct: 702  KKLNYLLLDEAQVVKNY----SSKTNKSLS--ALNVEHTFALSGTPLENRIEEIWAIFQV 755

Query: 174  ---WFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLD 230
                FL K ++  ++  S ++R      +      V     E  +  +  QL+D    + 
Sbjct: 756  VMPGFLPKREKFNKMEPSVISRLIQPFIMRRKKEDVLEELPEKMEITVYNQLADDQKVIY 815

Query: 231  IADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLAN 290
            +A  + + K +L      L +                     IE     +   +  Q+ N
Sbjct: 816  LAQLELMQKQVLEMDSAALSRS-------------------RIEIL---AGITRLRQICN 853

Query: 291  GAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQ------- 343
                + ++        E+++ L   I+ +   P+I +  F      ++K   +       
Sbjct: 854  TPALFMDDYKGSSGKLERLRELLAQIKDSGHRPLIFS-QFTKVFPHIEKLMEEQEMTAYK 912

Query: 344  --GRTLDKDPCT-IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM 400
              G T  KD  + +Q +N G          + G GLNL    ++++   LWW+       
Sbjct: 913  LTGSTPIKDRLSMVQAFNAGSRDAFLVSLKAGGVGLNLT-SADVVILVDLWWN-----PA 966

Query: 401  IERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
            +E   + R  + G K  V V  LI + TI+E +++    K   +DL+ N L+ +T+
Sbjct: 967  VEEQAIARAHRMGQKNTVEVIRLITKGTIEEKIMEIQERK---KDLIANVLEGDTV 1019


>gi|15674024|ref|NP_268199.1| SWI/SNF family helicase [Lactococcus lactis subsp. lactis Il1403]
 gi|12725092|gb|AAK06140.1|AE006434_2 SWI/SNF family helicase [Lactococcus lactis subsp. lactis Il1403]
          Length = 1034

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 103/476 (21%), Positives = 204/476 (42%), Gaps = 66/476 (13%)

Query: 2    NLAPHQTKIVDWI--LDHKRCA--IWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRV 57
            +L  +Q   V W+  L H      +   MG GKTV  +T +   +L  ++SVL+ AP  +
Sbjct: 589  SLRSYQETGVRWMSMLSHYNLGGILADDMGLGKTVQAITFI-LSNLKKDESVLITAPASL 647

Query: 58   AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
              + W SE +++++   ++ +VI GT  +R+K ++    +Y+ ++   G  +++ +    
Sbjct: 648  TYN-WASEFEKFTD--EIDFAVIDGTKAERSKEIQEKHQIYITSY---GSFLKDFEDYQD 701

Query: 118  --FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWG--QI 173
                 +++DE+  +K++     SKT ++L+  A   E    L+GTP  N + ++W   Q+
Sbjct: 702  KKLNYLLLDEAQVVKNY----SSKTNKSLS--ALNVEHTFALSGTPLENRIEEIWAIFQV 755

Query: 174  ---WFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLD 230
                FL K ++  ++  S ++R      +      V     E  +  +  QL+D    + 
Sbjct: 756  VMPGFLPKREKFNKMEPSVISRLIQPFIMRRKKEDVLEELPEKMEITVYNQLADDQKVIY 815

Query: 231  IADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLAN 290
            +A  + + K +L      L +                     IE     +   +  Q+ N
Sbjct: 816  LAQLELMQKQVLEMDSAALSRS-------------------RIEIL---AGITRLRQICN 853

Query: 291  GAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQ------- 343
                + ++        E+++ L   I+ +   P+I +  F      ++K   +       
Sbjct: 854  TPALFMDDYKGSSGKLERLRELLAQIKDSGHRPLIFS-QFTKVFPHIEKLMEEQEMTAYK 912

Query: 344  --GRTLDKDPCT-IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM 400
              G T  KD  + +Q +N G          + G GLNL    ++++   LWW+       
Sbjct: 913  LTGSTPIKDRLSMVQAFNAGSRDAFLVSLKAGGVGLNLT-SADVVILVDLWWN-----PA 966

Query: 401  IERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
            +E   + R  + G K  V V  LI + TI+E +++    K   +DL+ N L+ +T+
Sbjct: 967  VEEQAIARAHRMGQKNTVEVIRLITKGTIEEKIMEIQERK---KDLIANVLEGDTV 1019


>gi|303238092|ref|ZP_07324632.1| SNF2 family N-terminal domain protein [Prevotella disiens FB035-09AN]
 gi|302481727|gb|EFL44782.1| SNF2 family N-terminal domain protein [Prevotella disiens FB035-09AN]
          Length = 1337

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 114/477 (23%), Positives = 206/477 (43%), Gaps = 74/477 (15%)

Query: 2    NLAPHQTKIVDWILDHKRCAIWAS-------MGSGKTVSVLTALSYIHLWGEKSVLVIAP 54
            +L  +Q +  +W+    R   W +       MG GKT+  ++ L  +    E + LV+AP
Sbjct: 884  DLRKYQEEGFEWL---SRVTSWGAGVCLADDMGLGKTLQTISLL--LEQKKEGASLVVAP 938

Query: 55   LRVAQSVWTSEVQRWSNFSHMNISVITGT---------VKQRTKVLKTPAVLYVINFENL 105
              V  + W +E+++++    +N+ ++             KQ   VL T A+L +    N 
Sbjct: 939  ASVVPN-WRNEIRKFA--PSLNVLILNSADDRAAMIKKAKQGDIVLATYAMLNI----NE 991

Query: 106  GWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNG 165
              L+++    W    I +DE+  +K+   +  SK+A  L      ++R + LTGTP  N 
Sbjct: 992  AELIEQ---EW--NVICLDEAHTIKNPTTKM-SKSAMKL-----RAKRKVILTGTPIQNH 1040

Query: 166  LIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDC 225
            L +LW    F++ G  LG    +F  ++         I  +     ++ Q ++   +S  
Sbjct: 1041 LSELWNLFQFINPG-LLGSA-DAFKKKY---------ILPIEGDRNKSRQIQLRKLISPF 1089

Query: 226  CLSLDIADY-QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVK 284
             L     +  + + +   + + V L    M +Y   + +    ++ E   + ++ ++  +
Sbjct: 1090 LLRRTKGEVIEELPEKNEVVRPVELSDTEMARYELQRAQAEAMVEVEKNVSVSTLAEITR 1149

Query: 285  CLQLANGAVYYDEEKHWKEVHDEK---IKALEVIIEKANAAPIIVAYHFNSDLARLQKAF 341
              QLA      D  K W+ V  +    I   E + +  N A  +V   F S  A ++K  
Sbjct: 1150 LRQLACSTALVD--KKWEGVSSKTLAFIDLAESLNDSGNRA--LVFSQFTSYFAEIKKMM 1205

Query: 342  PQ---------GRT-LDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLW 391
             +         G T + K    ++E+ EG  P       + G GLNL  G N ++    W
Sbjct: 1206 DKTHLPYLYLDGSTPMKKREQLVREFQEGDCPFFLISLKAGGLGLNLT-GANYVIHLDPW 1264

Query: 392  WDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
            W+       IE+    R  + G ++ V VY LIAQ+TI+E +L+  +TK  + D LL
Sbjct: 1265 WN-----PAIEQQATDRAYRIGQEQDVTVYRLIAQHTIEEKILRLHKTKRDLADSLL 1316


>gi|281492645|ref|YP_003354625.1| SWF/SNF family DNA/RNA helicase [Lactococcus lactis subsp. lactis
            KF147]
 gi|281376309|gb|ADA65800.1| DNA/RNA helicase, SWF/SNF family [Lactococcus lactis subsp. lactis
            KF147]
          Length = 1034

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 103/476 (21%), Positives = 204/476 (42%), Gaps = 66/476 (13%)

Query: 2    NLAPHQTKIVDWI--LDHKRCA--IWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRV 57
            +L  +Q   V W+  L H      +   MG GKTV  +T +   +L  ++SVL+ AP  +
Sbjct: 589  SLRSYQETGVRWMSMLSHYNLGGILADDMGLGKTVQAITFI-LSNLKKDESVLITAPASL 647

Query: 58   AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
              + W SE +++++   ++ +VI GT  +R+K ++    +Y+ ++   G  +++ +    
Sbjct: 648  TYN-WASEFEKFTD--EIDFAVIDGTKAERSKEIQEKHQIYITSY---GSFLKDFEDYQD 701

Query: 118  --FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWG--QI 173
                 +++DE+  +K++     SKT ++L+  A   E    L+GTP  N + ++W   Q+
Sbjct: 702  KKLNYLLLDEAQVVKNY----SSKTNKSLS--ALNVEHTFALSGTPLENRIEEIWAIFQV 755

Query: 174  ---WFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLD 230
                FL K ++  ++  S ++R      +      V     E  +  +  QL+D    + 
Sbjct: 756  VMPGFLPKREKFNKMEPSVISRLIQPFIMRRKKEDVLEELPEKMEITVYNQLADDQKVIY 815

Query: 231  IADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLAN 290
            +A  + + K +L      L +                     IE     +   +  Q+ N
Sbjct: 816  LAQLELMQKQVLEMDSAALSRS-------------------RIEIL---AGITRLRQICN 853

Query: 291  GAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQ------- 343
                + ++        E+++ L   I+ +   P+I +  F      ++K   +       
Sbjct: 854  TPALFMDDYKGSSGKLERLRELLAQIKDSGHRPLIFS-QFTKVFPHIEKLMEEQEMTAYK 912

Query: 344  --GRTLDKDPCT-IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM 400
              G T  KD  + +Q +N G          + G GLNL    ++++   LWW+       
Sbjct: 913  LTGSTPIKDRLSMVQAFNAGSRDAFLVSLKAGGVGLNLT-SADVVILVDLWWN-----PA 966

Query: 401  IERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
            +E   + R  + G K  V V  LI + TI+E +++    K   +DL+ N L+ +T+
Sbjct: 967  VEEQAIARAHRMGQKNTVEVIRLITKGTIEEKIMEIQERK---KDLIANVLEGDTV 1019


>gi|256827746|ref|YP_003151705.1| DNA/RNA helicase, superfamily II, SNF2 family [Cryptobacterium curtum
            DSM 15641]
 gi|256583889|gb|ACU95023.1| DNA/RNA helicase, superfamily II, SNF2 family [Cryptobacterium curtum
            DSM 15641]
          Length = 1102

 Score = 73.6 bits (179), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 116/478 (24%), Positives = 208/478 (43%), Gaps = 65/478 (13%)

Query: 3    LAPHQTKIVDWI---LDHKRCAIWAS-MGSGKTV---SVLTALSYIHLWGEKSVLVIAPL 55
            L P+Q +   W+    D     I A  MG GK+V   +++ + S  H    +S L++ P 
Sbjct: 641  LRPYQEEGFCWLAHLCDVGMGGILADEMGLGKSVQLIALMVSRSLSHAHTNRSNLIVCPA 700

Query: 56   RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVL-KTPAVLYVINFENLGWLVQELKG 114
             +  + W +E  R++   H+ ++ + GT  +R  +  +T   +YV ++ +L     E   
Sbjct: 701  SLVYN-WLAEFDRFA--PHLRVAALVGTASEREALRQRTDIDVYVTSY-DLARRDIEHFA 756

Query: 115  TWPFATIVVDESTKLKSFRLRQGSKTARAL-AKPAWESERFIELTGTPSPNGLIDLWGQI 173
             + F  + +DE+  +K+      ++ ARA+ A PA    RF  LTGTP  N L +LW   
Sbjct: 757  NYRFDCLALDEAQYIKN----HATQAARAMKAIPA--DHRFA-LTGTPIENRLSELWSIF 809

Query: 174  WFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRY---TAKETAQKEIEAQLSDCCLSLD 230
             FL  G  L   ++ F  R+      G+   A R    TA    ++     L+D    L+
Sbjct: 810  DFLMPG--LLGSYRRFRDRYDKPIVEGNTKIAERLRQATAPFILRRRKAEVLTDLPDKLE 867

Query: 231  IADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSA-----SKTVKC 285
                       +I+ ++   Q  + Q H  +  L   ++  +   F++      ++  + 
Sbjct: 868  ----------SIISVRLEGKQRDLYQAH--EARLRQSIKSTDDARFSTGKLEVLAEITRL 915

Query: 286  LQL-ANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAA--PIIVAYHFNSDLARLQKAFP 342
             QL  + A+ YD+ +        K+ A+  I+E +  A    +V   F S L+R+ +   
Sbjct: 916  RQLCCDPALVYDDYRGPA----SKLDAIADIVEGSRDAGEKTLVFSQFTSFLSRIAQRLD 971

Query: 343  Q---------GRTLDKDPCT-IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWW 392
            +         G T  +     +  +N  ++P+      + G GLNL  G +++V    WW
Sbjct: 972  EMDIAYHTITGATPKQTRVQLVNAFNSDEVPVFLISLKAGGTGLNLT-GASVVVHADPWW 1030

Query: 393  DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
            +     Q  +     R  + G KR V VY LI  +TI+E +++   TK T  D ++ A
Sbjct: 1031 NAAAEDQATD-----RAHRIGQKRDVTVYKLIEHDTIEERIVKLQETKHTFVDQIIGA 1083


>gi|228917853|ref|ZP_04081390.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228841789|gb|EEM86899.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 855

 Score = 73.6 bits (179), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRTKGESFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 822 EMLERKQSLNNAVITS 837


>gi|228930248|ref|ZP_04093256.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228829389|gb|EEM75018.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 855

 Score = 73.2 bits (178), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 822 EMLERKQSLNNAVITS 837


>gi|229199361|ref|ZP_04326026.1| Helicase, SNF2/RAD54 [Bacillus cereus m1293]
 gi|228584075|gb|EEK42228.1| Helicase, SNF2/RAD54 [Bacillus cereus m1293]
          Length = 855

 Score = 73.2 bits (178), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKDVLEKHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 822 EMLERKQSLNNAVITS 837


>gi|330797032|ref|XP_003286567.1| hypothetical protein DICPUDRAFT_97424 [Dictyostelium purpureum]
 gi|325083472|gb|EGC36924.1| hypothetical protein DICPUDRAFT_97424 [Dictyostelium purpureum]
          Length = 1281

 Score = 73.2 bits (178), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 120/485 (24%), Positives = 217/485 (44%), Gaps = 104/485 (21%)

Query: 26  MGSGKTVSVLTALSYIH--LWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
           MG GKTV  +  +S+++  +   +  LV+APL    S W+SE  RWS    +++ V  G 
Sbjct: 503 MGLGKTVQTIAFISFLYERMNVREPFLVVAPLSTI-SNWSSEFIRWS--PKLHVIVYKGK 559

Query: 84  VKQRTKVLKT-PAVLYVINFENLGWLVQELK--GTWPFATIVVDESTKLKSFRLRQGSKT 140
            ++R +V +  P   +V+   +  +++++    G   +  I++DE  ++K+    + SK 
Sbjct: 560 QEERKEVFRQIPKNGFVVIITSFEYIIKDKNRLGKLDWVYIIIDEGHRIKN----KNSKL 615

Query: 141 ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQS-------FVARW 193
           +  L +  ++S+  + LTGTP  N L +LW  + FL     L  +F S       F A +
Sbjct: 616 SLQLRQ--YKSKHRLLLTGTPLQNDLSELWALLNFL-----LPSIFNSADTFEHWFNAPF 668

Query: 194 FNTTQIGSHIG---------------AVRYTAKETAQKEIEAQLSD-------CCLS-LD 230
            N ++  S I                 +R+      + ++E+QL D       C LS L 
Sbjct: 669 QNQSKSKSLINVNEEEQLIIINRLHQVLRFFLLRRLKSDVESQLPDKKEKVIKCNLSALQ 728

Query: 231 IADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLAN 290
           IA Y++     L+   V    P  K+     R     ++G     FN+  K ++  ++ N
Sbjct: 729 IAMYRS-----LVEYGVLPVDPDSKE----GRAGRLKMKG-----FNNIVKQLQ--KICN 772

Query: 291 GAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAP--IIVAYHFNSDLARLQKAFP 342
               + EE  W +++++ I++      ++ I+ K +A+   +++       +  +++ F 
Sbjct: 773 HPYLFKEE--W-DINEDLIRSSGKFDTMDQILTKMHASKHRVLIFTQMTEVINLMEEYFS 829

Query: 343 ---------QGRTLDKDPC-TIQEWNEGKIP----LLFAHPASCGHGLNLQYGGNILVFF 388
                     G T  ++    + EWN    P    +L  H  + G G+NLQ    +++F 
Sbjct: 830 LKEWTYLRLDGSTKPEERAHLVVEWNRPDSPFWIFVLSTH--AGGLGMNLQTADTVIIFD 887

Query: 389 SLW---WDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
           S W    DL + Q    RIG T         AV VY LI+ N+I+E +L+R   K  I  
Sbjct: 888 SDWNPQMDL-QAQDRCHRIGQT--------NAVNVYRLISANSIEEKILERATDKLEIDA 938

Query: 446 LLLNA 450
            ++ A
Sbjct: 939 KIIQA 943


>gi|229141981|ref|ZP_04270506.1| Helicase, SNF2/RAD54 [Bacillus cereus BDRD-ST26]
 gi|228641270|gb|EEK97576.1| Helicase, SNF2/RAD54 [Bacillus cereus BDRD-ST26]
          Length = 855

 Score = 73.2 bits (178), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKDVLEKHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 822 EMLERKQSLNNAVITS 837


>gi|229158809|ref|ZP_04286867.1| Helicase, SNF2/RAD54 [Bacillus cereus ATCC 4342]
 gi|228624793|gb|EEK81562.1| Helicase, SNF2/RAD54 [Bacillus cereus ATCC 4342]
          Length = 855

 Score = 73.2 bits (178), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 822 EMLERKQSLNNAVITS 837


>gi|196036261|ref|ZP_03103659.1| putative helicase [Bacillus cereus W]
 gi|218906422|ref|YP_002454256.1| putative helicase [Bacillus cereus AH820]
 gi|195991053|gb|EDX55023.1| putative helicase [Bacillus cereus W]
 gi|218539910|gb|ACK92308.1| putative helicase [Bacillus cereus AH820]
          Length = 918

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|228936530|ref|ZP_04099326.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228823118|gb|EEM68954.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
          Length = 855

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 200/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI  +       L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIIENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 822 EMLERKQSLNNAVITS 837


>gi|49481223|ref|YP_039235.1| SNF2 family helicase [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|49332779|gb|AAT63425.1| SNF2 family helicase [Bacillus thuringiensis serovar konkukian str.
           97-27]
          Length = 918

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKDVLEKHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|47569742|ref|ZP_00240415.1| helicase, SNF2/RAD54 family [Bacillus cereus G9241]
 gi|47553593|gb|EAL11971.1| helicase, SNF2/RAD54 family [Bacillus cereus G9241]
          Length = 918

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|229094348|ref|ZP_04225422.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock3-42]
 gi|228689026|gb|EEL42851.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock3-42]
          Length = 855

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 200/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI  +       L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIIENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 822 EMLERKQSLNNAVITS 837


>gi|254724328|ref|ZP_05186112.1| putative helicase [Bacillus anthracis str. A1055]
          Length = 918

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|196039505|ref|ZP_03106810.1| putative helicase [Bacillus cereus NVH0597-99]
 gi|196029665|gb|EDX68267.1| putative helicase [Bacillus cereus NVH0597-99]
          Length = 918

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|229032866|ref|ZP_04188821.1| Helicase, SNF2/RAD54 [Bacillus cereus AH1271]
 gi|228728411|gb|EEL79432.1| Helicase, SNF2/RAD54 [Bacillus cereus AH1271]
          Length = 855

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 105/494 (21%), Positives = 200/494 (40%), Gaps = 94/494 (19%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L+     +   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNLS-----ANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLL 448
           + L  K ++ + ++
Sbjct: 822 EMLERKQSLNNAVI 835


>gi|228948966|ref|ZP_04111239.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228810722|gb|EEM57070.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
          Length = 855

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 104/496 (20%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   ++    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVILTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 822 EMLERKQSLNNAVITS 837


>gi|30265272|ref|NP_847649.1| helicase, putative [Bacillus anthracis str. Ames]
 gi|47530804|ref|YP_022153.1| helicase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49188082|ref|YP_031335.1| helicase [Bacillus anthracis str. Sterne]
 gi|65317216|ref|ZP_00390175.1| COG0553: Superfamily II DNA/RNA helicases, SNF2 family [Bacillus
           anthracis str. A2012]
 gi|165870042|ref|ZP_02214699.1| putative helicase [Bacillus anthracis str. A0488]
 gi|167636534|ref|ZP_02394830.1| putative helicase [Bacillus anthracis str. A0442]
 gi|167641825|ref|ZP_02400066.1| putative helicase [Bacillus anthracis str. A0193]
 gi|170689422|ref|ZP_02880614.1| putative helicase [Bacillus anthracis str. A0465]
 gi|170708948|ref|ZP_02899380.1| putative helicase [Bacillus anthracis str. A0389]
 gi|177654075|ref|ZP_02936085.1| putative helicase [Bacillus anthracis str. A0174]
 gi|190567743|ref|ZP_03020655.1| putative helicase [Bacillus anthracis Tsiankovskii-I]
 gi|227818007|ref|YP_002818016.1| putative helicase [Bacillus anthracis str. CDC 684]
 gi|229602583|ref|YP_002869461.1| putative helicase [Bacillus anthracis str. A0248]
 gi|254686332|ref|ZP_05150191.1| putative helicase [Bacillus anthracis str. CNEVA-9066]
 gi|254735172|ref|ZP_05192881.1| putative helicase [Bacillus anthracis str. Western North America
           USA6153]
 gi|254737051|ref|ZP_05194756.1| putative helicase [Bacillus anthracis str. Western North America
           USA6153]
 gi|254744378|ref|ZP_05202058.1| putative helicase [Bacillus anthracis str. Kruger B]
 gi|254755680|ref|ZP_05207713.1| putative helicase [Bacillus anthracis str. Vollum]
 gi|254759588|ref|ZP_05211613.1| putative helicase [Bacillus anthracis str. Australia 94]
 gi|30259950|gb|AAP29135.1| putative helicase [Bacillus anthracis str. Ames]
 gi|47505952|gb|AAT34628.1| putative helicase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49182009|gb|AAT57385.1| helicase, putative [Bacillus anthracis str. Sterne]
 gi|164714365|gb|EDR19885.1| putative helicase [Bacillus anthracis str. A0488]
 gi|167510237|gb|EDR85642.1| putative helicase [Bacillus anthracis str. A0193]
 gi|167528066|gb|EDR90866.1| putative helicase [Bacillus anthracis str. A0442]
 gi|170126113|gb|EDS95008.1| putative helicase [Bacillus anthracis str. A0389]
 gi|170666649|gb|EDT17420.1| putative helicase [Bacillus anthracis str. A0465]
 gi|172080958|gb|EDT66037.1| putative helicase [Bacillus anthracis str. A0174]
 gi|190561159|gb|EDV15132.1| putative helicase [Bacillus anthracis Tsiankovskii-I]
 gi|227003185|gb|ACP12928.1| putative helicase [Bacillus anthracis str. CDC 684]
 gi|229266991|gb|ACQ48628.1| putative helicase [Bacillus anthracis str. A0248]
          Length = 918

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|206976890|ref|ZP_03237792.1| SNF2 family helicase [Bacillus cereus H3081.97]
 gi|206744856|gb|EDZ56261.1| SNF2 family helicase [Bacillus cereus H3081.97]
          Length = 918

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKDVLEKHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|257069450|ref|YP_003155705.1| DNA/RNA helicase, superfamily II, SNF2 family [Brachybacterium
            faecium DSM 4810]
 gi|256560268|gb|ACU86115.1| DNA/RNA helicase, superfamily II, SNF2 family [Brachybacterium
            faecium DSM 4810]
          Length = 1110

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 118/474 (24%), Positives = 196/474 (41%), Gaps = 53/474 (11%)

Query: 2    NLAPHQTKIVDWI---LDHKRCAIWAS-MGSGKTVSVLTALSYIH--LWGEKSVLVIAPL 55
             L P+Q +   W+     H    + A  MG GKT+  L  +++       E   LV+AP 
Sbjct: 647  ELRPYQREGYAWLTFLFSHGLGGVLADDMGLGKTLQTLALVAHARERSASEPPFLVVAPA 706

Query: 56   RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTP---AVLYVINFENLGWLVQEL 112
             V   VW  E +R++    + + V+  TV  R   L T    A L V ++  L    +E 
Sbjct: 707  SVL-PVWRREAERFA--PGLEVRVLDRTVAARGTDLPTAMLGADLVVTSYSVLRIDEEEF 763

Query: 113  KGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQ 172
              T  F   V+DE+  +K+ R    S+T RA AK      R + +TGTP  N L DLW  
Sbjct: 764  ASTR-FQGFVLDEAQFVKNRR----SRTHRA-AKGVRAGFR-LAITGTPMENSLDDLWAI 816

Query: 173  IWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIA 232
            +  +  G  LG     F  R+    + G H G +     E  ++ +   L      L  A
Sbjct: 817  LDLVAPGL-LGTAI-GFRKRYTLPIETGDHPGRM-----ELLRRRVRPFLLRRTKELVAA 869

Query: 233  DYQNIDKPILITKKVPLPQPVMKQYHKFQRE-----LYCDLQGENIEAFNSASKTVKCLQ 287
            +     + +L        + V     + +R+     +  DL       F S +  ++ + 
Sbjct: 870  ELPEKHEEVLTVTLGAEHRAVYDSVLQRERKKVLGLIDTDLDRSRFIVFRSLT-LLRMMA 928

Query: 288  LANGAVYYDEEKHWKEVHDEKIKALEVIIEK--ANAAPIIVAYHFN-------SDLAR-- 336
            L    V   + + + +V   K++AL   +E+   +   +++   F        S+L R  
Sbjct: 929  LDPSLV---DPEAYADVPSSKLEALFDRLEEVIGDGHRVLLFSQFTSYLDQVASELERRE 985

Query: 337  LQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEE 396
            ++ A   G T D+D   +  + EG  P+      + G GL L    + +     WW+   
Sbjct: 986  VRYAHLDGSTRDRD-AAVAGFREGDAPVFLISLKAGGFGLTLTE-ADYVFLLDPWWNPAA 1043

Query: 397  HQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
              Q ++     R  + G  R V VY +IA++TI+E VL   R K+ + D L + 
Sbjct: 1044 ENQAVD-----RAHRIGQDRTVMVYRMIAEDTIEEKVLALQRRKAELFDALTDG 1092


>gi|217962731|ref|YP_002341307.1| SNF2 family helicase [Bacillus cereus AH187]
 gi|222098706|ref|YP_002532764.1| helicase, putative [Bacillus cereus Q1]
 gi|217063978|gb|ACJ78228.1| SNF2 family helicase [Bacillus cereus AH187]
 gi|221242765|gb|ACM15475.1| helicase, putative [Bacillus cereus Q1]
          Length = 918

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKDVLEKHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|42784409|ref|NP_981656.1| helicase, putative [Bacillus cereus ATCC 10987]
 gi|42740341|gb|AAS44264.1| helicase, putative [Bacillus cereus ATCC 10987]
          Length = 918

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGEPFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKDVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|301056711|ref|YP_003794922.1| SNF2 family helicase [Bacillus anthracis CI]
 gi|300378880|gb|ADK07784.1| SNF2 family helicase [Bacillus cereus biovar anthracis str. CI]
          Length = 918

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 200/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI  +       L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIIENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|118480284|ref|YP_897435.1| SNF2 family helicase [Bacillus thuringiensis str. Al Hakam]
 gi|196045586|ref|ZP_03112816.1| putative helicase [Bacillus cereus 03BB108]
 gi|118419509|gb|ABK87928.1| SNF2 family helicase [Bacillus thuringiensis str. Al Hakam]
 gi|196023417|gb|EDX62094.1| putative helicase [Bacillus cereus 03BB108]
          Length = 918

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 104/496 (20%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTP--AVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   ++    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDSLQSADVILTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|288802766|ref|ZP_06408204.1| SNF2/helicase domain protein [Prevotella melaninogenica D18]
 gi|288334916|gb|EFC73353.1| SNF2/helicase domain protein [Prevotella melaninogenica D18]
          Length = 1343

 Score = 72.4 bits (176), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 108/440 (24%), Positives = 187/440 (42%), Gaps = 48/440 (10%)

Query: 26   MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK 85
            MG GKTV  +  L  +      + L++AP  V  + W +E+QR++    +N++++  +  
Sbjct: 917  MGLGKTVQTIALL--LEQSENGASLIVAPSSVVPN-WRNELQRFA--PTLNLTILNQSED 971

Query: 86   QRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
            +   + +  A   +I    L  + Q+      +  + +DE+  +K+   +  SK A  L 
Sbjct: 972  RSKDIKEAKAGDVIITTYGLLNIQQDDLTGREWNVVCLDEAHTIKNANTKM-SKAAMLL- 1029

Query: 146  KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGA 205
                +++  + LTGTP  N L +LW    F++ G  LG   Q F  ++         I  
Sbjct: 1030 ----KAQHKVILTGTPIQNHLAELWNLFQFINPG-LLGSAEQ-FRKKF---------ILP 1074

Query: 206  VRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK-PILITKKVP--LPQPVMKQYHKFQR 262
            +     +  Q ++   +S   L    A+   ID+ P     K+P  L    M  Y   +R
Sbjct: 1075 IEGDNDKARQSQLRRLISPFLLRRTKAEV--IDELPAKNEIKLPVELSSEEMAMYEVKRR 1132

Query: 263  ELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAA 322
            E    +     +  ++ ++     Q+A      D  K WK +   K+ A   + E  N +
Sbjct: 1133 ETEAKILENKADKVSTLAEITHLRQMACSCSLVD--KRWK-LPSSKVLAFIDLAESLNDS 1189

Query: 323  P--IIVAYHFNSDLARLQKAFPQGRT--LDKDPCT--------IQEWNEGKIPLLFAHPA 370
                +V   F S    ++KA    +   L  D  T        ++E+  GK P       
Sbjct: 1190 GNRALVFSQFTSFFEEIKKAMETAKLPYLYLDGSTPMSMREKLVKEFQSGKCPFFLISLK 1249

Query: 371  SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTID 430
            + G GLNL  G N ++    WW+       IE+    R  + G K+ V VY LI+Q+TI+
Sbjct: 1250 AGGLGLNLT-GANYVIHLDPWWN-----PAIEQQATDRAYRIGQKQDVTVYRLISQHTIE 1303

Query: 431  ELVLQRLRTKSTIQDLLLNA 450
            E +L+  +TK  + D LL  
Sbjct: 1304 EKILRLHKTKRNLSDSLLEG 1323


>gi|324329191|gb|ADY24451.1| helicase, putative [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 918

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 200/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K + +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKNIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKDVLEKHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|326798632|ref|YP_004316451.1| SNF2-related protein [Sphingobacterium sp. 21]
 gi|326549396|gb|ADZ77781.1| SNF2-related protein [Sphingobacterium sp. 21]
          Length = 1176

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 103/442 (23%), Positives = 193/442 (43%), Gaps = 46/442 (10%)

Query: 25   SMGSGKTVSVLTALSYIHLWGEKSV--LVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG 82
             MG GKT+ VLT L Y ++    S   L++ P  +  + W  EV++++   H ++ V  G
Sbjct: 743  DMGLGKTLQVLTLLDYHYMQTPDSAASLIVVPNTLLFN-WQQEVKKFT--PHRSVLVHHG 799

Query: 83   TVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTAR 142
             + +  ++   P  L +  +  L   ++ L     F+ +++DES  +K+       ++ R
Sbjct: 800  -LNRAAEIGCKPGQLILTTYGTLTTDIEMLSNKR-FSYLILDESQAIKN------PQSKR 851

Query: 143  ALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSH 202
                 + +S+  + LTGTP  NG+ DL+ Q+ F++ G  LG   Q      F  +  G  
Sbjct: 852  FDCAQSIQSDYRLALTGTPIENGISDLFAQLDFVNPG-FLGTYGQ------FKRSFPGIA 904

Query: 203  IGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQR 262
             G+     KE+ Q+ I   +     +    D     + IL    +P  + V ++Y ++ R
Sbjct: 905  DGSASDETKESLQRIIAPFMLRRTKTQVAKDLPEKTEMILYCDMLPEQRRVYEKYLQYFR 964

Query: 263  -ELYCDL-QGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKAL-EVIIEKA 319
             EL   + +G +          +K  Q+ N      +E +    H  K++ + E I+EK 
Sbjct: 965  GELANKIEEGRDKATMFVLEALMKLRQICNSPAILPKETYPN--HSSKLEEIQEHILEKT 1022

Query: 320  NAAPIIVAYHFNSDLARLQ---------KAFPQGRT----LDKDPCTIQEWNEGKIPLLF 366
                +++   F S L  L+          A+  G+T      ++    QE ++ ++ L+ 
Sbjct: 1023 QGHKLLIFSSFTSMLGLLKIELEKMGIAYAYLDGKTSGEQRQQEVTRFQEQDDCRVFLI- 1081

Query: 367  AHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQ 426
                + G GLNL    + +     WW+     Q I+R       + G ++ V  Y +I +
Sbjct: 1082 -SLKAGGTGLNLT-AADYVYILDPWWNPAAEAQAIDRC-----YRIGQEKHVMAYRMICK 1134

Query: 427  NTIDELVLQRLRTKSTIQDLLL 448
            +TI+E +L     K  + D L+
Sbjct: 1135 DTIEEKILNMQANKKALADSLI 1156


>gi|256846855|ref|ZP_05552310.1| SWF/SNF family helicase [Fusobacterium sp. 3_1_36A2]
 gi|256717821|gb|EEU31379.1| SWF/SNF family helicase [Fusobacterium sp. 3_1_36A2]
          Length = 899

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 99/468 (21%), Positives = 193/468 (41%), Gaps = 80/468 (17%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D+   A  A  MG GKT+  +  LS +H   +K  +VI P  +  + W +E++R+S 
Sbjct: 459 YLTDNNLGACLADDMGLGKTLQAIALLSKVHEEKKKKSMVIMPKSLIYN-WENEIKRFS- 516

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
              + + +  G  +  + + K   +L        G +  +++      F  +++DES  +
Sbjct: 517 -PKLKVGIYYGINRDFSSLKKVDIILTT-----YGTIRNDIESLLKQKFDLLILDESQNI 570

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +++ + L+GTP  N L++L+    FL+  +  G V Q F
Sbjct: 571 KNI----NSQTTKAVL--LLNAKKRVALSGTPIENNLLELYSLFRFLN-PEMFGSV-QEF 622

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
              +    Q  S    +    K+         +KE+ A L D    L   D    DK   
Sbjct: 623 TNDYIVPIQKYSDTSTIEELRKKIYPFLLRRVKKEVLADLPDKIEKLVYVDMN--DKH-- 678

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGEN------------IEAFNSASKTVKCLQLAN 290
                       +++++ +R+ Y  L  +N            ++A N     V   +L N
Sbjct: 679 ------------RRFYEERRKYYYSLLEKNTSSQGNFDKFFVLQAINELRHIVSSPELEN 726

Query: 291 GAVYYDEEKHWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ------ 343
             +          +  +K   +E +IE   N   ++V  ++ S +  +  +  +      
Sbjct: 727 KKI----------ISSKKEVLIENVIEAIENNHKVLVFVNYLSSIESICDSLKENKIKYL 776

Query: 344 ---GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM 400
              G+T D+     +  N+ +  +      + G GLNL     I ++   WW+       
Sbjct: 777 KMTGQTKDRQNLVDKFQNDSRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----TT 830

Query: 401 IERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           +E   + R  + G  + VF Y +I +NTI+E +L+    K+ + D L+
Sbjct: 831 VENQAIDRAYRLGQDKTVFAYKMIMRNTIEEKILKLQEIKNKLLDDLI 878


>gi|229124753|ref|ZP_04253933.1| Helicase, SNF2/RAD54 [Bacillus cereus 95/8201]
 gi|228658730|gb|EEL14390.1| Helicase, SNF2/RAD54 [Bacillus cereus 95/8201]
          Length = 855

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 104/496 (20%), Positives = 200/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI  +       L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIIENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L ++   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEDELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 822 EMLERKQSLNNAVITS 837


>gi|34763541|ref|ZP_00144479.1| SWF/SNF family helicase [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
 gi|27886790|gb|EAA23925.1| SWF/SNF family helicase [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
          Length = 899

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 99/468 (21%), Positives = 193/468 (41%), Gaps = 80/468 (17%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D+   A  A  MG GKT+  +  LS +H   +K  +VI P  +  + W +E++R+S 
Sbjct: 459 YLTDNNLGACLADDMGLGKTLQAIALLSKVHEEKKKKSMVIMPKSLIYN-WENEIKRFS- 516

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
              + + +  G  +  + + K   +L        G +  +++      F  +++DES  +
Sbjct: 517 -PKLKVGIYYGINRDFSSLKKVDIILTT-----YGTIRNDIESLLKQKFDLLILDESQNI 570

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +++ + L+GTP  N L++L+    FL+  +  G V Q F
Sbjct: 571 KNI----NSQTTKAVL--LLNAKKRVALSGTPIENNLLELYSLFRFLN-PEMFGSV-QEF 622

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
              +    Q  S    +    K+         +KE+ A L D    L   D    DK   
Sbjct: 623 TNDYIVPIQKYSDTSTIEELRKKIYPFLLRRVKKEVLADLPDKIEKLVYVDMN--DKH-- 678

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGEN------------IEAFNSASKTVKCLQLAN 290
                       +++++ +R+ Y  L  +N            ++A N     V   +L N
Sbjct: 679 ------------RRFYEERRKYYYSLLEKNTSSQGNFDKFFVLQAINELRHIVSSPELEN 726

Query: 291 GAVYYDEEKHWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ------ 343
             +          +  +K   +E +IE   N   ++V  ++ S +  +  +  +      
Sbjct: 727 KKI----------ISSKKEVLIENVIEAIENNHKVLVFVNYLSSIESICDSLKENKIKYL 776

Query: 344 ---GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM 400
              G+T D+     +  N+ +  +      + G GLNL     I ++   WW+       
Sbjct: 777 KMTGQTKDRQNLVDKFQNDSRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----TT 830

Query: 401 IERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           +E   + R  + G  + VF Y +I +NTI+E +L+    K+ + D L+
Sbjct: 831 VENQAIDRAYRLGQDKTVFAYKMIMRNTIEEKILKLQEIKNKLLDDLI 878


>gi|194466323|ref|ZP_03072310.1| Non-specific serine/threonine protein kinase [Lactobacillus reuteri
            100-23]
 gi|194453359|gb|EDX42256.1| Non-specific serine/threonine protein kinase [Lactobacillus reuteri
            100-23]
          Length = 1162

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 114/475 (24%), Positives = 204/475 (42%), Gaps = 61/475 (12%)

Query: 3    LAPHQTKIVDWILD----HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
            L P+Q   V W++     H    +   MG GKT+ ++T L  +   G    L++AP  V 
Sbjct: 704  LRPYQYDGVQWLMALMKYHFGGLLADEMGLGKTLQIITVL--LSEQGNGQNLIVAPAAVI 761

Query: 59   QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVL--KTPAVLYVINFENLGWLVQELKGTW 116
             + W  E+ +++    + ++V+ G+  +R K     T   + + +++     +   +G  
Sbjct: 762  YN-WQDEINKFA--PDLKVTVLDGSKAERRKQFAQSTERDIIITSYDAAKRDIDFYEGHV 818

Query: 117  PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
             F   V+DE+  +K+       +TA A    A  +++   LTGTP  N L +LW    +L
Sbjct: 819  -FNIEVIDEAQYIKN------PQTAAAKTVKAINAKQRFALTGTPIENRLSELWSIFDYL 871

Query: 177  DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
              G  LG  +Q F  ++          G +     + AQ +++  +    L     D  N
Sbjct: 872  MPG-FLGS-YQQFRKQY---------EGPIIKNQDDQAQDDLKRLVQPFMLRRLKKDVLN 920

Query: 237  IDKPILITKKVPLPQPVMKQYHKFQ---RELYCDLQGENIEAFNSA-----SKTVKCLQL 288
             D P +  ++V L   V KQ   +Q   + L   +Q +N E F        ++  +  +L
Sbjct: 921  -DLP-MKNEQVFLTPMVGKQESLYQARAQRLIRQIQKQNDEEFQQNKLAVLAEITRLREL 978

Query: 289  ANGAVYYDEEKHWKEVHDEKIKALEVII--EKANAAPIIVAYHFNSDLARLQKAFP---- 342
                   D           KIKA   +I  E A+   I++   F S LA L++       
Sbjct: 979  CCSPQLLDRGYSGPS---GKIKATMNLIKDEVADNHKILLFSQFTSALAILKEKLAKAGI 1035

Query: 343  -----QGRTLDKDPCT-IQEWNEGKIPLLF-AHPASCGHGLNLQYGGNILVFFSLWWDLE 395
                 +G+T   D    + E+N    P +F     + G GLNL    ++++ F  WW++ 
Sbjct: 1036 KYFVIEGKTKKADRLQFVDEFNSYDQPAVFLISLKAGGTGLNLT-SADVVIHFDPWWNIA 1094

Query: 396  EHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
               Q  +R       + G K  V +Y +IAQNTI+E +++  + K+ + + +L+ 
Sbjct: 1095 AENQATDRA-----HRIGQKNNVTIYKMIAQNTIEEKIIEMQQKKAALANSILSG 1144


>gi|294786039|ref|ZP_06751326.1| Snf2 family protein [Fusobacterium sp. 3_1_27]
 gi|294486376|gb|EFG33739.1| Snf2 family protein [Fusobacterium sp. 3_1_27]
          Length = 899

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 99/468 (21%), Positives = 193/468 (41%), Gaps = 80/468 (17%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D+   A  A  MG GKT+  +  LS +H   +K  +VI P  +  + W +E++R+S 
Sbjct: 459 YLTDNNLGACLADDMGLGKTLQAIALLSKVHEEKKKKSMVIMPKSLIYN-WENEIKRFS- 516

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
              + + +  G  +  + + K   +L        G +  +++      F  +++DES  +
Sbjct: 517 -PKLKVGIYYGINRDFSSLKKVDIILTT-----YGTIRNDIESLLKQKFDLLILDESQNI 570

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +++ + L+GTP  N L++L+    FL+  +  G V Q F
Sbjct: 571 KNI----NSQTTKAVL--LLNAKKRVALSGTPIENNLLELYSLFRFLN-PEMFGSV-QEF 622

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
              +    Q  S    +    K+         +KE+ A L D    L   D    DK   
Sbjct: 623 TNDYIVPIQKYSDTSTIEELRKKIYPFLLRRVKKEVLADLPDKIEKLVYVDMN--DKH-- 678

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGEN------------IEAFNSASKTVKCLQLAN 290
                       +++++ +R+ Y  L  +N            ++A N     V   +L N
Sbjct: 679 ------------RRFYEERRKYYYSLLEKNTSSQGNFDKFFVLQAINELRHIVSSPELEN 726

Query: 291 GAVYYDEEKHWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ------ 343
             +          +  +K   +E +IE   N   ++V  ++ S +  +  +  +      
Sbjct: 727 KKI----------ISSKKEVLIENVIEAIENNHKVLVFVNYLSSIESICDSLKENKIKYL 776

Query: 344 ---GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM 400
              G+T D+     +  N+ +  +      + G GLNL     I ++   WW+       
Sbjct: 777 KMTGQTKDRQNLVDKFQNDSRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----TT 830

Query: 401 IERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           +E   + R  + G  + VF Y +I +NTI+E +L+    K+ + D L+
Sbjct: 831 VENQAIDRAYRLGQDKTVFAYKMIMRNTIEEKILKLQEIKNKLLDDLI 878


>gi|52140319|ref|YP_086511.1| SNF2 family helicase [Bacillus cereus E33L]
 gi|51973788|gb|AAU15338.1| SNF2 family helicase [Bacillus cereus E33L]
          Length = 918

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 104/496 (20%), Positives = 201/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L ++   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEDELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 774

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 775 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 830

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 831 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 884

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 885 EMLERKQSLNNAVITS 900


>gi|237740914|ref|ZP_04571395.1| SWF/SNF family helicase [Fusobacterium sp. 4_1_13]
 gi|229431211|gb|EEO41423.1| SWF/SNF family helicase [Fusobacterium sp. 4_1_13]
          Length = 899

 Score = 71.6 bits (174), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 99/468 (21%), Positives = 193/468 (41%), Gaps = 80/468 (17%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D+   A  A  MG GKT+  +  LS +H   +K  +VI P  +  + W +E++R+S 
Sbjct: 459 YLTDNNLGACLADDMGLGKTLQAIALLSKVHEEKKKKSMVIMPKSLIYN-WENEIKRFS- 516

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
              + + +  G  +  + + K   +L        G +  +++      F  +++DES  +
Sbjct: 517 -PKLKVGIYYGINRDFSSLKKVDIILTT-----YGTIRNDIESLLKQKFDLLILDESQNI 570

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +++ + L+GTP  N L++L+    FL+  +  G V Q F
Sbjct: 571 KNI----NSQTTKAVL--LLNAKKRVALSGTPIENNLLELYSLFRFLN-PEMFGSV-QEF 622

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
              +    Q  S    +    K+         +KE+ A L D    L   D    DK   
Sbjct: 623 TNDYIVPIQKYSDTSTIEELRKKIYPFLLRRVKKEVLADLPDKIEKLVYVDMN--DKH-- 678

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGEN------------IEAFNSASKTVKCLQLAN 290
                       +++++ +R+ Y  L  +N            ++A N     V   +L N
Sbjct: 679 ------------RRFYEERRKYYYSLLEKNTSSQGNFDKFFVLQAINELRHIVSSPELEN 726

Query: 291 GAVYYDEEKHWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ------ 343
             +          +  +K   +E +IE   N   ++V  ++ S +  +  +  +      
Sbjct: 727 KKI----------ISSKKEVLIENVIEAIENNHKVLVFVNYLSSIESICDSLKENKIKYL 776

Query: 344 ---GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM 400
              G+T D+     +  N+ +  +      + G GLNL     I ++   WW+       
Sbjct: 777 KMTGQTKDRQNLVDKFQNDSRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----TT 830

Query: 401 IERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           +E   + R  + G  + VF Y +I +NTI+E +L+    K+ + D L+
Sbjct: 831 VENQAIDRAYRLGQDKTVFAYKMIMRNTIEEKILKLQEIKNKLLDDLI 878


>gi|229119309|ref|ZP_04248612.1| hypothetical protein bcere0017_55440 [Bacillus cereus Rock1-3]
 gi|228664175|gb|EEL19713.1| hypothetical protein bcere0017_55440 [Bacillus cereus Rock1-3]
          Length = 408

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 106/453 (23%), Positives = 194/453 (42%), Gaps = 56/453 (12%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAP--LRVA 58
           M L PHQ + ++   +H R A +  MG GKT           +  EK   +  P  L + 
Sbjct: 1   MKLFPHQDRALNDTYEHNRVAYYLDMGLGKTF----------VGSEKMWELNTPYNLLIC 50

Query: 59  QSVWTSEVQRWSNF--SHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           Q    S++  W      H +  VI    KQR + +   +VL ++N+E   W   EL    
Sbjct: 51  QK---SKIDDWKEHFEQHYDYEVIVFD-KQRMEEMPEESVL-IVNYER-AWRRDELLKLN 104

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F T+++DES+K+K+ + +Q     R  A      E  I L+GTP+     +LW Q+  L
Sbjct: 105 NF-TLMLDESSKIKNDKSKQTKFILRLNA------ENVILLSGTPTGGKYEELWSQLHLL 157

Query: 177 DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
                  R+ Q    + F   +        + T  +  ++ ++A+L     ++ +   + 
Sbjct: 158 G-----WRINQKLFLKQFVVQEWDDRNSKYKITGYKNVER-LKAKLKQYG-AVFMKTEEV 210

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
            D P     KV +P    K Y +F++    ++  E +     A+K +   QLA     Y+
Sbjct: 211 FDLPETTDVKVKIPGT--KLYKEFKKHHIVEIGEELLLGDTPAAKKLYLRQLAGS---YN 265

Query: 297 EEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQG-RTLDKDPCTIQ 355
           E          K++ ++ ++E  N   II+ Y+F  +   L     +   T++ +   + 
Sbjct: 266 E---------NKLQYVKDLVESTNDR-IIIFYNFKKEYEALVDLIDKPISTVNGNLKDLT 315

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
            + + +  +      +   GLNLQ   N +V+F+    L +  ++ E+    R  + G +
Sbjct: 316 AYEKFENSVTLIQYQAGAMGLNLQ-KANKIVYFT----LTDKSELFEQ-SKKRTHRIGQE 369

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           R  F YYL+   +I+  +L  L+ +    D+L 
Sbjct: 370 RPCFYYYLLTDGSIEWRMLDVLKERKDYTDVLF 402


>gi|116873076|ref|YP_849857.1| DNA/RNA helicase protein [Listeria welshimeri serovar 6b str.
            SLCC5334]
 gi|116741954|emb|CAK21078.1| DNA/RNA helicase protein [Listeria welshimeri serovar 6b str.
            SLCC5334]
          Length = 1072

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 100/462 (21%), Positives = 193/462 (41%), Gaps = 97/462 (20%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PDIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +  L    PF+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRIAEMEEIKHGHIYLISYPSLRQDIMNL-ADIPFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLR- 796

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQY-H 258
                       KE +  +I   +                +P L+ +   L Q V+K+   
Sbjct: 797  ---------KFKEISYDKIATMI----------------RPFLLRR---LKQDVVKELPD 828

Query: 259  KFQRELYCDLQGENIEAFNSASKTVKC-LQLANG-----------------AVYYDEEKH 300
            K +  LY +L  E    + +  + ++  L+ +NG                  +  D    
Sbjct: 829  KIETNLYSELTDEQKTIYLAYLEKIQADLEESNGNAGEERIKLLAGLTRLRQICCDPSLF 888

Query: 301  WKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARLQKAF-PQGRTL----DKDP 351
             +    E  K L++       + N   I++   F   LA +++    +G +L     K P
Sbjct: 889  VENYQGESGKLLQLFDTIQTARENGKRILIFSQFTGMLAIIRRKLEEEGHSLFYMDGKTP 948

Query: 352  C-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGV 406
                   +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E    
Sbjct: 949  AKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEEQAT 1002

Query: 407  TRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
             R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1003 GRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|227545238|ref|ZP_03975287.1| SNF2 helicase associated domain protein [Lactobacillus reuteri
            CF48-3A]
 gi|300909872|ref|ZP_07127333.1| non-specific serine/threonine protein kinase [Lactobacillus reuteri
            SD2112]
 gi|227184771|gb|EEI64842.1| SNF2 helicase associated domain protein [Lactobacillus reuteri
            CF48-3A]
 gi|300893737|gb|EFK87096.1| non-specific serine/threonine protein kinase [Lactobacillus reuteri
            SD2112]
          Length = 1161

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 114/475 (24%), Positives = 204/475 (42%), Gaps = 61/475 (12%)

Query: 3    LAPHQTKIVDWILD----HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
            L P+Q   V W++     H    +   MG GKT+ ++T L  +   G    L++AP  V 
Sbjct: 703  LRPYQYDGVQWLMALMKYHFGGLLADEMGLGKTLQIITVL--LSEQGNGQNLIVAPAAVI 760

Query: 59   QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVL--KTPAVLYVINFENLGWLVQELKGTW 116
             + W  E+++++    + ++V+ G+  +R K     T   + + +++     +   +G  
Sbjct: 761  YN-WQDEIKKFA--PDLKVTVLDGSKAERRKQFAQSTERDIIITSYDAAKRDIDFYEGHL 817

Query: 117  PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
             F   V+DE+  +K+       +TA A    A  +++   LTGTP  N L +LW    +L
Sbjct: 818  -FNIEVIDEAQYIKN------PQTAAAKTVKAINAKQRFALTGTPIENRLSELWSIFDYL 870

Query: 177  DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
              G  LG  +Q F  ++          G +       AQ +++  +    L     D  N
Sbjct: 871  MPG-FLGS-YQQFRKQY---------EGPIIKNQDNQAQDDLKRLVQPFMLRRLKKDVLN 919

Query: 237  IDKPILITKKVPLPQPVMKQYHKFQ---RELYCDLQGENIEAFNSA-----SKTVKCLQL 288
             D P +  ++V L   V KQ   +Q   + L   +Q +N E F        ++  +  +L
Sbjct: 920  -DLP-MKNEQVFLTPMVGKQESLYQARAQRLIRQIQKQNDEEFQQNKLAVLAEITRLREL 977

Query: 289  ANGAVYYDEEKHWKEVHDEKIKALEVII--EKANAAPIIVAYHFNSDLARLQKAFP---- 342
                   D           KIKA   +I  E A+   I++   F S LA L++       
Sbjct: 978  CCSPQLLDSGYSGPS---GKIKATMNLIKDEVADNHKILLFSQFTSALAILKEKLAKAGI 1034

Query: 343  -----QGRTLDKDPCT-IQEWNEGKIPLLF-AHPASCGHGLNLQYGGNILVFFSLWWDLE 395
                 +G+T   D    + E+N    P +F     + G GLNL    ++++ F  WW++ 
Sbjct: 1035 KYFVIEGKTKKADRLQFVDEFNSYDQPAVFLISLKAGGTGLNLT-SADVVIHFDPWWNIA 1093

Query: 396  EHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
               Q  +R       + G K  V +Y +IAQNTI+E +++  + K+ + + +L+ 
Sbjct: 1094 AENQATDRA-----HRIGQKNNVTIYKMIAQNTIEEKIIEMQQKKAALANSILSG 1143


>gi|325110937|ref|YP_004272005.1| SNF2-related protein [Planctomyces brasiliensis DSM 5305]
 gi|324971205|gb|ADY61983.1| SNF2-related protein [Planctomyces brasiliensis DSM 5305]
          Length = 1120

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 98/442 (22%), Positives = 175/442 (39%), Gaps = 47/442 (10%)

Query: 25   SMGSGKTVSVLTALS--YIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG 82
             MG GKTV +L  LS  Y  +      L++ P  +  + W  E++R++   H++     G
Sbjct: 690  DMGLGKTVQILAFLSHRYERMPDHDPTLIVVPKSLLFN-WRREIERFT--PHLSALEYAG 746

Query: 83   TVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTAR 142
              +   +       + ++ +  L   +  LK  + F  +++DE+  +K+     GS+ A+
Sbjct: 747  VSRSALRSTFGQHDIILMTYATLRRDIMSLK-DFQFDCVILDEAQAIKN----PGSQVAK 801

Query: 143  ALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGR--VFQSFVARWFNTTQIG 200
            A       + + + L+GTP  N L D+W    FL+ G  LGR  VF+S      +     
Sbjct: 802  ATR--LLHARQRLALSGTPIENHLGDMWSIFEFLNPG-LLGRSSVFKSLSNETDSQRLTE 858

Query: 201  SHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKF 260
            +  G ++       ++++ A L D        D    +  +            +K+Y++ 
Sbjct: 859  AVAGGLKPFVLRRTKEKVAADLPDRIEETLYCDLGPAETKLYDE---------LKEYYRN 909

Query: 261  QRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEK-------------HWKEVHDE 307
                  D QG      +     ++  Q A      D  K             H +E+  E
Sbjct: 910  SIFTLMDEQGLGKTKMHVLEALLRLRQAACHPGLLDSAKTGESSTKLDVLTEHLEELIAE 969

Query: 308  KIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFA 367
              K L  +  +  +   IV  H   D A +   +  G T D+D       N+  IP+   
Sbjct: 970  NHKTL--VFSQFTSLLAIVKNHL--DKANIPYVYLDGSTKDRDAVVQTFQNDKDIPVFLI 1025

Query: 368  HPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN 427
               + G GLNL    + +     WW+       +E   + R  + G  R V  Y LIA+ 
Sbjct: 1026 SLKAGGLGLNLT-AADYVFLLDPWWN-----PAVEAQAIDRAHRVGQTRNVIAYRLIARG 1079

Query: 428  TIDELVLQRLRTKSTIQDLLLN 449
            TI+E + +  + K  + D +L+
Sbjct: 1080 TIEEKIAELQQNKRKLADAILS 1101


>gi|52082146|ref|YP_080937.1| putative helicase YwqA [Bacillus licheniformis ATCC 14580]
 gi|52787537|ref|YP_093366.1| YwqA [Bacillus licheniformis ATCC 14580]
 gi|319648023|ref|ZP_08002240.1| YwqA protein [Bacillus sp. BT1B_CT2]
 gi|52005357|gb|AAU25299.1| putative helicase YwqA [Bacillus licheniformis ATCC 14580]
 gi|52350039|gb|AAU42673.1| YwqA [Bacillus licheniformis ATCC 14580]
 gi|317389658|gb|EFV70468.1| YwqA protein [Bacillus sp. BT1B_CT2]
          Length = 921

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 116/492 (23%), Positives = 210/492 (42%), Gaps = 87/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRV 57
           L  +Q   ++W++  + C   A     MG GKT+ ++   +Y+   G+++  L+IAP  V
Sbjct: 448 LRAYQEDGLNWLIFLRNCGFGACLADDMGLGKTIQMIAYFAYLKEQGQQTPSLIIAPTSV 507

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP 117
             + W  E++ ++    +  ++  G  + + +  +T      I   + G    +      
Sbjct: 508 LGN-WQRELETFA--PGLTAALHYGPKRPKGEAFQTSYKDADIVLTSYGLAQSDFDDLSS 564

Query: 118 FA--TIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
            A   I +DE+  +K+   +Q S++ R L     +    I L+GTP  N L +LW    F
Sbjct: 565 VAWNCICLDEAQNIKNAHTKQ-SRSIRKL-----KGLHHIALSGTPMENRLTELWSIYDF 618

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           ++KG  LG +  SF  R+            V    K+  +K IE QL            Q
Sbjct: 619 MNKG-YLGSL-GSFHKRF------------VLPIEKDRDEKRIE-QL------------Q 651

Query: 236 NIDKPILI-----TKKVPLPQPVMKQYHKF------QRELYCDLQGENIEAFNS-ASKTV 283
            + KP L+      K+V L  P  ++  +F      Q  LY  L  +  E  +S A    
Sbjct: 652 QLIKPFLLRRTKQDKEVALNLPEKQEEKEFVPLSAEQASLYEQLVKDTFEHMSSLAGMQR 711

Query: 284 KCLQLA----------NGAVYYDEEK----HWKEVHDEKIKALEVIIEKANAAPIIVAYH 329
           K L L+          + A+Y  E      + + V  EK+  L   I +++ + +I   +
Sbjct: 712 KALILSMLGKLKQICGHPALYLKETGSELLNGRSVKLEKLLELTKTIRESDESCLIFTQY 771

Query: 330 FN-SDLAR--LQKAFPQG--------RTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNL 378
               D+ +  L+K+F +           L++D   ++++   + P+L     + G GLNL
Sbjct: 772 LGMGDMMKRLLEKSFGEPVKFLNGSLSKLERDKM-VEQFQNKEFPILILSLKAGGTGLNL 830

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   TI+E + Q L 
Sbjct: 831 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTIEEKIDQMLE 884

Query: 439 TKSTIQDLLLNA 450
           +K ++ D ++ +
Sbjct: 885 SKQSLNDQIIQS 896


>gi|229008128|ref|ZP_04165659.1| Helicase, SNF2/RAD54 [Bacillus mycoides Rock1-4]
 gi|228753134|gb|EEM02641.1| Helicase, SNF2/RAD54 [Bacillus mycoides Rock1-4]
          Length = 867

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 113/501 (22%), Positives = 195/501 (38%), Gaps = 104/501 (20%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKSV-----LVIA 53
           L P+Q   V+W+L  +     A     MG GK++  +T L Y+    EKS+     L+IA
Sbjct: 400 LRPYQEHGVEWLLYLRELGFGALLADDMGLGKSIQTITYLLYVK---EKSLQTGPALIIA 456

Query: 54  PLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQE 111
           P  V  + W  E +R++   H+ + +  G+ + +    K    +   V+    L  L +E
Sbjct: 457 PTSVLGN-WQKEFERFT--PHLQVQLHYGSNRSKGDSFKDFLQSTDVVLTSYALAQLDEE 513

Query: 112 LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWG 171
                 +  I++DE+  +K+ + +Q SK  R L     ++   I LTGTP  N L +LW 
Sbjct: 514 ELNAQCWDAIILDEAQNIKNPQTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWS 567

Query: 172 QIWFLDKG--KRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL 229
              FL+ G    LG+  + FV          + I   R  AK                  
Sbjct: 568 IFDFLNHGYLGSLGQFQRRFV----------TPIEKDRDEAK------------------ 599

Query: 230 DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEA 275
            I   Q    P L+ +        +    K +++ YC L GE              NIE 
Sbjct: 600 -IQQIQRFISPFLLRRTKQDQTVALNLPDKQEQKEYCPLTGEQASLYEQLVQDTLQNIEG 658

Query: 276 FNSASKT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAA 322
                +         K  Q+ N    Y +E+  K++    +K       +E I ++  + 
Sbjct: 659 LTGIERRGFILMMLSKLKQICNHPALYLKEEAPKDIVQRSMKTQTLMDLIENIKDQNESC 718

Query: 323 PIIVAY-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHP 369
            I   Y              F   +  L  + P+   +++D   I+++  G   +     
Sbjct: 719 LIFTQYIGMGNMLQKILEEKFGQRVLFLNGSVPK---IERDKM-IEQFQNGTYDIFILSL 774

Query: 370 ASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTI 429
            + G GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T+
Sbjct: 775 KAGGTGLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTL 828

Query: 430 DELVLQRLRTKSTIQDLLLNA 450
           +E + + L  K ++   ++ +
Sbjct: 829 EEKIDEMLERKQSLSSAIITS 849


>gi|229175913|ref|ZP_04303410.1| Helicase, SNF2/RAD54 [Bacillus cereus MM3]
 gi|228607507|gb|EEK64832.1| Helicase, SNF2/RAD54 [Bacillus cereus MM3]
          Length = 855

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 107/494 (21%), Positives = 199/494 (40%), Gaps = 94/494 (19%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  +     A     MG GK++  +T L YI     ++   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRTLGFGALLADDMGLGKSIQTITYLLYIKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + + +  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRAKGESFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L  PA      I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL--PA---NHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+ +  +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVSPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIIERSMKTSTLMELIENIKDQNESCLIFTQ 711

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             HF   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 712 YIGMGNMLKNVLEEHFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 767

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 768 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 821

Query: 435 QRLRTKSTIQDLLL 448
           + L  K ++ + ++
Sbjct: 822 EMLERKQSLNNAVI 835


>gi|328957397|ref|YP_004374783.1| putative ATP-binding SNF2 helicase or protein kinase [Carnobacterium
            sp. 17-4]
 gi|328673721|gb|AEB29767.1| putative ATP-binding SNF2 helicase or protein kinase [Carnobacterium
            sp. 17-4]
          Length = 1075

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 108/456 (23%), Positives = 205/456 (44%), Gaps = 84/456 (18%)

Query: 25   SMGSGKTVSVLT-ALSYIHLWGEKS-VLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG 82
             MG GKT+ V+T  LS I   GE    L++AP  +  + W  E+++++    +   VI+G
Sbjct: 646  DMGLGKTIQVITYILSEIEEKGENDPFLIVAPASLIYN-WHFEIEKFA--PSVESIVISG 702

Query: 83   TVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKT 140
            T ++R ++++   P  + + ++ +    V   K   PF+T+++DES  +K+      +KT
Sbjct: 703  TAEERMQLIENVKPNQVLITSYPSFRQDVVHYK-KMPFSTLILDESQMVKN----HNTKT 757

Query: 141  ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIG 200
            ++AL     + +RF  L+GTP  N + +LW              +FQ  +  +F + +  
Sbjct: 758  SQALRDLTIK-KRFA-LSGTPIENKIEELWA-------------IFQLIMPGFFPSIK-- 800

Query: 201  SHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVP--LPQPVMKQYH 258
                      K  + ++I   +    L       + I K +L  K++P  +   +  Q  
Sbjct: 801  --------KFKTLSNEQIAKMIRPFVL-------RRIKKDVL--KELPDKIETNLYSQMT 843

Query: 259  KFQRELYCD-LQ--GENIEAFNSASKTVKCLQLANG-----------AVYYDEEKHWKEV 304
            K Q+ +Y   LQ   E++ + N A      +++  G            ++ D+     E 
Sbjct: 844  KEQKTVYLAYLQRIQESVNSMNGAEFKKNRIEILAGLTRLRQICCDPKLFIDD----YEG 899

Query: 305  HDEKIKALEVIIEKA--NAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPC- 352
               K++ L+  I+ A  N   I++   F S LA ++K   +         G+T  K+   
Sbjct: 900  SSGKLEQLKETIQTARENGRRILIFSQFTSMLAIIEKELDEQEVETFYLSGQTKPKERIE 959

Query: 353  TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQA 412
             + ++N G+  +      + G GLNL  G ++++ + LWW+       +E     R  + 
Sbjct: 960  MVNKFNAGEKDVFLISLKAGGTGLNLT-GADMVILYDLWWN-----PAVEEQAAGRAHRI 1013

Query: 413  GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
            G K+ V V  LIA+ TI+E + Q  + K  + D ++
Sbjct: 1014 GQKKVVQVLRLIAEGTIEEKIDQLQQEKKALFDQII 1049


>gi|257463846|ref|ZP_05628233.1| SWF/SNF family helicase [Fusobacterium sp. D12]
 gi|317061380|ref|ZP_07925865.1| metal dependent hydrolase [Fusobacterium sp. D12]
 gi|313687056|gb|EFS23891.1| metal dependent hydrolase [Fusobacterium sp. D12]
          Length = 1134

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 101/459 (22%), Positives = 190/459 (41%), Gaps = 76/459 (16%)

Query: 17   HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN 76
            H    +   MG GKT+  +  L+ +H   +K  L+I P  +  + W  E++++S    + 
Sbjct: 698  HLGACLADDMGLGKTLQAIAILTKLHQGKKKKSLIIMPKSLIYN-WQGEIEKFS--PKLK 754

Query: 77   ISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQ 136
            + +  G  +    + K   +L    +  +   +  LK  + F  I++DES  +K+ +   
Sbjct: 755  VGIYYGNNRDLQVIQKQDVIL--TTYGTVRNDIVSLKELF-FDLIILDESQNIKNIQ--- 808

Query: 137  GSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNT 196
             S+T +A+     +++  I L+GTP  N L +L+    FL+ G  +    + F A +   
Sbjct: 809  -SQTTKAVM--LLQAQNRIALSGTPIENNLSELYSLFRFLNPG--MFGSLEEFNATYAFP 863

Query: 197  TQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPL 249
             Q  +++ AV+   K+         +KE+   L D            I+K I I      
Sbjct: 864  IQKENNLEAVQDLRKKIYPFILRRVKKEVLKDLPD-----------KIEKTIYIDM---- 908

Query: 250  PQPVMKQYHKFQRELYCDLQGENI-------------EAFNSASKTVKCLQLANGAVYYD 296
              P  K++++ +R  Y ++    I             +A N   +   C ++ N  +   
Sbjct: 909  -NPEHKKFYEERRNYYYNMIHAGIREKGLGKVQFFILQALNELRQITSCPEIKNAYI--- 964

Query: 297  EEKHWKEVHDEKI-KALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRT 346
                 KE+  E+I +A+E      N   ++V  ++   +  + K+  +         G T
Sbjct: 965  -SSSKKEMLLEQISEAVE------NDHKVLVFTNYIGSIDTICKSLEEQEIPYLSMTGST 1017

Query: 347  LDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGV 406
             D+     +     K  +      + G GLNL     I ++   WW+     + +E   +
Sbjct: 1018 KDRQQLVNKFQKNEKYKVFVMTLKTGGVGLNLTAADTIFIY-DPWWN-----KTVENQAI 1071

Query: 407  TRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
             R  + G  R VF Y LI ++TI+E +LQ    KS + D
Sbjct: 1072 DRAYRLGQDRTVFSYKLILKDTIEEKILQLQELKSKLLD 1110


>gi|228999987|ref|ZP_04159559.1| Helicase, SNF2/RAD54 [Bacillus mycoides Rock3-17]
 gi|228759929|gb|EEM08903.1| Helicase, SNF2/RAD54 [Bacillus mycoides Rock3-17]
          Length = 867

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 113/501 (22%), Positives = 195/501 (38%), Gaps = 104/501 (20%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKSV-----LVIA 53
           L P+Q   V+W+L  +     A     MG GK++  +T L Y+    EKS+     L+IA
Sbjct: 400 LRPYQEHGVEWLLYLRELGFGALLADDMGLGKSIQTITYLLYVK---EKSLQTGPALIIA 456

Query: 54  PLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQE 111
           P  V  + W  E +R++   H+ + +  G+ + +    K    +   V+    L  L +E
Sbjct: 457 PTSVLGN-WQKEFERFT--PHLQVQLHYGSNRSKGDSFKDFLQSTDVVLTSYALAQLDEE 513

Query: 112 LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWG 171
                 +  I++DE+  +K+ + +Q SK  R L     ++   I LTGTP  N L +LW 
Sbjct: 514 ELNAQCWDAIILDEAQNIKNPQTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWS 567

Query: 172 QIWFLDKG--KRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL 229
              FL+ G    LG+  + FV          + I   R  AK                  
Sbjct: 568 IFDFLNHGYLGSLGQFQRRFV----------TPIEKDRDEAK------------------ 599

Query: 230 DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEA 275
            I   Q    P L+ +        +    K +++ YC L GE              NIE 
Sbjct: 600 -IQQIQRFISPFLLRRTKQDQTVALNLPDKQEQKEYCPLTGEQASLYEQLVQDTLQNIEG 658

Query: 276 FNSASKT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAA 322
                +         K  Q+ N    Y +E+  K++    +K       +E I ++  + 
Sbjct: 659 LTGIERRGFILMMLSKLKQICNHPALYLKEEAPKDIVQRSMKTQTLMDLIENIKDQNESC 718

Query: 323 PIIVAY-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHP 369
            I   Y              F   +  L  + P+   +++D   I+++  G   +     
Sbjct: 719 LIFTQYIGMGNMLQKILEEKFGQRVLFLNGSVPK---IERDKM-IEQFQNGTYDIFILSL 774

Query: 370 ASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTI 429
            + G GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T+
Sbjct: 775 KAGGTGLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTL 828

Query: 430 DELVLQRLRTKSTIQDLLLNA 450
           +E + + L  K ++   ++ +
Sbjct: 829 EEKIDEMLERKQSLSSAIITS 849


>gi|149198233|ref|ZP_01875280.1| swf/snf family helicase [Lentisphaera araneosa HTCC2155]
 gi|149138835|gb|EDM27241.1| swf/snf family helicase [Lentisphaera araneosa HTCC2155]
          Length = 1308

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 111/467 (23%), Positives = 189/467 (40%), Gaps = 54/467 (11%)

Query: 3    LAPHQTKIVDWILDHKRCAIWAS-------MGSGKTVSVLTALSYIHLWGEKSVLVIAPL 55
            L  +Q +   W+    R A W +       MG GKTV  L  LS     G    LV+AP 
Sbjct: 856  LRSYQEEGFQWL---SRMAEWGAGACLADDMGLGKTVQALAVLSARAHLGPS--LVVAPT 910

Query: 56   RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT 115
             V  + W  EVQR++    + + +   T  +          L V ++  L   V EL   
Sbjct: 911  SVCGN-WQEEVQRFA--PMLKVQIYDSTFAESAMESLDENDLLVCSYTMLQRDV-ELISK 966

Query: 116  WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
              +  IV+DE+  +K+       ++ R+ A  + ES+  I  TGTP  N   ++W    F
Sbjct: 967  RQWNGIVLDEAQAIKN------PQSGRSKAARSLESKFKIATTGTPVENHPGEIWALFDF 1020

Query: 176  LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
            L+ G  LG   Q+   +  N+  +   I  +    +   Q  I  +L    L       +
Sbjct: 1021 LNPG-YLGS--QTSFGKEINSAGVSQAINGLGERLRRRVQPFILRRLKKDVL-------K 1070

Query: 236  NIDKPILITKKVPLPQPVMKQYHKFQRELYCDL---QGENIEAFNSASKTVKCLQLANGA 292
            ++ +   I  ++PL       Y+  +      L    G+  + F    +  +  Q A   
Sbjct: 1071 DLPERTEINLRIPLSPDERGVYNGLRARASDRLGKRGGDRNDKFFILEEITRLRQAACSP 1130

Query: 293  VYYDEEKHWKEVHDEKIKALEVIIEKANAA-PIIVAYHFNSDLARLQKAFPQ-------- 343
               D  K + +   +  + +E++ E   A    +V   F S L  ++KA  +        
Sbjct: 1131 SLLD--KQFSDQSAKLKRFIELVKELKEAGHRALVFSQFTSFLDLVEKALAEEDVDFLRL 1188

Query: 344  -GRT-LDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMI 401
             G T   K P  ++++  GK  +      + G GLNL    N ++    WW+       +
Sbjct: 1189 DGSTPAKKRPQLVKKFQVGKSSVFLISLKAGGFGLNLT-AANYVIHLDPWWN-----PAV 1242

Query: 402  ERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
            E     R  + G ++AV VY LI++ TI+E +L+   +K  + D +L
Sbjct: 1243 EDQATDRAHRIGQEKAVTVYRLISEGTIEEKILKLHESKRELADFML 1289


>gi|319650819|ref|ZP_08004956.1| hypothetical protein HMPREF1013_01562 [Bacillus sp. 2_A_57_CT2]
 gi|317397417|gb|EFV78118.1| hypothetical protein HMPREF1013_01562 [Bacillus sp. 2_A_57_CT2]
          Length = 939

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 103/479 (21%), Positives = 196/479 (40%), Gaps = 59/479 (12%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLR 56
           +L P+Q   + W+L  +R    A     MG GKT+ +++ L  +    +    L++ P  
Sbjct: 471 DLRPYQKLGMSWLLFLRRYGFGAILADDMGLGKTIQLISYLLKVKKEEDSGPSLIVCPTS 530

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG-- 114
           V  + W  E++R++    MN+ +  G+ + + +      +   I   + G    +L+   
Sbjct: 531 VLGN-WQKEIERFA--PGMNVYLHYGSNRLKGESFSEKVMESDIVLTSYGLTHMDLEDFE 587

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +++I +DE+  +K+ + +Q S+  R L     + +  I LTGTP  N L +LW    
Sbjct: 588 TIEWSSISIDEAQNIKNAQTKQ-SRAVRKL-----KGKHHIALTGTPMENRLTELWSIFD 641

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F + G  LG + Q F  R+    +       VR          +     D  ++L++ D 
Sbjct: 642 FTNHG-YLGSLGQ-FQKRYVLPIEKDDDKDKVRQLQAYIRPFLLRRTKKDEDVALNLPD- 698

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCL----QLAN 290
                 +   +  PL       Y +  ++ +   Q E +  F      ++ L    QL N
Sbjct: 699 -----KLEQKEYCPLTAEQASLYEQLVQDTFA--QIEKLSGFERKGLILQLLSRLKQLCN 751

Query: 291 GAVYYDEEKHWKEVHDEKIKALEV-------------------IIEKANAAPIIVAYHFN 331
               Y +E+  K V +  +K  ++                    IE  N    ++   F 
Sbjct: 752 HPALYLKEEKPKHVLERSVKLEKLSELVSAVHEQGESCLIFTQYIEMGNMIARLLKKQFG 811

Query: 332 SDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLW 391
            D+  L  + P+    ++D   I  + + + P+      + G GLNL    N ++ +  W
Sbjct: 812 FDVPFLNGSVPKQ---ERD-NMISRFQDHEFPVFLLSLKAGGTGLNLT-AANHVIHYDRW 866

Query: 392 WDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
           W+       +E     R  + G KR V V+ +IA  T++E +   L  K ++ D ++ +
Sbjct: 867 WN-----PAVENQATDRAYRIGQKRFVHVHKMIATGTLEEKIDAMLEKKQSLNDQIITS 920


>gi|149200413|ref|ZP_01877429.1| DEAD/DEAH box helicase-like protein [Lentisphaera araneosa HTCC2155]
 gi|149136482|gb|EDM24919.1| DEAD/DEAH box helicase-like protein [Lentisphaera araneosa HTCC2155]
          Length = 1041

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 119/488 (24%), Positives = 202/488 (41%), Gaps = 95/488 (19%)

Query: 3    LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLR 56
            L  +Q + + W ++ ++  + A     MG GKTV VL+ L  +   GE  K+VL++AP R
Sbjct: 587  LRDYQKQALAWFIEMRKLKLGACLADDMGLGKTVQVLSFLHMLLKQGELDKAVLIVAP-R 645

Query: 57   VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLK--TPAVLYVINFENLGWLVQELKG 114
                 W  E+QR+S     ++ V       R KVL   T   + +  +  L     +LK 
Sbjct: 646  SLLFNWEQEIQRFSP----SLQVFQYLGAGRKKVLDKLTQGQVLLTTYGTLMRDAVKLKE 701

Query: 115  TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
               F+  V DE+  +K+  L   SK+ R +      +E  I LTGTP  N L DLW    
Sbjct: 702  RV-FSICVADEAQAMKN-PLSMTSKSMRLI-----NAEFKIALTGTPVENNLGDLWSLFE 754

Query: 175  FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
            FL                  N   +G++        K  A+  ++A+    C   ++   
Sbjct: 755  FL------------------NPNLLGTY--------KHFAKTYLDAK----CSEKNLESL 784

Query: 235  QNIDKPILITKKVPLPQPVMKQY-HKFQRELYCDLQGE------NIEAFNSASKTVKCLQ 287
            +   +P+++ +K      V K+   K ++ LYC+L  E       + A+ S  K     +
Sbjct: 785  RQTIRPLMLRRK---KSEVAKELPPKTEQLLYCELGEEQEKIYREMHAYYSQEKQKDDKE 841

Query: 288  LANGAVY---------------YDEEKHWKEVHDEKIKALEVIIEK--ANAAPIIVAYHF 330
               G                  Y   + ++ +   KI  L   +E+  A+ A  ++   F
Sbjct: 842  TPGGKGNMLAALTRLRQVVCHPYLVNEDYRHIESAKINLLISQLEQVFASGAKALIFSQF 901

Query: 331  NSDLARLQKAFP---------QGRTLDKDPCTIQEWNEG-KIPLLFAHPASCGHGLNLQY 380
               L  +++A            G T D+    +QE+NE  K         + G GLNL  
Sbjct: 902  TQFLDLIEEAIQMNKWNYTRLDGSTKDRQ-VPVQEFNENEKCRFFLISLKAGGTGLNLTQ 960

Query: 381  GGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK 440
               + +    WW+     Q I+R       + G ++AV  Y ++A++TI++ +LQ    K
Sbjct: 961  AQYVYI-MDPWWNPAAESQAIDRA-----YRIGQEKAVSAYRIVAKDTIEDKLLQLQAEK 1014

Query: 441  ST-IQDLL 447
            S  +QD++
Sbjct: 1015 SQLVQDVV 1022


>gi|229112656|ref|ZP_04242192.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock1-15]
 gi|228670788|gb|EEL26096.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock1-15]
          Length = 856

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 201/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         ++++YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKVYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEKFGQLVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|294782979|ref|ZP_06748305.1| Snf2 family protein [Fusobacterium sp. 1_1_41FAA]
 gi|294481620|gb|EFG29395.1| Snf2 family protein [Fusobacterium sp. 1_1_41FAA]
          Length = 896

 Score = 70.5 bits (171), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 98/459 (21%), Positives = 189/459 (41%), Gaps = 62/459 (13%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D++  A  A  MG GKT+  +  +S  H   +K  +VI P  +  + W SE+++++ 
Sbjct: 456 YLTDNRLGACLADDMGLGKTLQAIALISKTHEEKKKRSMVIMPKSLIFN-WESEIKKFA- 513

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
             ++ I+V  G  ++ + + K   VL        G +  +++      F  +V+DES  +
Sbjct: 514 -PNLKIAVYYGINRELSILKKADVVLTT-----YGTIRNDIENLLKEKFDLLVLDESQNI 567

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +E+ + L+GTP  N L++L+    FL+  +  G V QSF
Sbjct: 568 KNI----NSQTTKAVL--LLNAEKRVALSGTPVENNLLELYSLFRFLN-PEMFGTV-QSF 619

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSL---DIADYQNIDK 239
              +    Q  S    +    K+         +KE+ A L D    L   D+ D      
Sbjct: 620 TNNYIIPIQKYSDTSTIEELRKKIYPFLLRRVKKEVLADLPDKIEKLVYVDMNDEHRKYY 679

Query: 240 PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEK 299
                    L +        F +          ++A N     V   +L N  +      
Sbjct: 680 EEKRKYYYSLLENNTSSQGTFDKFFV-------LQAINELRHIVSSPELDNNKI------ 726

Query: 300 HWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDK 349
               +  +K   +E +IE   N   +++  ++ S +  +  +  +         G+T D+
Sbjct: 727 ----ISSKKEVLIENVIEAIENDHKVLIFVNYLSSIESICNSLKENKIKFLKMTGQTKDR 782

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
                +  ++ +  +      + G GLNL     I ++   WW+     + +E   + R 
Sbjct: 783 QSLVDKFQSDNRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----KTVENQAIDRA 836

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
            + G  + VF Y +I +NTI+E +L+    K  + D L+
Sbjct: 837 YRLGQDKTVFAYKMIMRNTIEEKILKLQEIKDKLLDDLI 875


>gi|237721132|ref|ZP_04551613.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|229449967|gb|EEO55758.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
          Length = 578

 Score = 70.5 bits (171), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 114/490 (23%), Positives = 206/490 (42%), Gaps = 84/490 (17%)

Query: 1   MNLAPHQTKI--VDWILDHKRCAIWASMGSGKTVSVLTALSYIH----LWGEK-SVLVIA 53
           M L P++ ++  V + ++HKRC      G GKT+  + A+   H    ++GE   VLVI 
Sbjct: 103 MLLQPYEYQLEGVQYAIEHKRCFFGDQPGLGKTLQAICAVVKAHKEAPIYGESFPVLVIC 162

Query: 54  PLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQR-------TKVLKTPAV-LYVINFENL 105
           P  +  + W  E ++   F+ MN  ++    +Q         K   +P   +++ N+E+L
Sbjct: 163 PAALKVN-WQREFKK---FAGMNSIILDDRNRQSWQSFYECKKSDGSPLCEVFITNYESL 218

Query: 106 GWLV-----QELKGTWP----------FATIVVDESTKLKSFRLRQGSKTARALAKPAWE 150
                    +E K T            F ++++DES K KS + +Q SK    + K    
Sbjct: 219 NKFFVKAVNKESKLTMKSIAFDQRVSLFRSVIIDESHKCKSSKTQQ-SKYVEGICK---- 273

Query: 151 SERFI-ELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYT 209
            +R+I  LTGTP  N   DL  Q+  L + +  G  +  +V R+ +  +  S++  + + 
Sbjct: 274 GKRYIFALTGTPVVNNNTDLIQQLKILGRLEDFGG-YSRYVERYCDGPKQASNVKELNWR 332

Query: 210 AKETA-----QKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQREL 264
              T      + ++  QL D         Y  +D  I  TK+    +  M +Y K  +  
Sbjct: 333 LWNTCFFRREKSKVLTQLPD-----KTRQYLTVD--ITTTKEYKAAEADMVKYLKKYK-- 383

Query: 265 YCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKAL-EVIIEKANAAP 323
                       N++ + V+  +  NGAV    +   +     KIKA+ E + +  +   
Sbjct: 384 ------------NASDEQVQ--KSMNGAVMVQMQLLKQISARGKIKAVCEFVHDVIDGGE 429

Query: 324 IIVAYHFNSD-LARLQKAFPQGRTLDKDPCTIQE-------WNEGKIPLLFAHPASCGHG 375
            ++ + +  + +A L+K FP+  T+       Q+        N     L+  +  S G G
Sbjct: 430 KLILFGYLKEVVAELKKEFPKAVTVTGSDSVNQKQYAVDSFQNNPDCKLIILNFKSGGTG 489

Query: 376 LNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQ 435
           L L     +  F    W   + +Q  +R       + G K  V  YY + ++TID+ +  
Sbjct: 490 LTLTAASRV-AFIEFPWTFSDCEQAEDRA-----HRNGQKNNVNCYYFLGKDTIDKYMYD 543

Query: 436 RLRTKSTIQD 445
            ++TK  I +
Sbjct: 544 VIQTKKNIAN 553


>gi|228911082|ref|ZP_04074889.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis IBL 200]
 gi|228848586|gb|EEM93433.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis IBL 200]
          Length = 856

 Score = 70.5 bits (171), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 201/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ +++    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNREKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEQFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|253999373|ref|YP_003051436.1| DNA methylase N-4/N-6 domain-containing protein [Methylovorus sp.
           SIP3-4]
 gi|253986052|gb|ACT50909.1| DNA methylase N-4/N-6 domain protein [Methylovorus sp. SIP3-4]
          Length = 838

 Score = 70.5 bits (171), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 102/414 (24%), Positives = 174/414 (42%), Gaps = 51/414 (12%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSV-LVIAPLRVAQS 60
           NL PH   IV W L   R A++A+ G  KT + L  + +I L    ++ L+  PL V Q 
Sbjct: 29  NLKPHTRAIVQWALHGGRRAVFAAFGLHKTATQLEIMRHIGLQKPGTMRLITMPLGVRQE 88

Query: 61  VWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK-GTWPFA 119
                 +R+ +  H+ +  I    +     +     +Y+ N+E+    V+E K     F 
Sbjct: 89  FKREVTERFKDEHHIELKFIRSDAE-----IDDDRTVYMTNYES----VREGKINLGQFN 139

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIEL-TGTPSPN---GLIDLWGQIWF 175
              +DE++ L+S+    GSKT +    P +    F  + T TPSPN    LI   G +  
Sbjct: 140 AASLDEASVLRSY----GSKTYQEFL-PLFNHMEFKFVNTATPSPNRFKELIHYAGFLGI 194

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           +D G+ L R F+   ++  N  Q+  H  A  Y    +    I+   SD   S +  +  
Sbjct: 195 MDTGQALTRFFKRDSSQAGN-LQLHPHKEAEFYIWLHSWAIFIQ-HPSDLGFSDEGYELP 252

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGA--V 293
           ++D   +   +VP            Q  L+ D+    ++A ++  +     ++A  A  V
Sbjct: 253 DLD---VRYHEVPCDYQAAGADRDGQNLLFQDVS-MGVQAASAEKRNSMSARIAKAAEIV 308

Query: 294 YYDEEKH---WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKD 350
             D + H   W ++ DE+       I+K  A P  V+ + + DL   +K           
Sbjct: 309 AQDPDDHFIVWHDLEDERHA-----IQK--AIPNAVSVYGSQDLDEREK----------- 350

Query: 351 PCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERI 404
              I E+++GK  +L   P   G G N Q   +  +F  + +   +  Q I R+
Sbjct: 351 --RIVEFSDGKFSVLSTKPIIAGSGCNFQRHCHREIFAGIGFKFNDFIQAIYRV 402


>gi|293372914|ref|ZP_06619283.1| SNF2 family N-terminal domain protein [Bacteroides ovatus SD CMC
           3f]
 gi|298480929|ref|ZP_06999124.1| SNF2 family domain-containing protein [Bacteroides sp. D22]
 gi|292631982|gb|EFF50591.1| SNF2 family N-terminal domain protein [Bacteroides ovatus SD CMC
           3f]
 gi|298272952|gb|EFI14518.1| SNF2 family domain-containing protein [Bacteroides sp. D22]
          Length = 578

 Score = 70.1 bits (170), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 114/490 (23%), Positives = 205/490 (41%), Gaps = 84/490 (17%)

Query: 1   MNLAPHQTKI--VDWILDHKRCAIWASMGSGKTVSVLTALSYIH----LWGEK-SVLVIA 53
           M L P++ ++  V + ++HKRC      G GKT+  + A+   H    ++GE   VLVI 
Sbjct: 103 MLLQPYEYQLEGVQYAIEHKRCFFGDQPGLGKTLQAICAVVKAHKEAPIYGESFPVLVIC 162

Query: 54  PLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQR-------TKVLKTPAV-LYVINFENL 105
           P  +  + W  E ++   F+ MN  ++    +Q         K    P   +++ N+E+L
Sbjct: 163 PAALKVN-WQREFKK---FAGMNSIILDDRNRQSWQSFYECKKSDGNPLCEVFITNYESL 218

Query: 106 GWLV-----QELKGTWP----------FATIVVDESTKLKSFRLRQGSKTARALAKPAWE 150
                    +E K T            F ++++DES K KS + +Q SK    + K    
Sbjct: 219 NKFFVKAVNKESKLTMKSIAFDQRVSLFRSVIIDESHKCKSSKTQQ-SKYVEGICK---- 273

Query: 151 SERFI-ELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYT 209
            +R+I  LTGTP  N   DL  Q+  L + +  G  +  +V R+ +  +  S++  + + 
Sbjct: 274 GKRYIFALTGTPVVNNNTDLLQQLKILGRLEDFGG-YSRYVERYCDGPKQASNVKELNWR 332

Query: 210 AKETA-----QKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQREL 264
              T      + ++  QL D         Y  +D  I  TK+    +  M +Y K  +  
Sbjct: 333 LWNTCFFRREKSKVLTQLPD-----KTRQYLTVD--ITTTKEYKAAEADMVKYLKKYK-- 383

Query: 265 YCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKAL-EVIIEKANAAP 323
                       N++ + V+  +  NGAV    +   +     KIKA+ E + +  +   
Sbjct: 384 ------------NASDEQVQ--KSMNGAVMVQMQLLKQISARGKIKAVCEFVHDVIDGGE 429

Query: 324 IIVAYHFNSD-LARLQKAFPQGRTLDKDPCTIQE-------WNEGKIPLLFAHPASCGHG 375
            ++ + +  + +A L+K FP+  T+       Q+        N     L+  +  S G G
Sbjct: 430 KLILFGYLKEVVAELKKEFPKAVTVTGSDSVNQKQYAVDSFQNNPDCKLIILNFKSGGTG 489

Query: 376 LNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQ 435
           L L     +  F    W   + +Q  +R       + G K  V  YY + ++TID+ +  
Sbjct: 490 LTLTAASRV-AFIEFPWTFSDCEQAEDRA-----HRNGQKNNVNCYYFLGKDTIDKYMYD 543

Query: 436 RLRTKSTIQD 445
            ++TK  I +
Sbjct: 544 VIQTKKNIAN 553


>gi|228994365|ref|ZP_04154249.1| Helicase, SNF2/RAD54 [Bacillus pseudomycoides DSM 12442]
 gi|228765382|gb|EEM14052.1| Helicase, SNF2/RAD54 [Bacillus pseudomycoides DSM 12442]
          Length = 867

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 112/501 (22%), Positives = 195/501 (38%), Gaps = 104/501 (20%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKSV-----LVIA 53
           L P+Q   V+W+L  +     A     MG GK++  +T L Y+    E+S+     L+IA
Sbjct: 400 LRPYQEHGVEWLLYLRELGFGALLADDMGLGKSIQTITYLLYVK---ERSLQTGPALIIA 456

Query: 54  PLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQE 111
           P  V  + W  E +R++   H+ + +  G+ + +    K    +   V+    L  L +E
Sbjct: 457 PTSVLGN-WQKEFERFT--PHLQVQLHYGSNRSKGDSFKDFLQSTDVVLTSYALAQLDEE 513

Query: 112 LKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWG 171
                 +  I++DE+  +K+ + +Q SK  R L     ++   I LTGTP  N L +LW 
Sbjct: 514 ELNAQCWDAIILDEAQNIKNPQTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWS 567

Query: 172 QIWFLDKG--KRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL 229
              FL+ G    LG+  + FV          + I   R  AK                  
Sbjct: 568 IFDFLNHGYLGSLGQFQRRFV----------TPIEKDRDEAK------------------ 599

Query: 230 DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEA 275
            I   Q    P L+ +        +    K +++ YC L GE              NIE 
Sbjct: 600 -IQQIQRFISPFLLRRTKQDQTVALNLPDKQEQKEYCPLTGEQASLYEQLVQDTLQNIEG 658

Query: 276 FNSASKT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAA 322
                +         K  Q+ N    Y +E+  K++    +K       +E I ++  + 
Sbjct: 659 LTGIERRGFILMMLSKLKQICNHPALYLKEEAPKDIVQRSMKTQTLMDLIENIKDQNESC 718

Query: 323 PIIVAY-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHP 369
            I   Y              F   +  L  + P+   +++D   I+++  G   +     
Sbjct: 719 LIFTQYIGMGNMLQKILEEKFGQRVLFLNGSVPK---IERDKM-IEQFQNGTYDIFILSL 774

Query: 370 ASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTI 429
            + G GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T+
Sbjct: 775 KAGGTGLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTL 828

Query: 430 DELVLQRLRTKSTIQDLLLNA 450
           +E + + L  K ++   ++ +
Sbjct: 829 EEKIDEMLERKQSLSSAIITS 849


>gi|212640482|ref|YP_002317002.1| SWF/SNF family helicase [Anoxybacillus flavithermus WK1]
 gi|212561962|gb|ACJ35017.1| SWF/SNF family helicase [Anoxybacillus flavithermus WK1]
          Length = 898

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 119/482 (24%), Positives = 200/482 (41%), Gaps = 66/482 (13%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q + VDW++  ++          MG GKT+ +L  L+Y+    +++   L+I P  
Sbjct: 430 LRPYQQRGVDWLVFLRQLGFGGCLADDMGLGKTIQMLAYLAYVKENEKRNGPALLICPTS 489

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQR--TKVLKTPAVLYVINFENLGWLVQELKG 114
           V  + W  E Q++     + + V  G+ +    T V K  +   VI   +L  L  +   
Sbjct: 490 VIGN-WQKECQQF--VPSLTVYVHHGSNRGHGDTFVEKAKSCDLVITSYSLAHLDFDDLA 546

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  I +DE+  +K+ + +Q    ARA+ K   +    I LTGTP  N L +LW    
Sbjct: 547 SIDWDVICLDEAQNIKNAQTKQ----ARAIRK--LKGRHKIALTGTPIENRLNELWSIFH 600

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQL-----SDCCLSL 229
           FL+ G  LG   Q+   R F    I  +  A    A E  QK I   L     +D  ++L
Sbjct: 601 FLNPG-YLGS--QTEFQRRF-AAPIEKNGDA---QATEKLQKLIRPFLLRRTKTDERIAL 653

Query: 230 DIAD--YQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQ 287
           D+ D   Q    P+ + +     Q V +   K ++      +G  ++  NS        Q
Sbjct: 654 DLPDKLEQKEYCPLTVEQASLYEQIVQQSLEKLEQVDGFARRGIILQMLNSLK------Q 707

Query: 288 LANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVAY------------- 328
           L N    Y +EKH K++ +   K       +E I E   +  I   Y             
Sbjct: 708 LCNHPALYLKEKHPKQIVERSHKVEKLLELVEQIRENGESCLIFTQYIQMGEMIQHLLST 767

Query: 329 HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFF 388
           H    +  L  + P+ +T D+    I+++  G+  +      + G GLNL    N ++ F
Sbjct: 768 HLKETVVFLNGSTPK-QTRDE---MIEQFQNGQFHIFILSLKAGGTGLNLT-AANHVIHF 822

Query: 389 SLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
             WW+       +E     R  + G  + V V+  I   TI+E +   L  K  + + L+
Sbjct: 823 DRWWN-----PAVENQATDRAYRIGQTKFVHVHKFITTGTIEEKIDDMLEKKQALNEQLI 877

Query: 449 NA 450
            +
Sbjct: 878 QS 879


>gi|237745383|ref|ZP_04575864.1| SWF/SNF family helicase [Fusobacterium sp. 7_1]
 gi|229432612|gb|EEO42824.1| SWF/SNF family helicase [Fusobacterium sp. 7_1]
          Length = 899

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 98/458 (21%), Positives = 193/458 (42%), Gaps = 60/458 (13%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D+   A  A  MG GKT+  +  L+ +H   +K  +VI P  +  + W +E++R+S 
Sbjct: 459 YLTDNNLGACLADDMGLGKTLQAIALLTNLHEEKKKKSMVIMPKSLIYN-WENEIKRFS- 516

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
              + + V  G  +  + + K   +L        G +  +++      F  +V+DES  +
Sbjct: 517 -PKLKVGVYYGINRDFSLLKKVDIILTT-----YGTIRNDIENLLEQKFDLLVLDESQNI 570

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      S++ + L+GTP  N L++L+    FL+  +  G V Q F
Sbjct: 571 KNI----NSQTTKAVL--LLNSKKRVALSGTPIENNLLELYSLFRFLN-PEMFGSV-QEF 622

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
              +    Q  S    +    K+         +KE+ A L D    L   D  +      
Sbjct: 623 TNDYIVPIQKYSDTSTIEELRKKIYPFLLRRVKKEVLADLPDKIEKLVYVDMND------ 676

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASK--TVKCLQLANGAVYYDEEKH 300
                       +++++ +R+ Y  L  +N  +  +  K   ++ +      V   E + 
Sbjct: 677 ----------EHRRFYEERRKYYYSLLEKNTSSQGNFDKFFVLQAINELRHIVSSPELES 726

Query: 301 WKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKD 350
            K +  +K   +E +IE   N   ++V  ++ S +  +  +  +         G+T D+ 
Sbjct: 727 KKIISSKKEVLIENVIEAIENNHKVLVFVNYLSSIESICDSLKENKIKYLKMTGQTKDRQ 786

Query: 351 PCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 410
               +  N+ +  +      + G GLNL     I ++   WW+       +E   + R  
Sbjct: 787 NLVDKFQNDSRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----TTVENQAIDRAY 840

Query: 411 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           + G  + VF Y +I +NTI+E +L+    K+ + D L+
Sbjct: 841 RLGQDKTVFAYKMIMRNTIEEKILKLQEIKNKLLDDLI 878


>gi|218960404|ref|YP_001740179.1| hypothetical protein CLOAM0057 [Candidatus Cloacamonas
            acidaminovorans]
 gi|167729061|emb|CAO79972.1| hypothetical protein CLOAM0057 [Candidatus Cloacamonas
            acidaminovorans]
          Length = 1065

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 116/482 (24%), Positives = 206/482 (42%), Gaps = 93/482 (19%)

Query: 17   HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN 76
            H    +   MG GKT+  L+A+    L G+ S LVI P  +  + W +E+ ++    H N
Sbjct: 627  HLNGILADEMGLGKTIQALSAILSTTL-GQVS-LVICPKTLLYN-WAAEIDKF----HTN 679

Query: 77   I--SVITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFR 133
            I  +++ G    R ++L  P V L+++++  +   V  LK    F  IV+DE+  +K+  
Sbjct: 680  IPFAIVDGNKTTRMEILSNPNVQLFIMSYSMVLGDVAYLKNM-EFEWIVLDEAQNIKNVS 738

Query: 134  LRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKG--KRLGRVFQSFVA 191
             ++ S   +       +S+  + LTGTP  N L +LW    FL+ G    L +  Q+++ 
Sbjct: 739  AQRTSAIKKL------KSKHRLALTGTPIENNLTELWSIFDFLNPGYLGTLNKFKQNYLP 792

Query: 192  RWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY--QNIDKPILITKKVPL 249
                                  A+ EI A+LS   LS  +A +  + I K +L+      
Sbjct: 793  ----------------------AEGEITARLS---LSRMVAPFMLRRIKKDVLLELPDKQ 827

Query: 250  PQPVMKQYHKFQRELYCDL----------QGENIEAFNSASKTVKCLQ-------LANGA 292
             Q    + +  Q +LY  +          +G+ + ++      +  L+       LANG 
Sbjct: 828  EQISWCKLNTLQEKLYLQILDMVHKKLLPEGKEMPSYIHILAALTKLRQVCNHPHLANGD 887

Query: 293  VYYDEEKHWKEVHDEKIKALEVIIEKANAA-PIIVAYHFNSDLARLQK---------AFP 342
            +  + E   K       + LE++ E  NA   +++   F   L+ ++K          + 
Sbjct: 888  ILPELEASSKLE-----QLLELVTEATNAGHKVLIFSQFVQMLSIIRKVLEANSLPYCYL 942

Query: 343  QGRTLDK-DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMI 401
             G+T D+  P    E N  +I L      + G GLNL    + ++ +  WW+      M+
Sbjct: 943  DGQTKDRVTPIKSFETN-PEIKLFLISLKAGGTGLNLT-AADTVILYDPWWN-----PMV 995

Query: 402  ERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDL-------LLNALKKE 454
            E   + R  + G    V V+ LI + T++E +LQ  + K  + +        +L A+ KE
Sbjct: 996  ENQAIDRTHRIGQTHKVQVFRLITKGTVEEKILQLQQNKRELFETVIEGGQNVLKAMTKE 1055

Query: 455  TI 456
             I
Sbjct: 1056 DI 1057


>gi|163791108|ref|ZP_02185528.1| Snf2 family protein [Carnobacterium sp. AT7]
 gi|159873664|gb|EDP67748.1| Snf2 family protein [Carnobacterium sp. AT7]
          Length = 1075

 Score = 70.1 bits (170), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 106/456 (23%), Positives = 204/456 (44%), Gaps = 84/456 (18%)

Query: 25   SMGSGKTVSVLT-ALSYIHLWGEKS-VLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG 82
             MG GKT+ V+T  LS I   G+    L++AP  +  + W  E+++++    +   V++G
Sbjct: 646  DMGLGKTIQVITYMLSEIEEKGQNDPFLIVAPASLIYN-WHFEIEKFA--PSIESIVVSG 702

Query: 83   TVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKT 140
            T ++R ++++   P  + + ++ +    V   K + PF+T+++DES  +K+      +KT
Sbjct: 703  TAEERMQLIENVKPNQVLITSYPSFRQDVVHYKQS-PFSTLILDESQMVKN----HNTKT 757

Query: 141  ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIG 200
            ++AL     + +RF  L+GTP  N + +LW              +FQ  +  +F + +  
Sbjct: 758  SQALRDLTIK-KRFA-LSGTPIENKIEELWA-------------IFQLIMPGFFPSVK-- 800

Query: 201  SHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVP--LPQPVMKQYH 258
                      K    ++I   +    L       + I K +L  K++P  +   +  Q  
Sbjct: 801  --------KFKTLPNEQIAKMIRPFVL-------RRIKKDVL--KELPDKIETNLYSQMT 843

Query: 259  KFQRELYCD-LQ--GENIEAFNSASKTVKCLQLANG-----------AVYYDEEKHWKEV 304
            K Q+ +Y   LQ   E++ + N A      +++  G            ++ D+     E 
Sbjct: 844  KEQKTVYLAYLQRIQESVNSMNGAEFKKNRIEILAGLTRLRQICCDPKLFIDD----YEG 899

Query: 305  HDEKIKALEVIIEKA--NAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPC- 352
               K++ L+  ++ A  N   I++   F S LA ++K   Q         G+T  K+   
Sbjct: 900  DSGKLEQLKETVQTARENGRRILIFSQFTSMLAIIEKELAQQSVETFYLSGQTKPKERIE 959

Query: 353  TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQA 412
             +  +N G+  +      + G GLNL  G ++++ + LWW+       +E     R  + 
Sbjct: 960  MVNRFNAGEKEVFLISLKAGGTGLNLT-GADMVILYDLWWN-----PAVEEQAAGRAHRI 1013

Query: 413  GFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
            G K+ V V  LIA+ TI+E + Q  + K  + D ++
Sbjct: 1014 GQKKVVQVLRLIAEGTIEEKIDQLQQEKKALFDQII 1049


>gi|229147777|ref|ZP_04276120.1| Helicase, SNF2/RAD54 [Bacillus cereus BDRD-ST24]
 gi|228635790|gb|EEK92277.1| Helicase, SNF2/RAD54 [Bacillus cereus BDRD-ST24]
          Length = 856

 Score = 70.1 bits (170), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|237739928|ref|ZP_04570409.1| SWF/SNF family helicase [Fusobacterium sp. 2_1_31]
 gi|229421945|gb|EEO36992.1| SWF/SNF family helicase [Fusobacterium sp. 2_1_31]
          Length = 896

 Score = 70.1 bits (170), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 97/459 (21%), Positives = 189/459 (41%), Gaps = 62/459 (13%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D++  A  A  MG GKT+  +  +S  H   +K  +VI P  +  + W SE+++++ 
Sbjct: 456 YLTDNRLGACLADDMGLGKTLQAIALISKTHEEKKKRSMVIMPKSLIFN-WESEIKKFA- 513

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
             ++ I+V  G  ++ + + K   VL        G +  +++      F  +V+DES  +
Sbjct: 514 -PNLKIAVYYGINRELSILKKADVVLTT-----YGTIRNDIENLLKEKFDLLVLDESQNI 567

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +E+ + L+GTP  N L++L+    FL+  +  G V Q+F
Sbjct: 568 KNI----NSQTTKAVL--LLNAEKRVALSGTPVENNLLELYSLFRFLN-PEMFGTV-QNF 619

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSL---DIADYQNIDK 239
              +    Q  S    +    K+         +KE+ A L D    L   D+ D      
Sbjct: 620 TNNYIIPIQKYSDTSTIEELRKKIYPFLLRRVKKEVLADLPDKIEKLVYVDMNDEHRKYY 679

Query: 240 PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEK 299
                    L +        F +          ++A N     V   +L N  +      
Sbjct: 680 EEKRRYYYSLLENNTSSQGNFDKFFV-------LQAINELRHIVSSPELDNNKI------ 726

Query: 300 HWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDK 349
               +  +K   +E +IE   N   +++  ++ S +  +  +  +         G+T D+
Sbjct: 727 ----ISSKKEVLIENVIEAIENDHKVLIFVNYLSSIESICNSLKENKIKFLKMTGQTKDR 782

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
                +  ++ +  +      + G GLNL     I ++   WW+     + +E   + R 
Sbjct: 783 QSLVDKFQSDNRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----KTVENQAIDRA 836

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
            + G  + VF Y +I +NTI+E +L+    K  + D L+
Sbjct: 837 YRLGQDKTVFAYKMIMRNTIEEKILKLQEIKDKLLDDLI 875


>gi|229050914|ref|ZP_04194465.1| Helicase, SNF2/RAD54 [Bacillus cereus AH676]
 gi|228722459|gb|EEL73853.1| Helicase, SNF2/RAD54 [Bacillus cereus AH676]
          Length = 856

 Score = 70.1 bits (170), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|282880921|ref|ZP_06289612.1| SNF2 family N-terminal domain protein [Prevotella timonensis CRIS
            5C-B1]
 gi|281305144|gb|EFA97213.1| SNF2 family N-terminal domain protein [Prevotella timonensis CRIS
            5C-B1]
          Length = 1254

 Score = 70.1 bits (170), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 109/455 (23%), Positives = 189/455 (41%), Gaps = 80/455 (17%)

Query: 25   SMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
             MG GKT+  +T L  +        L++ P  +  + W  E+ R++    +N+ V+   V
Sbjct: 828  DMGLGKTLQTITLL--LEQAQSGPSLIVVPASLVPN-WRKELSRFA--PTLNVFVLNDEV 882

Query: 85   KQ--------RTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQ 136
             +        R +VL T   L  I+ + L       + +W    +V+DE+  +K+   + 
Sbjct: 883  NREQAIEQISRNEVLVTTYALLTIHQQQLS------QKSW--NVVVLDEAHTIKNPNTKM 934

Query: 137  GSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNT 196
             SK A  L     ++ER + LTGTP  N L +LW    F++ G  LG   Q F  ++   
Sbjct: 935  -SKAAMTL-----KAERKVILTGTPIQNHLSELWNLFQFINPG-LLGNAEQ-FKKKYI-- 984

Query: 197  TQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL-----------DIADYQNIDKPILITK 245
                          +E   KE + QL                  ++ +  +I+ P+ ++ 
Sbjct: 985  -----------IPIEENKNKERQGQLKKLISPFLLRRTKGEVIEELPEKNDINLPVELSD 1033

Query: 246  KVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVH 305
                 +  M + H+ + E    L  E ++  ++ S+  K  Q+A      D  K WK+  
Sbjct: 1034 N----ELAMYELHRKKAEELA-LAEEGVK-LSTLSEITKLRQMACSISLVD--KTWKKT- 1084

Query: 306  DEKIKALEVIIEKAN--AAPIIVAYHFNSDLARLQKAFPQ---------GRT-LDKDPCT 353
              K+     + E  N      +V   F S LA +++   +         G T + K    
Sbjct: 1085 SSKLSTFIALAESLNDSGGRALVFSQFTSFLAEVRQVMDKIKLPYLYLDGATPIKKREEI 1144

Query: 354  IQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAG 413
            + E+ +G  P       + G GLNL    N ++    WW+       IE+    R  + G
Sbjct: 1145 VDEFQKGNYPFFLISLKAGGLGLNLT-AANYVIHLDPWWN-----PAIEQQATDRAYRIG 1198

Query: 414  FKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
             +  V VY+LIAQ+TI+E +++  +TK  + D LL
Sbjct: 1199 QRNDVTVYHLIAQHTIEEKIIRLHKTKRDLADSLL 1233


>gi|228975316|ref|ZP_04135873.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228981952|ref|ZP_04142247.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis Bt407]
 gi|228778064|gb|EEM26336.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis Bt407]
 gi|228784449|gb|EEM32471.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
          Length = 855

 Score = 70.1 bits (170), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTP--AVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDSLQSADVVLTSYALAQLDEEELT 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKILMELIENIKDQNESCLIFTQ 711

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 712 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 771

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 772 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 825

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 826 RKQSLNNAVITS 837


>gi|229130493|ref|ZP_04259449.1| Helicase, SNF2/RAD54 [Bacillus cereus BDRD-Cer4]
 gi|228652832|gb|EEL08714.1| Helicase, SNF2/RAD54 [Bacillus cereus BDRD-Cer4]
          Length = 856

 Score = 70.1 bits (170), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLIELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|256850404|ref|ZP_05555832.1| non-specific serine/threonine protein kinase [Lactobacillus crispatus
            MV-1A-US]
 gi|262046447|ref|ZP_06019409.1| non-specific serine/threonine protein kinase [Lactobacillus crispatus
            MV-3A-US]
 gi|312977470|ref|ZP_07789218.1| Snf2 family protein [Lactobacillus crispatus CTV-05]
 gi|256712801|gb|EEU27794.1| non-specific serine/threonine protein kinase [Lactobacillus crispatus
            MV-1A-US]
 gi|260573318|gb|EEX29876.1| non-specific serine/threonine protein kinase [Lactobacillus crispatus
            MV-3A-US]
 gi|310895901|gb|EFQ44967.1| Snf2 family protein [Lactobacillus crispatus CTV-05]
          Length = 1131

 Score = 70.1 bits (170), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 110/484 (22%), Positives = 215/484 (44%), Gaps = 79/484 (16%)

Query: 3    LAPHQTKIVDW---ILDHKRCAIWAS-MGSGKTVSVLTAL--SYIHLWGEKSVLVIAPLR 56
            L P+Q    +W   I+++K   + A  MG GKT+ +++ L      +  +   L++AP  
Sbjct: 669  LRPYQKIGFNWLSTIVNYKFGGLLADEMGLGKTLQIISLLLARKEKMQNQLPSLIVAPAS 728

Query: 57   VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG-- 114
            V  + W +EV++++    +N++++ GT K+R ++L   A  Y +   +   L ++L+   
Sbjct: 729  VIYN-WQAEVKKFA--PSLNVALLDGTKKERERLL-LDAKKYNLLISSYQSLNRDLEAYQ 784

Query: 115  TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
               F   V+DE+  +K+    Q S TA+ +     ++   + LTGTP  N L +LW    
Sbjct: 785  NLIFDVEVIDEAQNIKN----QQSVTAKTVK--VIKAHHKLALTGTPIENKLSELWSIFD 838

Query: 175  FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL----- 229
            +L  G  LG ++  F  ++         +  V+        KE E QL++  +       
Sbjct: 839  YLMPG-FLG-LYPDFRKKY--------ELPIVK-----EQDKEAEDQLANMIIPFILRRL 883

Query: 230  ------DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSA---- 279
                  D+ D      P+ + KK          Y+   +++   L G+  E F  +    
Sbjct: 884  KKDVLRDLPDKDEEIVPVKMNKKQA------DLYNMQTQKIIAQLNGQGDEDFKRSRFQI 937

Query: 280  -SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNS----- 332
             ++  K  ++        E  H K   ++ I  +E+I    AN   I++   F +     
Sbjct: 938  LAQITKLREICCDPHLLYENYHGKS--NKLIATIELIKNNLANGHKILLFSQFTAMLDIL 995

Query: 333  --DLARLQKAFPQGRTLDKDPCT-----IQEWNEGKIPLLF-AHPASCGHGLNLQYGGNI 384
              +LARL+   P        P T     +Q++N+   P +F     + G G+NL  G ++
Sbjct: 996  HENLARLR--LPLFTITGSTPKTKRQEQVQKFNQMAQPGVFLISLKAGGTGINLT-GADV 1052

Query: 385  LVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQ 444
            ++ +  WW+L   +Q        R  + G K +V +Y ++ +++I+E ++   + K+ + 
Sbjct: 1053 VIHYDPWWNLAAEKQ-----ATDRAHRIGQKHSVKIYKMVTEDSIEERIIALQQKKAELA 1107

Query: 445  DLLL 448
            D++L
Sbjct: 1108 DIIL 1111


>gi|229153405|ref|ZP_04281583.1| Helicase, SNF2/RAD54 [Bacillus cereus m1550]
 gi|228630009|gb|EEK86660.1| Helicase, SNF2/RAD54 [Bacillus cereus m1550]
          Length = 856

 Score = 69.7 bits (169), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFFQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEKFGQRVPFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|159898290|ref|YP_001544537.1| non-specific serine/threonine protein kinase [Herpetosiphon
            aurantiacus ATCC 23779]
 gi|159891329|gb|ABX04409.1| Non-specific serine/threonine protein kinase [Herpetosiphon
            aurantiacus ATCC 23779]
          Length = 1055

 Score = 69.7 bits (169), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 94/428 (21%), Positives = 176/428 (41%), Gaps = 44/428 (10%)

Query: 25   SMGSGKTVSVLTALSYIHLWGEKSV--LVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG 82
             MG+GKT+  L  L  +   G+ S   L++ P R     W  E+ RW+     ++ V+  
Sbjct: 622  DMGTGKTIQTLAFLQSLKARGQASASSLIVMP-RSLIFNWQREIARWTP----DLQVLVH 676

Query: 83   TVKQRTKVLKTPAVLYVINFENLGWLVQELK--GTWPFATIVVDESTKLKSFRLRQGSKT 140
            T + R   +   +  Y +     G L++++    T+ F  +V+DE+  +K+      S+T
Sbjct: 677  TDQGRPDTVAAFSD-YDLVLTTYGTLLRDIDLFATYQFHCLVLDEAQAIKN----PSSQT 731

Query: 141  ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRV--FQSFVARWFNTTQ 198
            ARA    A  ++  + LTGTP  N +++LW Q  FL+    LG +  F+S  A       
Sbjct: 732  ARA--ARALHADHRLTLTGTPVENSILELWSQFAFLNPSM-LGSLEHFRSEFATPIERDG 788

Query: 199  IGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYH 258
                   +R        +  + Q++         +    ++ ++     P  Q + ++Y 
Sbjct: 789  DQQTAQLLRRMVNPFILRRTKDQVA--------PELPPRNERLMYCDMEPAQQKLYQRYR 840

Query: 259  KFQRELYCDL---QGENIEAFNSASKTVKCLQLANGAVYYDEE-KHWKEVHDEKIKALEV 314
               R +   L   QG N          ++  Q+ N     +   +      D+ ++ LEV
Sbjct: 841  DQYRAMLLSLIDDQGINDSRIKVLEGLLRLRQICNHPQLVEATFRGHSAKFDQLLETLEV 900

Query: 315  IIEKANAAPIIVAYH-------FNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFA 367
            +  + + A I   +           D   L  A+  G+T ++     +   + +I     
Sbjct: 901  LHAEGHKALIFSQFVQMLTLLWKELDRRNLSYAYLDGKTNNRAAVVDRFQTDPQIHFFLI 960

Query: 368  HPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQN 427
               + G GLNL    + ++    WW+    QQ  +R       + G  + VF+Y LI +N
Sbjct: 961  SLKAGGVGLNLT-AADYVIHIDPWWNPAVEQQATDRT-----HRIGQDKPVFIYKLIVRN 1014

Query: 428  TIDELVLQ 435
            +++E +LQ
Sbjct: 1015 SVEEKILQ 1022


>gi|326943035|gb|AEA18931.1| SWF/SNF family helicase [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 918

 Score = 69.7 bits (169), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTP--AVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDSLQSADVVLTSYALAQLDEEELT 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKILMELIENIKDQNESCLIFTQ 774

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 775 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 834

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 835 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 888

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 889 RKQSLNNAVITS 900


>gi|228961502|ref|ZP_04123113.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228798216|gb|EEM45218.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar pakistani str.
           T13001]
          Length = 856

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|255974902|ref|ZP_05425488.1| Snf2 family protein [Enterococcus faecalis T2]
 gi|307278760|ref|ZP_07559826.1| protein, SNF2 family [Enterococcus faecalis TX0860]
 gi|255967774|gb|EET98396.1| Snf2 family protein [Enterococcus faecalis T2]
 gi|306504566|gb|EFM73770.1| protein, SNF2 family [Enterococcus faecalis TX0860]
          Length = 1065

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMSVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|229072708|ref|ZP_04205910.1| Helicase, SNF2/RAD54 [Bacillus cereus F65185]
 gi|229181505|ref|ZP_04308833.1| Helicase, SNF2/RAD54 [Bacillus cereus 172560W]
 gi|228602080|gb|EEK59573.1| Helicase, SNF2/RAD54 [Bacillus cereus 172560W]
 gi|228710684|gb|EEL62657.1| Helicase, SNF2/RAD54 [Bacillus cereus F65185]
          Length = 856

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|229193493|ref|ZP_04320440.1| Helicase, SNF2/RAD54 [Bacillus cereus ATCC 10876]
 gi|228590025|gb|EEK47897.1| Helicase, SNF2/RAD54 [Bacillus cereus ATCC 10876]
          Length = 856

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|228923978|ref|ZP_04087255.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228835777|gb|EEM81141.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
          Length = 856

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEQFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|228955491|ref|ZP_04117496.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228804283|gb|EEM50897.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
          Length = 856

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|229082458|ref|ZP_04214921.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock4-2]
 gi|228700890|gb|EEL53413.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock4-2]
          Length = 856

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|296505669|ref|YP_003667369.1| SWF/SNF family helicase [Bacillus thuringiensis BMB171]
 gi|296326721|gb|ADH09649.1| SWF/SNF family helicase [Bacillus thuringiensis BMB171]
          Length = 918

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 774

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 775 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 834

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 835 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 888

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 889 RKQSLNNAVITS 900


>gi|228968365|ref|ZP_04129360.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228791331|gb|EEM38938.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis serovar sotto str.
           T04001]
          Length = 856

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 201/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ +++    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLCVQLHYGSNREKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 713 YIGMGNMLKRVLEEQFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 772

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 773 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 826

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 827 RKQSLNNAVITS 838


>gi|293380595|ref|ZP_06626650.1| SNF2 family N-terminal domain protein [Lactobacillus crispatus 214-1]
 gi|290922842|gb|EFD99789.1| SNF2 family N-terminal domain protein [Lactobacillus crispatus 214-1]
          Length = 1175

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 110/484 (22%), Positives = 215/484 (44%), Gaps = 79/484 (16%)

Query: 3    LAPHQTKIVDW---ILDHKRCAIWAS-MGSGKTVSVLTAL--SYIHLWGEKSVLVIAPLR 56
            L P+Q    +W   I+++K   + A  MG GKT+ +++ L      +  +   L++AP  
Sbjct: 713  LRPYQKIGFNWLSTIVNYKFGGLLADEMGLGKTLQIISLLLARKEKMQNQLPSLIVAPAS 772

Query: 57   VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG-- 114
            V  + W +EV++++    +N++++ GT K+R ++L   A  Y +   +   L ++L+   
Sbjct: 773  VIYN-WQAEVKKFA--PSLNVALLDGTKKERERLL-LDAKKYNLLISSYQSLNRDLEAYQ 828

Query: 115  TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
               F   V+DE+  +K+    Q S TA+ +     ++   + LTGTP  N L +LW    
Sbjct: 829  NLIFDVEVIDEAQNIKN----QQSVTAKTVK--VIKAHHKLALTGTPIENKLSELWSIFD 882

Query: 175  FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL----- 229
            +L  G  LG ++  F  ++         +  V+        KE E QL++  +       
Sbjct: 883  YLMPG-FLG-LYPDFRKKY--------ELPIVK-----EQDKEAEDQLANMIIPFILRRL 927

Query: 230  ------DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSA---- 279
                  D+ D      P+ + KK          Y+   +++   L G+  E F  +    
Sbjct: 928  KKDVLRDLPDKDEEIVPVKMNKKQA------DLYNMQTQKIIAQLNGQGDEDFKRSRFQI 981

Query: 280  -SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNS----- 332
             ++  K  ++        E  H K   ++ I  +E+I    AN   I++   F +     
Sbjct: 982  LAQITKLREICCDPHLLYENYHGKS--NKLIATIELIKNNLANGHKILLFSQFTAMLDIL 1039

Query: 333  --DLARLQKAFPQGRTLDKDPCT-----IQEWNEGKIPLLF-AHPASCGHGLNLQYGGNI 384
              +LARL+   P        P T     +Q++N+   P +F     + G G+NL  G ++
Sbjct: 1040 HENLARLR--LPLFTITGSTPKTKRQEQVQKFNQMAQPGVFLISLKAGGTGINLT-GADV 1096

Query: 385  LVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQ 444
            ++ +  WW+L   +Q        R  + G K +V +Y ++ +++I+E ++   + K+ + 
Sbjct: 1097 VIHYDPWWNLAAEKQ-----ATDRAHRIGQKHSVKIYKMVTEDSIEERIIALQQKKAELA 1151

Query: 445  DLLL 448
            D++L
Sbjct: 1152 DIIL 1155


>gi|218233440|ref|YP_002370024.1| putative helicase [Bacillus cereus B4264]
 gi|218161397|gb|ACK61389.1| putative helicase [Bacillus cereus B4264]
          Length = 918

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 774

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 775 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 834

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 835 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 888

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 889 RKQSLNNAVITS 900


>gi|227878641|ref|ZP_03996558.1| Snf2 family helicase [Lactobacillus crispatus JV-V01]
 gi|256843239|ref|ZP_05548727.1| non-specific serine/threonine protein kinase [Lactobacillus crispatus
            125-2-CHN]
 gi|227861761|gb|EEJ69363.1| Snf2 family helicase [Lactobacillus crispatus JV-V01]
 gi|256614659|gb|EEU19860.1| non-specific serine/threonine protein kinase [Lactobacillus crispatus
            125-2-CHN]
          Length = 1175

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 110/484 (22%), Positives = 215/484 (44%), Gaps = 79/484 (16%)

Query: 3    LAPHQTKIVDW---ILDHKRCAIWAS-MGSGKTVSVLTAL--SYIHLWGEKSVLVIAPLR 56
            L P+Q    +W   I+++K   + A  MG GKT+ +++ L      +  +   L++AP  
Sbjct: 713  LRPYQKIGFNWLSTIVNYKFGGLLADEMGLGKTLQIISLLLARKEKMQNQLPSLIVAPAS 772

Query: 57   VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG-- 114
            V  + W +EV++++    +N++++ GT K+R ++L   A  Y +   +   L ++L+   
Sbjct: 773  VIYN-WQAEVKKFA--PSLNVALLDGTKKERERLL-LDAKKYNLLISSYQSLNRDLEAYQ 828

Query: 115  TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
               F   V+DE+  +K+    Q S TA+ +     ++   + LTGTP  N L +LW    
Sbjct: 829  NLIFDVEVIDEAQNIKN----QQSVTAKTVK--VIKAHHKLALTGTPIENKLSELWSIFD 882

Query: 175  FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL----- 229
            +L  G  LG ++  F  ++         +  V+        KE E QL++  +       
Sbjct: 883  YLMPG-FLG-LYPDFRKKY--------ELPIVK-----EQDKEAEDQLANMIIPFILRRL 927

Query: 230  ------DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSA---- 279
                  D+ D      P+ + KK          Y+   +++   L G+  E F  +    
Sbjct: 928  KKDVLRDLPDKDEEIVPVKMNKKQA------DLYNMQTQKIIAQLNGQGDEDFKRSRFQI 981

Query: 280  -SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNS----- 332
             ++  K  ++        E  H K   ++ I  +E+I    AN   I++   F +     
Sbjct: 982  LAQITKLREICCDPHLLYENYHGKS--NKLIATIELIKNNLANGHKILLFSQFTAMLDIL 1039

Query: 333  --DLARLQKAFPQGRTLDKDPCT-----IQEWNEGKIPLLF-AHPASCGHGLNLQYGGNI 384
              +LARL+   P        P T     +Q++N+   P +F     + G G+NL  G ++
Sbjct: 1040 HENLARLR--LPLFTITGSTPKTKRQEQVQKFNQMAQPGVFLISLKAGGTGINLT-GADV 1096

Query: 385  LVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQ 444
            ++ +  WW+L   +Q        R  + G K +V +Y ++ +++I+E ++   + K+ + 
Sbjct: 1097 VIHYDPWWNLAAEKQ-----ATDRAHRIGQKHSVKIYKMVTEDSIEERIIALQQKKAELA 1151

Query: 445  DLLL 448
            D++L
Sbjct: 1152 DIIL 1155


>gi|149200479|ref|ZP_01877493.1| hypothetical protein LNTAR_13447 [Lentisphaera araneosa HTCC2155]
 gi|149136441|gb|EDM24880.1| hypothetical protein LNTAR_13447 [Lentisphaera araneosa HTCC2155]
          Length = 1021

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 104/463 (22%), Positives = 196/463 (42%), Gaps = 44/463 (9%)

Query: 3    LAPHQTKIVDWILDHKRC---AIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
            L  +Q   + W+++ K     AI A  MG GKT+  L+ L+ +     +  L++ P  + 
Sbjct: 566  LRDYQVDGLHWLINMKNANCGAILADEMGLGKTIQTLSMLASLD--KTEPCLIVCPSSLM 623

Query: 59   QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP- 117
             + W  E +R++    M   +I+G   +R KV+      Y +   +   L +++      
Sbjct: 624  DN-WQKEAKRFT--PQMKTCIISGDSIERKKVIAERHE-YDMLITSYSLLRRDMDAYAKV 679

Query: 118  -FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
             F T+V+DE+  +K+ R  Q + + R+L     +++  + LTGTP  N   DLW    FL
Sbjct: 680  RFDTVVLDEAQHIKNHR-SQSALSCRSL-----QADSRLALTGTPLENSAADLWSVFEFL 733

Query: 177  DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQN 236
                 LG   ++F A  F   Q+       +Y A +  +  I  +L    L       + 
Sbjct: 734  SPS-LLGSK-KNFEAA-FKEDQVNPK---AQYIALKKLRPFILRRLKKDVLPQLPPKQEQ 787

Query: 237  IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYD 296
            + +  L  K+  L + + +    F +++  D    +    +  S   +  Q  +      
Sbjct: 788  VIEFTLSDKEQELYKNIAEN---FLQDILQDQTAFSKRRLDILSLITRLRQTCSHPALLP 844

Query: 297  EEKHWKEVHDEKIKALEVIIE--KANAAPIIVAYHFNSDLARLQK---------AFPQGR 345
            EE   KE+   K +  + ++E  + ++   +V   F S L+ +++          +  G 
Sbjct: 845  EEFKAKEIESSKFQLFQELVEEIRDSSHRALVFSQFTSMLSLMREWLDEQGIKYCYLDGS 904

Query: 346  TLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIG 405
            T  +     Q   +  I        + G GLNL  G + ++ +  WW+      M+    
Sbjct: 905  TKKRQDLVDQFNEDDSIQFFLLSLKAGGTGLNLT-GADTVIHYDNWWN-----PMVVNQA 958

Query: 406  VTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
              R  + G  R V +  L+AQNTI++ ++Q  +TK  + D L+
Sbjct: 959  SDRAHRIGQTRNVNIIKLVAQNTIEDKIIQLQKTKEKLFDQLV 1001


>gi|291547356|emb|CBL20464.1| Superfamily II DNA/RNA helicases, SNF2 family [Ruminococcus sp.
            SR1/5]
          Length = 1130

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 110/475 (23%), Positives = 192/475 (40%), Gaps = 104/475 (21%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---------KSVLVIAPLRVAQSVWTSEVQRWSNFSHM 75
             MG GKT+ VLT      LW E         +  LVI P  +  + W +E++R++    +
Sbjct: 692  DMGLGKTLQVLT-----FLWSEFQESAPGENRRALVITPASLVFN-WMNEIERFA--PGL 743

Query: 76   NISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG--TWPFATIVVDESTKLKSFR 133
              +V+TG VK+R  ++K      V+   +   L ++LK      FA  ++DE+  +K+  
Sbjct: 744  PATVVTGDVKERKALIKNAGEREVL-ITSYDLLKRDLKAYQNLDFAVQIIDEAQYIKN-- 800

Query: 134  LRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARW 193
               G++ A+A+ +    SE  + LTGTP  N L +LW    FL  G         F+  +
Sbjct: 801  --HGTQVAKAVKE--IRSEFRLALTGTPVENRLSELWSIFDFLMPG---------FLYSY 847

Query: 194  FNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPV 253
                              E  +KEIE        S  +   Q + +P ++ +   L + V
Sbjct: 848  ------------------EKFRKEIELPAVQYSSSNAMERLQKMIRPFVLRR---LKRDV 886

Query: 254  MKQY-HKFQRELYCDLQGENIEAFNSAS---------------KTVKCLQLAN------- 290
            +K    K +++++  L+ E  E + + +               +T K   LA        
Sbjct: 887  LKDLPDKLEKDMFSPLESEQKELYEAHTERFRLMLGMQSDAEFRTSKLQILAEITRLRQI 946

Query: 291  ----GAVYYDEEKHWKEVHDEKIKALEVIIEKANAA-PIIVAYHFNSDL----ARLQKA- 340
                G VY    + +K    +    +E++    N    I++   F + L     RL+KA 
Sbjct: 947  CCYPGLVY----EGYKGNSSKLEMCMELVQNAVNGGHKILLFSQFTTMLDVLAVRLKKAK 1002

Query: 341  -----FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLE 395
                      + +K    +  +NE    +      + G GLNL    +I++ +  WW+L 
Sbjct: 1003 VSFYMLTGSTSKEKRAQMVHAFNEDDTSVFCISLKAGGTGLNLT-AADIVIHYDPWWNLA 1061

Query: 396  EHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
               Q  +R       + G +  V VY L  ++TI+E +      K  + D +LN 
Sbjct: 1062 VQNQATDRA-----HRIGQQNVVSVYRLFMKDTIEERIRALQERKRELADEILNG 1111


>gi|258545090|ref|ZP_05705324.1| Snf2 family protein [Cardiobacterium hominis ATCC 15826]
 gi|258519667|gb|EEV88526.1| Snf2 family protein [Cardiobacterium hominis ATCC 15826]
          Length = 1017

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 99/459 (21%), Positives = 185/459 (40%), Gaps = 59/459 (12%)

Query: 3   LAPHQTKIVDWI--LDHKRCA--IWASMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLR 56
           L P+Q   +DW+  L   R    +   MG GKT+  L  L ++   GE  +  L++AP  
Sbjct: 558 LRPYQQHGLDWLAFLHENRLGGCLADDMGLGKTLQTLAFLQHLKDQGEATRPSLIVAPTS 617

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           +  + W  E ++++    + +  +TGT + R         + +  +   G LV++++   
Sbjct: 618 LIYN-WQMEAEKFT--PELGVYALTGTERNRDAAHLGQHDIILTTY---GTLVRDIETLQ 671

Query: 117 --PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
             PF  I++DES  +K+ +  Q  K  R L     ++E  + LTGTP  N   DL+ Q+ 
Sbjct: 672 HQPFNYIILDESQAIKNPQ-SQRYKAVRLL-----KAENRLCLTGTPIENNTFDLYAQMN 725

Query: 175 FLDKG-----KRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQL---SDCC 226
           FL+ G           F   + +  + T        +       +++++  +L   ++  
Sbjct: 726 FLNPGLLGNNSHFKSTFADAIDKHKDETSAALLAKLIHPFILRRSKEQVATELPPKTESI 785

Query: 227 LSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEA--FNSASKTVK 284
           L  D+   Q   K    TKK            +++ +L   +  + IE    +     +K
Sbjct: 786 LYCDMGTAQR--KLYDATKK------------RYREQLLHQIAADGIEKSQLHILDGLLK 831

Query: 285 CLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQK----- 339
             Q+ N      + + + +   +    LE I EK  A  I+V   F   L  +Q      
Sbjct: 832 LRQICNSPALLADREDYGDDSAKLDLLLENIKEKTGAHKILVFSSFVKMLGLIQARLDAE 891

Query: 340 ----AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLE 395
                +  G+T D+            + +      + G GLNL     + +    WW+  
Sbjct: 892 NIPYEYLDGQTRDRKAKVENFQTNDAVRVFLISTKAGGTGLNLTEADYVFI-VDPWWN-- 948

Query: 396 EHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
                +E   + R  + G ++ V  Y +I +N+I+E +L
Sbjct: 949 ---PAVENQAIDRSHRIGQEKHVMAYRIICKNSIEEKIL 984


>gi|206970363|ref|ZP_03231316.1| putative helicase [Bacillus cereus AH1134]
 gi|206734940|gb|EDZ52109.1| putative helicase [Bacillus cereus AH1134]
          Length = 918

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 774

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 775 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 834

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 835 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 888

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 889 RKQSLNNAVITS 900


>gi|30023277|ref|NP_834908.1| SWF/SNF family helicase [Bacillus cereus ATCC 14579]
 gi|29898838|gb|AAP12109.1| SWF/SNF family helicase [Bacillus cereus ATCC 14579]
          Length = 918

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    +    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGNSFEDFLQSADVVLTSYALAQLDEEELT 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLIELIENIKDQNESCLIFTQ 774

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 775 YIGMGNMLKRVLEEKFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 834

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 835 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 888

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 889 RKQSLNNAVITS 900


>gi|291234127|ref|XP_002737002.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent
            regulator of chromatin a5-like [Saccoglossus kowalevskii]
          Length = 1241

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 106/469 (22%), Positives = 183/469 (39%), Gaps = 76/469 (16%)

Query: 26   MGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRWS------------- 70
            MG GKT+  +T + ++ L G+  K VL++ P  V  S W  EV+R++             
Sbjct: 785  MGLGKTIQTITTILHLKLTGQLVKPVLLVVPTSV-MSNWEREVKRFAPCLTVEKYYGTGR 843

Query: 71   --NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTK 128
                  M+    T  V++R K     + + +  ++ L W   E+     F  IV+DE+  
Sbjct: 844  ALPIDSMDGYDSTEPVRKRRKTSSNGSDIIMTTYQ-LLWRDVEVLQKMKFGMIVIDEAQH 902

Query: 129  LKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQS 188
            +K+F+    S+T++ L K   +S   + L+GTP  N L +LW              VF  
Sbjct: 903  IKNFK----SQTSKCLKK--IKSPMRVALSGTPVENKLSELWS-------------VFDF 943

Query: 189  FVARWFNTTQ-----IGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILI 243
             + ++  T +     +   I   R   K    K I A      L  D    +++   ++ 
Sbjct: 944  AIPKYLGTIKDFSDNLAKPIEIERDPEKLCILKSITAPFLMRRLKTDKNIIKDLPDKVID 1003

Query: 244  TKKVPLPQPVMKQYHKFQRELY-----CDLQGENIEAFNSASKTVKCLQLANGAVYYDEE 298
             K V L       Y    RE+      C  +G+  +        +K  Q+ N    Y + 
Sbjct: 1004 NKYVSLSTEQAALYESLVREMMQKIIECKEKGQRNKYIFKILTHLK--QICNHPANYLDS 1061

Query: 299  KHWKEVHDEKIKA----LEVIIEKANAAPIIVAY-------------HFNSDLARLQKAF 341
            K     H  K+K     LE I+++     I   Y             HF+     L+ + 
Sbjct: 1062 KPSIVEHSGKMKMLVELLEPILQQGEKVLIFSQYVRMISLMAKMLEHHFHIKPLTLEGSM 1121

Query: 342  PQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMI 401
             Q   + +D        E    +      + G GLNL    N ++ + LW++       +
Sbjct: 1122 SQ---IKRDKVIHAFKTEPHQQVFIISLKAGGTGLNLT-EANHVIHYDLWYN-----PAV 1172

Query: 402  ERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
            E     R  + G  ++VFVY +I + T +E + + +  K  + DL +N 
Sbjct: 1173 ENQATDRAYRIGQSKSVFVYRMITEKTFEERIDEMIVKKKDLSDLSVNV 1221


>gi|257090879|ref|ZP_05585240.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|312902516|ref|ZP_07761722.1| protein, SNF2 family [Enterococcus faecalis TX0635]
 gi|256999691|gb|EEU86211.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|310634186|gb|EFQ17469.1| protein, SNF2 family [Enterococcus faecalis TX0635]
 gi|315579675|gb|EFU91866.1| protein, SNF2 family [Enterococcus faecalis TX0630]
          Length = 1065

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|257081744|ref|ZP_05576105.1| Snf2 family protein [Enterococcus faecalis E1Sol]
 gi|256989774|gb|EEU77076.1| Snf2 family protein [Enterococcus faecalis E1Sol]
          Length = 1065

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|218900369|ref|YP_002448780.1| putative helicase [Bacillus cereus G9842]
 gi|218544351|gb|ACK96745.1| putative helicase [Bacillus cereus G9842]
          Length = 918

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 201/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 451 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ +++    +    +   V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PNLCVQLHYGSNREKGNSFEDFLQSADVVLTSYALAQLDEEELT 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 774

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    KD    I+E+  G   +      + G GLNL
Sbjct: 775 YIGMGNMLKRVLEEQFGQRVLFLNGSVPKKDRDKMIEEFQNGTYDIFILSLKAGGTGLNL 834

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 835 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 888

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 889 RKQSLNNAVITS 900


>gi|307276930|ref|ZP_07558040.1| protein, SNF2 family [Enterococcus faecalis TX2134]
 gi|306506353|gb|EFM75513.1| protein, SNF2 family [Enterococcus faecalis TX2134]
 gi|315143788|gb|EFT87804.1| protein, SNF2 family [Enterococcus faecalis TX2141]
          Length = 1065

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEECLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|255971908|ref|ZP_05422494.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|312953715|ref|ZP_07772550.1| protein, SNF2 family [Enterococcus faecalis TX0102]
 gi|255962926|gb|EET95402.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|295113640|emb|CBL32277.1| Superfamily II DNA/RNA helicases, SNF2 family [Enterococcus sp. 7L76]
 gi|310628362|gb|EFQ11645.1| protein, SNF2 family [Enterococcus faecalis TX0102]
 gi|315149934|gb|EFT93950.1| protein, SNF2 family [Enterococcus faecalis TX0012]
 gi|315151814|gb|EFT95830.1| protein, SNF2 family [Enterococcus faecalis TX0031]
 gi|315159334|gb|EFU03351.1| protein, SNF2 family [Enterococcus faecalis TX0312]
 gi|323481616|gb|ADX81055.1| SNF2-type helicase [Enterococcus faecalis 62]
          Length = 1065

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|29377168|ref|NP_816322.1| Snf2 family protein [Enterococcus faecalis V583]
 gi|227554179|ref|ZP_03984226.1| Snf2 family helicase [Enterococcus faecalis HH22]
 gi|256763318|ref|ZP_05503898.1| Snf2 family protein [Enterococcus faecalis T3]
 gi|256963798|ref|ZP_05567969.1| Snf2 family protein [Enterococcus faecalis HIP11704]
 gi|257084340|ref|ZP_05578701.1| Snf2 family protein [Enterococcus faecalis Fly1]
 gi|257421693|ref|ZP_05598683.1| Snf2 family protein [Enterococcus faecalis X98]
 gi|307271745|ref|ZP_07553016.1| protein, SNF2 family [Enterococcus faecalis TX0855]
 gi|312900055|ref|ZP_07759372.1| protein, SNF2 family [Enterococcus faecalis TX0470]
 gi|29344634|gb|AAO82392.1| Snf2 family protein [Enterococcus faecalis V583]
 gi|227176678|gb|EEI57650.1| Snf2 family helicase [Enterococcus faecalis HH22]
 gi|256684569|gb|EEU24264.1| Snf2 family protein [Enterococcus faecalis T3]
 gi|256954294|gb|EEU70926.1| Snf2 family protein [Enterococcus faecalis HIP11704]
 gi|256992370|gb|EEU79672.1| Snf2 family protein [Enterococcus faecalis Fly1]
 gi|257163517|gb|EEU93477.1| Snf2 family protein [Enterococcus faecalis X98]
 gi|306511623|gb|EFM80622.1| protein, SNF2 family [Enterococcus faecalis TX0855]
 gi|311292812|gb|EFQ71368.1| protein, SNF2 family [Enterococcus faecalis TX0470]
 gi|315155557|gb|EFT99573.1| protein, SNF2 family [Enterococcus faecalis TX0043]
 gi|315573810|gb|EFU86001.1| protein, SNF2 family [Enterococcus faecalis TX0309B]
 gi|315580246|gb|EFU92437.1| protein, SNF2 family [Enterococcus faecalis TX0309A]
          Length = 1065

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|257087662|ref|ZP_05582023.1| Snf2 family protein [Enterococcus faecalis D6]
 gi|300861266|ref|ZP_07107353.1| SNF2 family N-terminal domain protein [Enterococcus faecalis TUSoD
            Ef11]
 gi|307288690|ref|ZP_07568670.1| protein, SNF2 family [Enterococcus faecalis TX0109]
 gi|256995692|gb|EEU82994.1| Snf2 family protein [Enterococcus faecalis D6]
 gi|300850305|gb|EFK78055.1| SNF2 family N-terminal domain protein [Enterococcus faecalis TUSoD
            Ef11]
 gi|306500356|gb|EFM69693.1| protein, SNF2 family [Enterococcus faecalis TX0109]
 gi|315025539|gb|EFT37471.1| protein, SNF2 family [Enterococcus faecalis TX2137]
 gi|315035196|gb|EFT47128.1| protein, SNF2 family [Enterococcus faecalis TX0027]
 gi|315165356|gb|EFU09373.1| protein, SNF2 family [Enterococcus faecalis TX1302]
          Length = 1065

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|229549191|ref|ZP_04437916.1| Snf2 family helicase [Enterococcus faecalis ATCC 29200]
 gi|229305428|gb|EEN71424.1| Snf2 family helicase [Enterococcus faecalis ATCC 29200]
          Length = 1065

 Score = 69.3 bits (168), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|266620561|ref|ZP_06113496.1| SNF2 family protein [Clostridium hathewayi DSM 13479]
 gi|288867854|gb|EFD00153.1| SNF2 family protein [Clostridium hathewayi DSM 13479]
          Length = 1154

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 99/431 (22%), Positives = 182/431 (42%), Gaps = 75/431 (17%)

Query: 50   LVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK-QRTKVLKTPAVLYVINFENLGWL 108
            L+I P  +  + W SE+ R++    + +  + G+   ++ K+ ++ A + + +++ L   
Sbjct: 738  LIICPASLVYN-WESEIHRFA--PGLTVDTVVGSAGIRKEKIKESRADILLTSYDLLKRD 794

Query: 109  VQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLID 168
            V+  + T  F T+ +DE+  +K+     G++ A+A+   A    R   LTGTP  N L +
Sbjct: 795  VEAYQETL-FDTVFIDEAQNIKN----HGTQAAKAV--KAVSGARRFALTGTPIENALSE 847

Query: 169  LWGQIWFLDKG-------------------------KRLGRVFQSFVARWFNTT---QIG 200
            LW    FL  G                         +RL R+ + F+ R        ++ 
Sbjct: 848  LWSIFDFLMPGFLGGYKHFKEKYEQPVTARQDEVAAERLRRMIRPFILRRLKKEVLRELP 907

Query: 201  SHIGAVRYTAKETAQKEI-EAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHK 259
              +  V Y+  E AQ+EI EA++     SL     +          +V   Q + +  H 
Sbjct: 908  DKLEEVVYSRMEDAQREIYEARVQKLLDSLSKQSQEEF--------RVGKLQILAELTH- 958

Query: 260  FQRELYCD--LQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIE 317
              R+L CD  L  EN      A+K   C++L   AV    E   K +   +  ++  II 
Sbjct: 959  -LRQLCCDPSLVYENYNG--GAAKVDTCVELVKNAV----EAGNKILLFSQFTSMLDIIR 1011

Query: 318  KANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLN 377
            K      I  Y     +++           +K    ++ +NE   P+      + G GLN
Sbjct: 1012 KRLDEEEIGYYILTGAVSK-----------EKRSELVRAFNEDDTPVFLISLKAGGTGLN 1060

Query: 378  LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRL 437
            L    +I++ F  WW+     Q  +     R  + G ++ V VY LI ++T++E +L+  
Sbjct: 1061 LT-AASIVIHFDPWWN-----QAAQNQATDRAHRIGQQQVVTVYKLIMKDTLEEKILEMQ 1114

Query: 438  RTKSTIQDLLL 448
              K+ + + ++
Sbjct: 1115 EKKAGLSEEII 1125


>gi|262066952|ref|ZP_06026564.1| SWF/SNF family helicase [Fusobacterium periodonticum ATCC 33693]
 gi|291379300|gb|EFE86818.1| SWF/SNF family helicase [Fusobacterium periodonticum ATCC 33693]
          Length = 896

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 97/459 (21%), Positives = 189/459 (41%), Gaps = 62/459 (13%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D++  A  A  MG GKT+  +  +S  H   +K  +VI P  +  + W SE+++++ 
Sbjct: 456 YLTDNRLGACLADDMGLGKTLQAIALISKTHEEKKKRTMVIMPKSLIFN-WESEIKKFA- 513

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
             ++ I+V  G  ++ + + K   VL        G +  +++      F  +V+DES  +
Sbjct: 514 -PNLKIAVYYGINRELSILKKADVVLTT-----YGTIRNDIENLLKEKFDLLVLDESQNI 567

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +E+ + L+GTP  N L++L+    FL+  +  G V QSF
Sbjct: 568 KNI----NSQTTKAVL--LLNAEKRVALSGTPVENNLLELYSLFRFLN-PEMFGTV-QSF 619

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSL---DIADYQNIDK 239
              +    Q  S    +    K+         +KE+ A L D    L   D+ +      
Sbjct: 620 TNNYIIPIQKYSDTSTIEELRKKIYPFLLRRVKKEVLADLPDKIEKLVYVDMNEEHRKYY 679

Query: 240 PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEK 299
                    L +        F +          ++A N     V   +L N  +      
Sbjct: 680 EEKRKYYYSLLENNTSSQGTFDKFFV-------LQAINELRHIVSSPELDNNKI------ 726

Query: 300 HWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDK 349
               +  +K   +E +IE   N   +++  ++ S +  +  +  +         G+T D+
Sbjct: 727 ----ISSKKEVLIENVIEAIENNHKVLIFVNYLSSIESICNSLKENKIKFLKMTGQTKDR 782

Query: 350 DPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
                +  ++ +  +      + G GLNL     I ++   WW+     + +E   + R 
Sbjct: 783 QSLVDKFQSDDRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----KTVENQAIDRA 836

Query: 410 RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
            + G  + VF Y +I +NTI+E +L+    K  + D L+
Sbjct: 837 YRLGQDKTVFAYKMIMRNTIEEKILKLQEIKDKLLDDLI 875


>gi|315174973|gb|EFU18990.1| protein, SNF2 family [Enterococcus faecalis TX1346]
          Length = 1065

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|288958707|ref|YP_003449048.1| hypothetical protein AZL_018660 [Azospirillum sp. B510]
 gi|288911015|dbj|BAI72504.1| hypothetical protein AZL_018660 [Azospirillum sp. B510]
          Length = 1160

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 106/449 (23%), Positives = 193/449 (42%), Gaps = 62/449 (13%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE--KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG 82
             MG GKT   L  ++     G   +  LV+ P  +  + WT+E +R++   H+ + V+ G
Sbjct: 717  DMGLGKTAQTLAHIAMEEHEGRLTEPCLVVVPTSLVPN-WTAEAERFT--PHLRVVVLHG 773

Query: 83   TVKQRTKVLKTPAVLYVINFENLGWLVQEL----KGTWPFATIVVDESTKLKSFRLRQGS 138
             V +  K+ +      V+     G + ++L    + TW    IV+DE+  +K+       
Sbjct: 774  -VDRHGKLAEIDRAHIVVT--TYGVVARDLDLLKRLTWHM--IVLDEAQAIKN----PDG 824

Query: 139  KTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKG-----KRLGRVFQSFVARW 193
            K  RA+A  A  +   + L+GTP  N L +LW Q  FL  G     K  G+ ++  + + 
Sbjct: 825  KATRAVA--ALPARHRLCLSGTPVENNLGELWSQFAFLMPGLLGDRKEFGKRYRVPIEKR 882

Query: 194  FNTTQIGSHIGAVR----YTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPL 249
             + T+    +  +R       KE   KE+  + ++  + +D+   Q   + +  T ++ +
Sbjct: 883  GDNTRANLLMRRIRPFLLRRTKEAVAKELPPK-TEVVVRIDLERDQ---RDLYETIRLSV 938

Query: 250  PQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVK--CLQ---LANGAVYYDEEKHWKEV 304
             + V        R L     G+N  A   A   ++  C     L + A    + +   ++
Sbjct: 939  NETVRAALAASGRGL-----GQNTIAVIDALLKLRQVCCDPRLLKSIAALGGKARPSAKL 993

Query: 305  HDEKIKALEVIIEKANAAPIIVAYHFNS--DLARLQ---KAFP----QGRTLDKDPCTIQ 355
            H       E++ E      I++   F +  DL +L+    A P     GRTLD+    + 
Sbjct: 994  HALTGMVKEMVPEGRR---ILIFSQFTTMLDLIKLELEKAAIPYVELTGRTLDR-ALPVN 1049

Query: 356  EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
             +   ++P+      + G GLNL    + ++ +  WW+     Q  +R       + G  
Sbjct: 1050 RFQNREVPVFLISLKAGGRGLNLT-AADTVIHYDPWWNPAAEDQATDR-----AYRIGQD 1103

Query: 416  RAVFVYYLIAQNTIDELVLQRLRTKSTIQ 444
            + VFVY LIA NT++E +L   R K ++ 
Sbjct: 1104 KPVFVYKLIAANTVEERILDLQRRKGSLS 1132


>gi|327535910|gb|AEA94744.1| Snf2 family protein [Enterococcus faecalis OG1RF]
          Length = 1065

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|257079857|ref|ZP_05574218.1| Snf2 family protein [Enterococcus faecalis JH1]
 gi|294780417|ref|ZP_06745783.1| SNF2 family N-terminal domain protein [Enterococcus faecalis PC1.1]
 gi|307269625|ref|ZP_07550961.1| protein, SNF2 family [Enterococcus faecalis TX4248]
 gi|256987887|gb|EEU75189.1| Snf2 family protein [Enterococcus faecalis JH1]
 gi|294452517|gb|EFG20953.1| SNF2 family N-terminal domain protein [Enterococcus faecalis PC1.1]
 gi|306514042|gb|EFM82627.1| protein, SNF2 family [Enterococcus faecalis TX4248]
 gi|329570678|gb|EGG52395.1| protein, SNF2 family [Enterococcus faecalis TX1467]
          Length = 1065

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|227519520|ref|ZP_03949569.1| Snf2 family helicase [Enterococcus faecalis TX0104]
 gi|227073045|gb|EEI11008.1| Snf2 family helicase [Enterococcus faecalis TX0104]
          Length = 1065

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|315168675|gb|EFU12692.1| protein, SNF2 family [Enterococcus faecalis TX1341]
          Length = 1065

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|257416863|ref|ZP_05593857.1| Snf2 family protein [Enterococcus faecalis AR01/DG]
 gi|257158691|gb|EEU88651.1| Snf2 family protein [Enterococcus faecalis ARO1/DG]
          Length = 1065

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|296120640|ref|YP_003628418.1| SNF2-related protein [Planctomyces limnophilus DSM 3776]
 gi|296012980|gb|ADG66219.1| SNF2-related protein [Planctomyces limnophilus DSM 3776]
          Length = 674

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 111/460 (24%), Positives = 198/460 (43%), Gaps = 82/460 (17%)

Query: 5   PHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWT 63
           P+Q + + W+  H    +   MG GKT+  +TA+  +   G+ + V+++ P  +  + W 
Sbjct: 227 PYQYEGIAWLFSHDAALLADEMGLGKTMQTITAIRLLVRSGQVRRVVLVCPKPLLPN-WQ 285

Query: 64  SEVQRWSNFSHMNISVITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWP-FATI 121
            E + W+    +   V+ G   +R      P V + ++N+E L   V      +P F  +
Sbjct: 286 REFRTWAE--ELPFVVVEGDTDRRRITWTMPGVPVLIVNYETLVRDVANFGDEFPKFDLV 343

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD---- 177
           V+DE+ ++K+ R  + ++TAR + +      R   LTGTP  N   +L     FL+    
Sbjct: 344 VLDEAQRIKN-RTSRTAETARRIPR-----RRAWALTGTPIENRPEELGALYEFLELVPP 397

Query: 178 ----KGKRLGRVFQSFVAR------------WFNTTQIGSHIGAVRYTAKETAQKEIEAQ 221
                 K+L  + + F+ R              +   I     A RY+  +TA+KE   Q
Sbjct: 398 GSTPDLKQLQSLSKEFILRRTKDLVMKDMPPRLDRDAILELSPAQRYSY-DTAEKEGVIQ 456

Query: 222 LSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASK 281
           L++   S+ I   Q++ + +L  K++    P+  +  KF R L  D++    E   S  K
Sbjct: 457 LNEMGDSISI---QHVFELVLRLKQITNWDPLTGESAKFDR-LEADME----EVAASGGK 508

Query: 282 TVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANA-APIIVAYHFNSDLARLQKA 340
            +   Q             W        K L+ + EK     P++  YH      +L++ 
Sbjct: 509 AILFSQ-------------W-------TKTLDFLKEKLERFGPLV--YH-GGIPNKLRE- 544

Query: 341 FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM 400
            P  +   +DP         K  +L ++ A+   GLNLQ+ G + + +  WW+       
Sbjct: 545 -PVLKQFKEDPT--------KHIILMSY-ATGAVGLNLQFAGYVFL-YDRWWN-----PA 588

Query: 401 IERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTK 440
           IE   + R  + G K  V V   I+++TI+E + + L  K
Sbjct: 589 IEDQAINRAHRIGCKSQVIVTRFISKDTIEEKIDRVLTEK 628


>gi|237733335|ref|ZP_04563816.1| SWF/SNF family helicase [Mollicutes bacterium D7]
 gi|229383547|gb|EEO33638.1| SWF/SNF family helicase [Coprobacillus sp. D7]
          Length = 1068

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 115/467 (24%), Positives = 182/467 (38%), Gaps = 105/467 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
             MG GKT+ ++T L        K+ +VI P  +  + W  E++++SN   +N+  I+GT+
Sbjct: 632  DMGLGKTLQMITVLEDAK-KNHKASIVITPATLILN-WQDEIKKFSN--DLNVLCISGTL 687

Query: 85   KQRTKVLKTPAVLYVINFENLGWLVQ--ELKGTWPFATIVVDESTKLKSFRLRQGSKTAR 142
              R K+++      VI   +  ++ +  EL   + F  IV+DE+  +K+    Q +K AR
Sbjct: 688  SVRKKMIEQINNYDVI-ITSYDYIRRDFELYKPFKFEYIVLDEAQYIKN----QATKNAR 742

Query: 143  ALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL---------------------DKGK- 180
            A+ K    + RF  LTGTP  N L +LW    FL                     D+ K 
Sbjct: 743  AV-KELHGTHRF-ALTGTPIENSLAELWSIFDFLMPNYLYNYNYFREHFERPIVRDEDKD 800

Query: 181  ---RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIE----AQLSDCCLSLDIA- 232
               RL ++ + F+ R      +      +    K    KE E    A LS     L  A 
Sbjct: 801  AQIRLKKMVEPFILRRTKQEVLEELPDKIENNIKIAFNKEEENLYIANLSQINSELKTAL 860

Query: 233  DYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGA 292
            D + IDK  ++     L            R++ CD +    E    +SK   CL +   A
Sbjct: 861  DVERIDKIQILAMMTRL------------RQICCDARILYNEIIGPSSKMKACLDIIKKA 908

Query: 293  VYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLD---- 348
                                     K N   +++   F S L  L+K   +   L     
Sbjct: 909  -------------------------KENNQKVLLFSSFTSSLDLLEKELRKEDILYYVLT 943

Query: 349  ------KDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIE 402
                  K    +  +      +      + G GLNL    +I++ F  WW++    Q  +
Sbjct: 944  GATNKIKRHQLVNAFQNDNTDVFLISLKAGGTGLNLT-AASIVIHFDPWWNMSAQNQATD 1002

Query: 403  ---RIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDL 446
               RIG T   Q        VY LI +N+I+E + Q L+ +   QDL
Sbjct: 1003 RAYRIGQTNNVQ--------VYKLIMKNSIEEKI-QELQAQK--QDL 1038


>gi|315162049|gb|EFU06066.1| protein, SNF2 family [Enterococcus faecalis TX0645]
          Length = 1065

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|256853990|ref|ZP_05559355.1| Snf2 family protein [Enterococcus faecalis T8]
 gi|307290304|ref|ZP_07570220.1| protein, SNF2 family [Enterococcus faecalis TX0411]
 gi|256710933|gb|EEU25976.1| Snf2 family protein [Enterococcus faecalis T8]
 gi|306498725|gb|EFM68226.1| protein, SNF2 family [Enterococcus faecalis TX0411]
 gi|315030488|gb|EFT42420.1| protein, SNF2 family [Enterococcus faecalis TX4000]
          Length = 1065

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|315170383|gb|EFU14400.1| protein, SNF2 family [Enterococcus faecalis TX1342]
          Length = 1065

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|257869721|ref|ZP_05649374.1| Snf2 family protein [Enterococcus gallinarum EG2]
 gi|257803885|gb|EEV32707.1| Snf2 family protein [Enterococcus gallinarum EG2]
          Length = 1074

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 96/428 (22%), Positives = 186/428 (43%), Gaps = 67/428 (15%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV 79
            MG GKTV  ++     +L  EK      + L++AP  +  + W  E++R++    +   V
Sbjct: 651  MGLGKTVQTIS-----YLLSEKQEKQQLNALIVAPASLTYN-WQQEIKRFA--PTIRSVV 702

Query: 80   ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            I+G+ ++R   L+ PA + + ++ +L   + + +     A +++DE+  +K+     G+K
Sbjct: 703  ISGSREERGSQLQLPADVRITSYASLRQDIDQYQ-ELGLAYLILDEAQMVKN----SGTK 757

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
            TA+AL +      RF  L+GTP  N L +LW              +F+  +  +F   Q 
Sbjct: 758  TAQAL-RSLNVPHRFA-LSGTPIENNLEELWS-------------LFEMIMPGFFPNKQ- 801

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD-YQNIDKPILITKKVPLPQPVMKQYH 258
                   RY  KE   +EI   +    L  D     Q++ + +       L +   K Y 
Sbjct: 802  -------RY--KELTTQEIAKMIKPFILRRDKKSVLQDLPEKLETNYYSVLTEEQKKIYL 852

Query: 259  KFQRELYCDLQGENIEAFNSASKTV-----KCLQLANGAVYYDEEKHWKEVHDEKIKALE 313
             + R++  ++   +  AF     ++     +  Q+      + E+        E++K L 
Sbjct: 853  AYLRQMREEIAQMDTAAFRKNRISILAGLTRLRQICCDPRLFVEDYEGTSGKLEQVKDL- 911

Query: 314  VIIEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQEWNEGKIP 363
            +   K N   +++   F S L+ +++   Q         G T  ++  + +  +N G+  
Sbjct: 912  IQAAKENGRRVLLFSQFTSMLSIIEEELAQEGIETFYLRGSTPPQERLSMVDAFNNGEKD 971

Query: 364  LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
            +      + G GLNL  G + ++ + LWW+       +E     R  + G K+ V V+ +
Sbjct: 972  VFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHRIGQKKVVEVWRM 1025

Query: 424  IAQNTIDE 431
            IA+ TI+E
Sbjct: 1026 IAEGTIEE 1033


>gi|328543336|ref|YP_004303445.1| Helicase domain protein [polymorphum gilvum SL003B-26A1]
 gi|326413081|gb|ADZ70144.1| Helicase domain protein [Polymorphum gilvum SL003B-26A1]
          Length = 481

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 111/477 (23%), Positives = 203/477 (42%), Gaps = 69/477 (14%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKS-VLVIAPLRVAQ 59
             L  HQ + V ++       +    G GKT   + A   +   G+   +LVI P  + +
Sbjct: 18  FELLQHQHEGVAFLTGRGVGLLAFEQGLGKTFVAIEAFRRLLDAGQADRLLVICPNSLKR 77

Query: 60  SVWTSEVQRWSNFSHMNISVITGTVKQRTKVLK-TPAVLYVINFEN-------LGWLVQE 111
           + W +E  +++    +++ V  G  K+R    + + A + + ++E        L  L Q 
Sbjct: 78  N-WVAEFTKFA--PSVSVDVAEGVPKKRRATFRESRARVIITSYETARSETTALLALAQR 134

Query: 112 LKGTWPFATIVVDESTKLKSFRLRQGSKTARALA---KPAWESERFIELTGTPSPNGLID 168
            +       +V+DES   K++R  Q S  AR +A   K  W       L+GTP  N   D
Sbjct: 135 QR-----TVLVLDESHAAKNWR-SQTSAAARIVAPHCKFRWL------LSGTPVTNTATD 182

Query: 169 LWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLS 228
           L+ Q+  ++ G+      +SF AR  +  +           A++   + I  +  + CL 
Sbjct: 183 LFTQVEIIEPGRGSLGSLESFTARLEDDPEAS--------FARDVFDRLILRRTKEQCLD 234

Query: 229 LDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQ---GENIEAFNSA--SKTV 283
           L    + ++        +V LP    + Y K + E+ C+++   GE   A+ S   +K  
Sbjct: 235 LPEKSFVDV--------RVELPPWQRRLYDKMRDEMVCEIEAMSGEQYRAYASTALAKLT 286

Query: 284 KCLQLA-NGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAP---IIVAYHF----NSDLA 335
           + +QLA N ++ + E     E    K +AL+ +IE   + P   +I+  ++     + LA
Sbjct: 287 RLVQLACNPSLIFPE----AEGTPAKFEALDGVIEDILSVPGRKVILWSNYIRTIETLLA 342

Query: 336 RLQKA---FPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWW 392
           R+  A   +    T ++         +  + +L A+PA+ G G  L    +  ++ SL W
Sbjct: 343 RIPGAVAIYGGTPTSERQEIAASFQQDPDVRVLIANPAAAGTGFTLT-AASFTIYESLSW 401

Query: 393 DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN 449
             + + Q  +     R  + G    V    LIA +TI+E ++  L  KS +   LL 
Sbjct: 402 RYDHYAQSQD-----RNHRIGQTEPVTYLRLIAADTIEEAIVVALERKSALARTLLG 453


>gi|332686359|ref|YP_004456133.1| Snf2 family protein [Melissococcus plutonius ATCC 35311]
 gi|332370368|dbj|BAK21324.1| Snf2 family protein [Melissococcus plutonius ATCC 35311]
          Length = 1068

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 99/436 (22%), Positives = 184/436 (42%), Gaps = 80/436 (18%)

Query: 26   MGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
            MG GKT+  +T L      G++    L++AP  +  + W +E++++S  +  N+ +I G 
Sbjct: 643  MGLGKTLQTITYLLSEKEEGKQKSPALIVAPASLIYN-WIAEIKKFSPTT--NVQIIFGN 699

Query: 84   VKQRTKVLKTPAV--LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTA 141
              +R K+L       + + ++ +L   V++ K       +++DE+  +K+     G+KTA
Sbjct: 700  KDERIKLLANAEKQDILITSYASLRQDVEQYKEI-KIDYLILDEAQMVKN----SGTKTA 754

Query: 142  RALAKPAWESERFIELTGTPSPNGLIDLWG-------------QIWFLDKGKRLGRVFQS 188
            +AL   + E  +   L+GTP  N L +LW               I+   +   + +V Q 
Sbjct: 755  KALR--SLEISKKFALSGTPIENNLEELWSIFQLILPGLLPSKMIFRKMRANDIAKVIQP 812

Query: 189  FVARWFNTT---QIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITK 245
            F+ R    T    +   I +  Y+     QK I        L    AD Q +D+      
Sbjct: 813  FILRRDKQTVLSDLPEKIESNLYSVLTEEQKTIYL----AYLKQMQADIQKMDQATFKKN 868

Query: 246  KVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVH 305
            ++ +   + +      R++ CD +   IE +   S  V                      
Sbjct: 869  RLNILAGLTR-----LRQICCDPRL-FIEDYTGGSSKV---------------------- 900

Query: 306  DEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQ 355
             E++K + +I  K N   +++   F   L+ L+K F +         G T  K+    + 
Sbjct: 901  -EQVKEI-LITAKKNNKRVLLFSQFKGMLSILEKEFQRLDLETFYLSGSTKPKERINMVN 958

Query: 356  EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
             +N+G+  +      + G GLNL  G + +V + LWW+       +E    +R  + G K
Sbjct: 959  AFNDGQKDVFLISLKAGGTGLNLT-GADTVVLYDLWWN-----PAVEEQAASRAHRIGQK 1012

Query: 416  RAVFVYYLIAQNTIDE 431
            + V V+ +I + TI+E
Sbjct: 1013 KVVEVWRMITEGTIEE 1028


>gi|256616806|ref|ZP_05473652.1| Snf2 family protein [Enterococcus faecalis ATCC 4200]
 gi|256596333|gb|EEU15509.1| Snf2 family protein [Enterococcus faecalis ATCC 4200]
          Length = 1065

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEECLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTP-AVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSIEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|257420085|ref|ZP_05597079.1| conserved hypothetical protein [Enterococcus faecalis T11]
 gi|257161913|gb|EEU91873.1| conserved hypothetical protein [Enterococcus faecalis T11]
          Length = 1065

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEIRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|326431585|gb|EGD77155.1| CHD1 protein [Salpingoeca sp. ATCC 50818]
          Length = 1497

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 116/514 (22%), Positives = 215/514 (41%), Gaps = 100/514 (19%)

Query: 3   LAPHQTKIVDWIL---DHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEK--SVLVIAPLR 56
           L P+Q K ++W++   ++    I A  MG GKT+  ++ L+Y+  +       L+I PL 
Sbjct: 468 LKPYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLLTYLFEYKRNYGPFLIIVPLS 527

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPA-VLYVINFENLGWLVQELK-- 113
              S W  E+++W+    +   V  G  + R  + KT     Y +      +++++    
Sbjct: 528 TL-SNWRMELEKWAPV--LQALVYRGAPQYRKSLKKTVVEAKYNVLLTTYEYVIRDKSAL 584

Query: 114 GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQI 173
           G  P+  +++DE  ++K+   ++G K  + L + ++  +R + LTGTP  N L +LW  +
Sbjct: 585 GRVPWEYLIIDEGHRMKN---KEG-KLTQTLTQ-SYSCQRRLLLTGTPLQNNLPELWALL 639

Query: 174 WFLDKGKRLGRVFQSF--VARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
            FL     L ++F+S      WFN    G+                   +LS+    L I
Sbjct: 640 NFL-----LPKIFESVRNFEDWFNAPFAGTGEN---------------MELSNEETMLII 679

Query: 232 ADYQNIDKPILITK-----KVPLPQPV-----------MKQYHKFQRELYCDLQGENIEA 275
                + +P L+ +     +  LP  +            KQ +K  +E    L G+  ++
Sbjct: 680 QRLHKVLRPFLLRRLKKDVESQLPNKIEYVIKCEMSVLQKQLYKHMKEHGVLLTGDEAKS 739

Query: 276 ---FNSASKTVKCL--------QLANGA-------VYYDEEKHWKEVHDEKI----KALE 313
               +   +TV  L        +L N         V Y   +  + VHDE +      LE
Sbjct: 740 KSGHHHKKRTVHALRNTLMQLRKLCNHPFLFKEIEVAYARHRSLQYVHDEDLWRASGKLE 799

Query: 314 VIIE-----KANAAPIIVAYHFNSDLARLQKAFP---------QGRTLDKDPC-TIQEWN 358
           ++       KA+   +++       L  L+  F           G T D++    ++E+N
Sbjct: 800 LLTRMLPKFKASKHKVLLFSQMTQLLTILEDFFTAIGLTYIRLDGGTSDEERGRQVKEFN 859

Query: 359 --EGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKR 416
             + +I +      + G GLNLQ    +++F S W     HQ +       R  + G K 
Sbjct: 860 SPDSQIDVFVLSTRAGGLGLNLQTADTVIIFDSDW---NPHQDL---QAQDRAHRIGQKN 913

Query: 417 AVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
            V V+ L + N+++E +L+  R K  + + ++ A
Sbjct: 914 EVRVFRLCSINSVEETILEAARFKLNVDEKVIQA 947


>gi|310779269|ref|YP_003967602.1| SNF2-related protein [Ilyobacter polytropus DSM 2926]
 gi|309748592|gb|ADO83254.1| SNF2-related protein [Ilyobacter polytropus DSM 2926]
          Length = 920

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 98/467 (20%), Positives = 193/467 (41%), Gaps = 72/467 (15%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           +++D+K     A  MG GKT+  +  LS I+    K  LV  P  +  + W +E+++++ 
Sbjct: 478 YLIDNKIGGCLADDMGLGKTLQAIALLSRIYETPRKPSLVAMPKSLIYN-WENEIKKFN- 535

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK--GTWPFATIVVDESTKL 129
             ++N+ +  G  +   ++ ++  VL        G +  ++K      F  +++DES  +
Sbjct: 536 -PNLNVKIYYGNNRDVNEIKESQIVLTT-----YGTVRNDIKTLKEMEFELVILDESQNI 589

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRV--FQ 187
           K+      S+T +A+      S+  + L+GTP  N L +L+    FL+     G +  F 
Sbjct: 590 KNI----NSQTTKAVM--LLNSQNRVALSGTPVENNLGELYSLFRFLNPT-MFGSIDEFN 642

Query: 188 SFVARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKP 240
           SF A   N  Q  + +  V    K+         +KE+   L D    +   +  +  K 
Sbjct: 643 SFYA---NPIQRDNDMEVVEELRKKIYPFILRRTKKEVLKDLPDKIEKVHFVEMNDEQKK 699

Query: 241 ILITKKV---PLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDE 297
           I   +++    L    +K++   + +++       ++A N   +   C ++    +    
Sbjct: 700 IYDERRLFYYDLIHNQIKEHGIGKSQIFI------LQALNELRQLASCPEMKTEGLVSST 753

Query: 298 EKHWKEVHDEKIKALEVIIEK-----ANAAPIIVAYHF---------NSDLARLQKAFPQ 343
           ++             E++IE       N   I++  +F         + D   ++  +  
Sbjct: 754 KR-------------EILIENIREAVDNGHKILIFTNFIRSIENICEDLDKHNIKHLYMT 800

Query: 344 GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
           G T D+     +  N+ K  +      + G GLNL     I ++   WW+     Q    
Sbjct: 801 GATKDRQSLVEKFQNDKKCKVFVMTLKTGGVGLNLTAADTIFIY-DPWWNKTAEDQ---- 855

Query: 404 IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
             V R  + G  R VF Y LI + TI+E +L+    KS + + L+++
Sbjct: 856 -AVDRSHRMGQDRTVFSYKLITKGTIEEKILKLQEEKSRLFEKLISS 901


>gi|229164183|ref|ZP_04292118.1| Helicase, SNF2/RAD54 [Bacillus cereus R309803]
 gi|228619300|gb|EEK76191.1| Helicase, SNF2/RAD54 [Bacillus cereus R309803]
          Length = 840

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 104/496 (20%), Positives = 198/496 (39%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L Y      K+   L++AP  
Sbjct: 373 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYAKENNLKTGPALIVAPTS 432

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ I +  G+ + +    K    +   V+    L  L +E   
Sbjct: 433 VLGN-WQKEFERFA--PNLRIQLHYGSSRDKGDSFKDFLQSADVVLTSYALAQLDEEELT 489

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 490 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 543

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 544 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPD- 600

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
                                   K +++ YC L GE              N+E  +   
Sbjct: 601 ------------------------KLEQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 636

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 637 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 696

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y             +F   +  L  + P+ +  DK    I+++  G   +      + G 
Sbjct: 697 YIGMGNMLKRVLEENFGQRVLFLNGSVPK-KERDK---MIEQFQNGTYDIFILSLKAGGT 752

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 753 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 806

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 807 EMLERKQSLNNAVITS 822


>gi|229544926|ref|ZP_04433651.1| Snf2 family helicase [Enterococcus faecalis TX1322]
 gi|229309818|gb|EEN75805.1| Snf2 family helicase [Enterococcus faecalis TX1322]
          Length = 1065

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEIRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|325113188|ref|YP_004277134.1| putative helicase [Acidiphilium multivorum AIU301]
 gi|325052655|dbj|BAJ82992.1| putative helicase [Acidiphilium multivorum AIU301]
          Length = 918

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 117/497 (23%), Positives = 196/497 (39%), Gaps = 95/497 (19%)

Query: 2   NLAPHQTKIVDWI--LDHKR--CAIWASMGSGKTVSVLTALSYIHLWGEKS-------VL 50
            L P+Q   V W+  L   R    +   MG GKT+ VL  L       EKS        +
Sbjct: 441 TLRPYQKAGVQWLRLLSALRLGACLADDMGLGKTIQVLALL-----LAEKSRRAVRQPSI 495

Query: 51  VIAPLRVAQSVWTSEVQRWS-----NFSHMNISVITGTVKQRTKVLKTPAVLYVINFENL 105
           ++AP  +  + W+ E+ R++        H + S  T  +K  T        L + ++  L
Sbjct: 496 LVAPASLLAN-WSGEIDRFAPDLRARIVHSSTSSAT-EIKTFTAEDAAAFDLVITSYGTL 553

Query: 106 GWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNG 165
             L    +  W FA  ++DE+  +K+   +Q ++ A+AL      +E  I LTGTP  N 
Sbjct: 554 LRLPALTEILWRFA--ILDEAQAIKNPAAKQ-TRAAKAL-----RAEARIALTGTPVENA 605

Query: 166 LIDLWGQIWFLDKGKRLG--RVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLS 223
           L DLW    F++ G  LG  R F  +     N  Q  +  G +R   +    + ++   +
Sbjct: 606 LGDLWSIFDFINPGL-LGNARKFARYTKSLANQRQ--NPYGPLRDLVRPYILRRMK---T 659

Query: 224 DCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSA---- 279
           D  +  D+ D   ++   L+++K              Q  LY +  G+   +   A    
Sbjct: 660 DKAIIADLPDKIEMNAHCLLSRK--------------QAALYSEAVGDLARSLEEAEGMA 705

Query: 280 ------SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANA------------ 321
                 +  V+  Q+ N   ++  + +W E    K + L  I E   A            
Sbjct: 706 RRGLVLASLVRLKQICNHPAHWLNDGNWDEAGSGKFRRLREIAEAVAARQDKMLVFTQFR 765

Query: 322 ---API--IVAYHFNSDLARLQKAFP--QGRTLDKDPCTIQEWNEG-KIPLLFAHPASCG 373
              AP+  ++A  F  D   L    P  Q RTL      +Q + E  ++P       + G
Sbjct: 766 EMVAPLAALLASVFGRDGLELHGGTPVRQRRTL------VQRFQEDEEVPFFVLSLKAGG 819

Query: 374 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 433
            GL L    ++ V F  WW+       +E     R  + G K  V V+  I + T++E +
Sbjct: 820 TGLTLTAASHV-VHFDRWWN-----PAVEAQATDRAFRIGQKSNVLVHKFICRGTVEERI 873

Query: 434 LQRLRTKSTIQDLLLNA 450
              +  K ++   LL+ 
Sbjct: 874 DAMIEAKQSLSTELLSG 890


>gi|251773066|gb|EES53622.1| DNA/RNA helicase, SNF2 family [Leptospirillum ferrodiazotrophum]
          Length = 824

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 113/499 (22%), Positives = 200/499 (40%), Gaps = 102/499 (20%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYI-HLWGEKSVLVIAPLRVAQSV 61
           L P+Q +   + +   R  I   MG GKT+  + A   +   +G   VLV+ P  +    
Sbjct: 234 LYPYQVEGALFAVRTGRVLIGDEMGLGKTIQAIAAAEILARHFGVTKVLVVCPTSLKYQ- 292

Query: 62  WTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATI 121
           W SE+ +   F+     VI+G    R K  +    + + N+E L   +  + G W    +
Sbjct: 293 WQSEIHK---FAGRESRVISGGRAVREKAFREEDFVKITNYEKLSPDLDLIAG-WGPDLV 348

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKR 181
           +VDE+ ++K++     +  +RAL +   +S   I LTGTP  N L +L   + F+D+  R
Sbjct: 349 IVDEAQRVKNWN----TLASRALKR--IDSPYAIVLTGTPLENKLEELISIVQFVDR-YR 401

Query: 182 LGRVFQ-----------SFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLD 230
           LG  ++             V  +    +IG  +  V    K++   E+  QL        
Sbjct: 402 LGPTWKLLHEHQVKDEHGRVVGYKGLEKIGQTLAPVVLRRKKS---EVLGQLP------- 451

Query: 231 IADYQNIDKPILITKKVP----------LPQPVMKQYHKF-------QRELYCDLQGENI 273
               +  D+ +L+   +P          +   +  ++ K        QR L C LQ   +
Sbjct: 452 ----ERTDQNLLVPMTLPQIRIHEENAEIVASIGNRWRKTGYLSEVDQRRLTCSLQNMRM 507

Query: 274 ---------EAFNSASKTVKCLQLANG--------AVYYDEEKHWKEVHDEKIKALEVII 316
                       +   K  + + L +G        AV + +   W   HD       ++I
Sbjct: 508 VCNSTYLIDPETDHGVKADELVALLDGLFSDPGTKAVVFSQ---WTRTHD-------IVI 557

Query: 317 EKANAAPI-IVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHG 375
            + +A  I  V++H              G   D+ P  ++ + E     +F    +   G
Sbjct: 558 RRLDARGIGSVSFH-------------GGIPSDRRPALVERFREDPDCRVFLSTDAGSTG 604

Query: 376 LNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQ 435
           LNLQ+  ++LV   L W+    +Q I RI      + G KR V +   +A+  I+E +L 
Sbjct: 605 LNLQH-ASVLVNMDLPWNPAILEQRIARI-----HRMGQKRPVQIVNFVAKGGIEEGMLG 658

Query: 436 RLRTKSTIQDLLLNALKKE 454
            L  K ++ + +L+    E
Sbjct: 659 LLSFKQSLSEGILDGGAGE 677


>gi|315148655|gb|EFT92671.1| protein, SNF2 family [Enterococcus faecalis TX4244]
          Length = 1065

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 101/440 (22%), Positives = 188/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEKS-------VLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK         L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGIALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     QK +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQKTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|256957920|ref|ZP_05562091.1| Snf2 family protein [Enterococcus faecalis DS5]
 gi|256948416|gb|EEU65048.1| Snf2 family protein [Enterococcus faecalis DS5]
          Length = 1065

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 100/440 (22%), Positives = 189/440 (42%), Gaps = 89/440 (20%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+  +T     +L  EK       + L++AP  +  + W +EV+R++    +N+ 
Sbjct: 641  MGLGKTLQTIT-----YLLSEKEEERLKGTALIVAPASLTYN-WLAEVKRFA--PTLNVQ 692

Query: 79   VITGTVKQRTKVLKTPAV-LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQG 137
            V++G  ++R  +L+     + + ++ ++   VQ L        +++DE+  +K+     G
Sbjct: 693  VVSGNRQERAALLQNSTEDILITSYASMRQDVQ-LYQEMRVGYLILDEAQMVKN----SG 747

Query: 138  SKTARALAKPAWESERFIELTGTPSPNGLIDLW------------GQIWFLD-KGKRLGR 184
            +KTA+AL K     +RF  L+GTP  N L +LW            G+  F + K + + +
Sbjct: 748  TKTAQAL-KSLKVPQRFA-LSGTPIENNLDELWSIFQMILPGLFPGKKAFREIKPEEIAK 805

Query: 185  VFQSFVARWFNTTQIGS---HIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPI 241
            + Q F+ R    T +      I    Y+     Q+ +        L    AD   +D+  
Sbjct: 806  MIQPFILRRDKKTVLADLPEKIENNMYSVLTEEQRTVYL----AYLKQMQADVSQMDQAT 861

Query: 242  LITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                ++ +   + +      R++ CD +   IE +   S  V                  
Sbjct: 862  FKKNRMSILAGLTR-----LRQICCDPRL-FIEDYTGGSGKV------------------ 897

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKA---------FPQGRTLDKDPC 352
                 E++K   ++  K N   +++   F S L+ L+K          + +G T  +D  
Sbjct: 898  -----EQVKDF-LVAAKENNRRVLLFSQFTSMLSILEKELNELGLETFYLRGSTKPQDRL 951

Query: 353  TI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            T+   +NEG+  +      + G GLNL  G + ++ + LWW+       +E     R  +
Sbjct: 952  TMANAFNEGEKDVFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHR 1005

Query: 412  AGFKRAVFVYYLIAQNTIDE 431
             G K+ V V+ +IA+ T++E
Sbjct: 1006 MGQKKVVEVWRMIAEGTVEE 1025


>gi|256544992|ref|ZP_05472360.1| SNF2 family prophage LambdaSa04, helicase [Anaerococcus vaginalis
           ATCC 51170]
 gi|256399288|gb|EEU12897.1| SNF2 family prophage LambdaSa04, helicase [Anaerococcus vaginalis
           ATCC 51170]
          Length = 78

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 52/71 (73%), Gaps = 1/71 (1%)

Query: 268 LQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVA 327
           ++ ++I+A NSA+ + K LQ+A+G+VY DE+K+   +HD KI ALE +IE AN  P+ +A
Sbjct: 5   IKEKDIDAVNSAALSNKLLQMASGSVY-DEDKNMIRIHDRKIDALENLIEGANGKPVPIA 63

Query: 328 YHFNSDLARLQ 338
           Y + SDL R++
Sbjct: 64  YWYKSDLKRIK 74


>gi|257867846|ref|ZP_05647499.1| Snf2 family protein [Enterococcus casseliflavus EC30]
 gi|257874174|ref|ZP_05653827.1| Snf2 family protein [Enterococcus casseliflavus EC10]
 gi|257801929|gb|EEV30832.1| Snf2 family protein [Enterococcus casseliflavus EC30]
 gi|257808338|gb|EEV37160.1| Snf2 family protein [Enterococcus casseliflavus EC10]
          Length = 1054

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 93/428 (21%), Positives = 182/428 (42%), Gaps = 67/428 (15%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV 79
            MG GKTV  ++     +L  EK      + L++AP  +  + W  E++R++    ++ SV
Sbjct: 630  MGLGKTVQTIS-----YLLSEKQEKQKLNALIVAPASLTFN-WQQEIKRFA--PTISASV 681

Query: 80   ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            I+GT ++R   +  PA + + ++ +L   +   +       +++DE+  +K+      +K
Sbjct: 682  ISGTKEEREGQMAQPADVRITSYASLRQDIDAYQA-LDLTCLILDEAQMVKN----SATK 736

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
            TA+AL   + E  +   L+GTP  N L +LW              +FQ  +  +F   Q 
Sbjct: 737  TAQALR--SLEVPQRFALSGTPIENNLEELWS-------------LFQMIMPGFFPNKQ- 780

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD-YQNIDKPILITKKVPLPQPVMKQYH 258
                       KE + +EI   +    L  D      ++ + +       L +   K Y 
Sbjct: 781  ---------KFKELSTQEIAKMIKPFILRRDKKSVLHDLPQKLETNYYSVLTEEQKKIYL 831

Query: 259  KFQRELYCDLQGENIEAFNSASKTV-----KCLQLANGAVYYDEEKHWKEVHDEKIKALE 313
             + R++  ++   +  +F     ++     +  Q+      + E+        E++K L 
Sbjct: 832  AYLRQMREEIAQMDSTSFRKNRISILAGLTRLRQICCDPRLFVEDYEGSSGKLEQVKDL- 890

Query: 314  VIIEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQEWNEGKIP 363
            ++  K N   +++   F S L+ +++   Q         G T  +D  T +  +N G+  
Sbjct: 891  LLAAKENGRRVLLFSQFTSMLSIIEEELAQEGFESFYLRGSTPPQDRLTMVDAFNSGEKD 950

Query: 364  LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
            +      + G GLNL  G + ++ + LWW+       +E     R  + G K  V V+ +
Sbjct: 951  VFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHRIGQKNVVEVWRM 1004

Query: 424  IAQNTIDE 431
            IA+ TI+E
Sbjct: 1005 IAEGTIEE 1012


>gi|228903720|ref|ZP_04067840.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis IBL 4222]
 gi|228855988|gb|EEN00528.1| Helicase, SNF2/RAD54 [Bacillus thuringiensis IBL 4222]
          Length = 856

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 103/496 (20%), Positives = 199/496 (40%), Gaps = 94/496 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L YI     K+   L++AP  
Sbjct: 389 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYIKENNLKTGPALIVAPTS 448

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ +++    +    +   V+    L  L +E   
Sbjct: 449 VLGN-WQKEFERFA--PNLCVQLHYGSNREKGNSFEDFLQSADVVLTSYALAQLDEEELT 505

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 506 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 559

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 560 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 617

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 618 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 652

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  + V +  +K       +E I ++  +  I   
Sbjct: 653 RRGFILLMLNKLKQICNHPALYLKEEEPQNVVERSMKTKTLMELIENIKDQNESCLIFTQ 712

Query: 328 Y-------------HFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
           Y              F   +  L  + P+ +  DK    I+E+  G   +      + G 
Sbjct: 713 YIGMGNMLKRVLEEQFGQRVLFLNGSVPK-KNRDK---MIEEFQNGTYDIFILSLKAGGT 768

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + 
Sbjct: 769 GLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKID 822

Query: 435 QRLRTKSTIQDLLLNA 450
           + L  K ++ + ++ +
Sbjct: 823 EMLERKQSLNNAVITS 838


>gi|167756157|ref|ZP_02428284.1| hypothetical protein CLORAM_01680 [Clostridium ramosum DSM 1402]
 gi|167704149|gb|EDS18728.1| hypothetical protein CLORAM_01680 [Clostridium ramosum DSM 1402]
          Length = 1068

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 116/467 (24%), Positives = 183/467 (39%), Gaps = 105/467 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
             MG GKT+ ++T L        K+ +VI P  +  + W  E++++SN   +N+  I+GT+
Sbjct: 632  DMGLGKTLQMITVLEDAK-KNHKASIVITPATLILN-WQDEIKKFSN--DLNVLCISGTL 687

Query: 85   KQRTKVLKTPAVLYVINFENLGWLVQ--ELKGTWPFATIVVDESTKLKSFRLRQGSKTAR 142
              R K+++      VI   +  ++ +  EL   + F  IV+DE+  +K+    Q +K AR
Sbjct: 688  SVRKKMIEQINNYDVI-ITSYDYIRRDFELYKPFKFEYIVLDEAQYIKN----QATKNAR 742

Query: 143  ALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL---------------------DKGK- 180
            A+ K    + RF  LTGTP  N L +LW    FL                     D+ K 
Sbjct: 743  AV-KELHGTHRF-ALTGTPIENSLAELWSIFDFLMPNYLYNYNYFREHFERPIVRDEDKD 800

Query: 181  ---RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIE----AQLSDCCLSLDIA- 232
               RL ++ + F+ R      +      +    K    KE E    A LS     L  A 
Sbjct: 801  AQIRLKKMVEPFILRRTKQEVLEELPDKIENNIKIAFNKEEENLYIANLSQINSELKTAL 860

Query: 233  DYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGA 292
            D + IDK  ++     L            R++ CD +    E    +SK   CL +   A
Sbjct: 861  DVERIDKIQILAMMTRL------------RQICCDARILYNEIIGPSSKMKACLDIIKKA 908

Query: 293  VYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQ--------- 343
                                     K N   +++   F S L  L+K   +         
Sbjct: 909  -------------------------KENNQKVLLFSSFTSSLDLLEKELRKEDISYYVLT 943

Query: 344  GRTLD-KDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIE 402
            G T   K    +  +      +      + G GLNL    +I++ F  WW++    Q  +
Sbjct: 944  GATNKIKRHQLVNAFQNDNTDVFLISLKAGGTGLNLT-AASIVIHFDPWWNMSAQNQATD 1002

Query: 403  ---RIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDL 446
               RIG T   Q        VY LI +N+I+E + Q L+ +   QDL
Sbjct: 1003 RAYRIGQTNNVQ--------VYKLIMKNSIEEKI-QELQAQK--QDL 1038


>gi|295693012|ref|YP_003601622.1| non-specific serine/threonine protein kinase [Lactobacillus
           crispatus ST1]
 gi|295031118|emb|CBL50597.1| Non-specific serine/threonine protein kinase [Lactobacillus
           crispatus ST1]
          Length = 1018

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 110/484 (22%), Positives = 214/484 (44%), Gaps = 79/484 (16%)

Query: 3   LAPHQTKIVDW---ILDHKRCAIWAS-MGSGKTVSVLTAL--SYIHLWGEKSVLVIAPLR 56
           L P+Q    +W   I+++K   + A  MG GKT+ +++ L      +  +   L++AP  
Sbjct: 556 LRPYQKIGFNWLSTIVNYKFGGLLADEMGLGKTLQIISLLLARKEKMQNQLPSLIVAPAS 615

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG-- 114
           V  + W +EV++++    +N++++ GT K+R ++L   A  Y +   +   L ++L+   
Sbjct: 616 VIYN-WQAEVKKFA--PSLNVALLDGTKKERERLL-LDAKKYDLLISSYQSLNRDLEAYQ 671

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
              F   V+DE+  +K+    Q S TA+ +     ++   + LTGTP  N L +LW    
Sbjct: 672 NLIFDVEVIDEAQNIKN----QQSVTAKTVK--VIKAHHKLALTGTPIENKLSELWSIFD 725

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL----- 229
           +L  G  LG  +  F  ++         +  V+        KE E QL++  +       
Sbjct: 726 YLMPG-FLGS-YPDFRKKY--------ELPIVK-----EQDKEAEDQLANMVIPFILRRL 770

Query: 230 ------DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSA---- 279
                 D+ D      P+ + KK          Y+   +++   L G+  E F  +    
Sbjct: 771 KKDVLRDLPDKDEEIVPVKMNKKQA------DLYNMQTQKIIAQLNGQGDEDFKRSRFQI 824

Query: 280 -SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNS----- 332
            ++  K  ++        E  H K   ++ I  +E+I    AN   I++   F +     
Sbjct: 825 LAQINKLREICCDPHLLYENYHGKS--NKLIATIELIKNNLANGHKILLFSQFTAMLDIL 882

Query: 333 --DLARLQKAFPQGRTLDKDPCT-----IQEWNEGKIPLLF-AHPASCGHGLNLQYGGNI 384
             +LARL+   P        P T     +Q++N+   P +F     + G G+NL  G ++
Sbjct: 883 HENLARLR--LPLFTITGSTPKTKRQEQVQKFNQMAQPGVFLISLKAGGTGINLT-GADV 939

Query: 385 LVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQ 444
           ++ +  WW+L   +Q        R  + G K +V +Y ++ +++I+E ++   + K+ + 
Sbjct: 940 VIHYDPWWNLAAEKQ-----ATDRAHRIGQKHSVKIYKMVTEDSIEERIIALQQKKAELA 994

Query: 445 DLLL 448
           D++L
Sbjct: 995 DIIL 998


>gi|261420703|ref|YP_003254385.1| SNF2-related protein [Geobacillus sp. Y412MC61]
 gi|319768373|ref|YP_004133874.1| SNF2-related protein [Geobacillus sp. Y412MC52]
 gi|261377160|gb|ACX79903.1| SNF2-related protein [Geobacillus sp. Y412MC61]
 gi|317113239|gb|ADU95731.1| SNF2-related protein [Geobacillus sp. Y412MC52]
          Length = 924

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 115/494 (23%), Positives = 185/494 (37%), Gaps = 94/494 (19%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLW--GEKSVLVIAPL 55
            L P+Q + VDW++  +R    A     MG GKTV +L  L+Y+      +   L+I P 
Sbjct: 448 TLRPYQQRGVDWLVFLRRFGFGACLADDMGLGKTVQLLAYLTYVKEMERPDTPALLICPT 507

Query: 56  RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT 115
            V  + W  E  R++    + +       K    V        VI   NL  L Q+    
Sbjct: 508 SVIGN-WQKECARFTPDLRVYVHHGPNRAKNDAFVQTAGEADLVITSYNLAHLDQDDLKQ 566

Query: 116 WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
             +  I +DE+  +K+ + +Q     R   K        I L+GTP  N L +LW    F
Sbjct: 567 MHWHVICLDEAQNIKNAQTKQARAIRRLSGK------HKIALSGTPVENRLGELWSIFHF 620

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           L+ G                   +GS     R  A    +KE +A+          A  Q
Sbjct: 621 LNPG------------------YLGSAAEFERRFAGPI-EKEGDARKK--------AALQ 653

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-----------NIEAFNSASKTVK 284
            + +P L+ +        +    K +++ YC L  E            +E    AS   +
Sbjct: 654 ALIRPFLLRRTKTDEAVALNLPDKLEQKEYCPLTAEQAALYEQLVNDTLERAKEASPFAR 713

Query: 285 ---CLQLANG--------AVYYDEEKHWKEVHDEKIKALEVIIE-----KANAAPIIVAY 328
               LQ+ NG        A+Y  E +  + V  E+   LE +IE     + N    ++  
Sbjct: 714 RGLILQMLNGVKQICDHPALYLKERRPRQLV--ERSHKLEKLIELIEQIRTNDESCLIFT 771

Query: 329 H---------------FNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCG 373
                           F+  +  L    P+ +T D+    + E+   K P+      + G
Sbjct: 772 QYVRMGEMIQELLSDLFDEPVLFLHGGVPK-QTRDR---MVDEFQAKKAPIFLLSLKAGG 827

Query: 374 HGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELV 433
            GLNL    N ++ F  WW+       +E     R  + G  + V V+ LI   TI+E +
Sbjct: 828 TGLNLT-AANHVIHFDRWWN-----PAVENQATDRAYRIGQTKFVHVHKLITIGTIEEKI 881

Query: 434 LQRLRTKSTIQDLL 447
            + L  K  + DL+
Sbjct: 882 DEMLEQKQALADLI 895


>gi|312901374|ref|ZP_07760654.1| protein, SNF2 family [Enterococcus faecalis TX0470]
 gi|311291537|gb|EFQ70093.1| protein, SNF2 family [Enterococcus faecalis TX0470]
          Length = 404

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 103/452 (22%), Positives = 186/452 (41%), Gaps = 71/452 (15%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVL-TALSYIHLWGEKSVLVIAPLRVAQSV 61
           L   Q KI+D I  +   A+    G+GKT++ +   L Y    GE  ++V  P ++ +  
Sbjct: 2   LYDFQKKIIDSIDANYLLAM--DTGTGKTITAIHQYLKYSR--GEPILIVAPPQKIKEGG 57

Query: 62  WTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATI 121
           W  ++Q   +F  + IS    +  + T   K    LY       GW V            
Sbjct: 58  WRRDIQAVCDFYKIEISFTELSYGKLTDSYK----LYK------GWFV------------ 95

Query: 122 VVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK- 180
           + DE+  +K+      S+  +A AK   +S  F+ LT TP+ NG  D +   +F+  G  
Sbjct: 96  IFDEAHYIKN----PTSQRGKAAAKLTKQSSHFLLLTATPASNGWEDTYN--YFIMFGYF 149

Query: 181 RLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKP 240
           +  +      A+W        ++G  R    E    E +        ++ I+  + +D P
Sbjct: 150 KSKKEMNDQHAKWGTM-----YLGTRRVPKIEGWLHEEKLYSKYDSFTISISKDEALDLP 204

Query: 241 ILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKH 300
            LI + V   +   K+Y    ++        + E +++ SK      LA+G  YY  +K 
Sbjct: 205 PLIFEDVKFKKS--KEYMTVAKDRVL-----SDEEYDTPSK------LAHGLRYYANQK- 250

Query: 301 WKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQ-----KAFPQGRTLDKDPCTIQ 355
                 +K+   +++ E    + II+ Y++  ++  L+     K F +      +    Q
Sbjct: 251 ------DKLDYAQMLCE-GTESNIIIFYYYQKEIEALKEKIKNKTFFEVNGKHSNLPPKQ 303

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
            W   K  + F    +   G+ LQY  N ++F++  +  +++ Q      + R  + G  
Sbjct: 304 SWKSLKNSVTFVQYMAGSAGIELQY-ANTVIFYTPTYSYQDYSQ-----ALGRAYRNGQT 357

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLL 447
           + V VY  I Q TI++ V Q L  K    + L
Sbjct: 358 KKVTVYRFITQQTIEQAVYQALENKEDFSEEL 389


>gi|257876739|ref|ZP_05656392.1| Snf2 family protein [Enterococcus casseliflavus EC20]
 gi|257810905|gb|EEV39725.1| Snf2 family protein [Enterococcus casseliflavus EC20]
          Length = 1054

 Score = 68.2 bits (165), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 93/428 (21%), Positives = 182/428 (42%), Gaps = 67/428 (15%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV 79
            MG GKTV  ++     +L  EK      + L++AP  +  + W  E++R++    ++ SV
Sbjct: 630  MGLGKTVQTIS-----YLLSEKQEKQKLNALIVAPASLTFN-WQQEIKRFA--PTISASV 681

Query: 80   ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            I+GT ++R   +  PA + + ++ +L   +   +       +++DE+  +K+      +K
Sbjct: 682  ISGTKEEREGQMAQPADVRITSYASLRQDIDAYQA-LDLTCLILDEAQMVKN----SATK 736

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
            TA+AL   + E  +   L+GTP  N L +LW              +FQ  +  +F   Q 
Sbjct: 737  TAQALR--SLEVPQRFALSGTPIENNLEELWS-------------LFQMIMPGFFPNKQ- 780

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD-YQNIDKPILITKKVPLPQPVMKQYH 258
                       KE + +EI   +    L  D      ++ + +       L +   K Y 
Sbjct: 781  ---------KFKELSTQEIAKMIKPFILRRDKRSVLHDLPQKLETNYYSVLTEEQKKIYL 831

Query: 259  KFQRELYCDLQGENIEAFNSASKTV-----KCLQLANGAVYYDEEKHWKEVHDEKIKALE 313
             + R++  ++   +  +F     ++     +  Q+      + E+        E++K L 
Sbjct: 832  AYLRQMREEIAQMDSTSFRKNRISILAGLTRLRQICCDPRLFVEDYEGSSGKLEQVKDL- 890

Query: 314  VIIEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQEWNEGKIP 363
            ++  K N   +++   F S L+ +++   Q         G T  +D  T +  +N G+  
Sbjct: 891  LLAAKENGRRVLLFSQFTSMLSIIEEELAQEGFESFYLRGSTPPQDRLTMVDAFNSGEKD 950

Query: 364  LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
            +      + G GLNL  G + ++ + LWW+       +E     R  + G K  V V+ +
Sbjct: 951  VFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHRIGQKNVVEVWRM 1004

Query: 424  IAQNTIDE 431
            IA+ TI+E
Sbjct: 1005 IAEGTIEE 1012


>gi|150865881|ref|XP_001385272.2| helicase [Scheffersomyces stipitis CBS 6054]
 gi|149387137|gb|ABN67243.2| helicase [Scheffersomyces stipitis CBS 6054]
          Length = 809

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 122/531 (22%), Positives = 204/531 (38%), Gaps = 106/531 (19%)

Query: 3   LAPHQTKIVDWIL---------DHKRCAIWASMGSGKTVSVLTAL--------------S 39
           L PHQ + V ++          + K C +   MG GKT+  +T +              S
Sbjct: 174 LRPHQVEGVKFVYECLMGFRGNNGKGCLLADEMGLGKTLMTITVIWTLCRQNPFIKQPRS 233

Query: 40  YIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTK-------VLK 92
            IH      VL+  P+ +  + W  E ++W   + ++I  + G V    +        L 
Sbjct: 234 TIH-----KVLICCPVSLINN-WKDEFKKWLGMNKLSILTLGGNVSSNDRQDLVSFGNLN 287

Query: 93  TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESE 152
              VL ++N+E +    QEL     F  +V DE  +LKS      +K    L   ++   
Sbjct: 288 VYQVL-IMNYEKVTTYHQELSKIR-FDLLVCDEGHRLKS----SSNKVMNHLT--SFNIP 339

Query: 153 RFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKE 212
           R I LTGTP  N L++ +  I F++ G  LG  F+SF   + N       +       KE
Sbjct: 340 RKILLTGTPIQNDLVEYYTIINFINPGI-LGD-FKSFQKSFINPITRSRDVTCFDPVVKE 397

Query: 213 TAQKEIEAQLSDCCLSLDIADYQNIDKPILITK-KVPLPQPVMKQYHKFQRELYCDLQGE 271
               EI  +L D      +   Q++    L  K  V L  P        Q+ L+  +   
Sbjct: 398 QGL-EISNKLIDITKQFTLRRTQSLLLNYLTEKTDVILYAPPT----DLQKRLFSYII-- 450

Query: 272 NIEAFN-----SASKTVKCL-------QLANGAVYYDEEKHWKEVHDEKIKALEVI---- 315
           N+++FN     SAS T +         +L N      E+  + ++   + + +E++    
Sbjct: 451 NLKSFNELMNDSASTTTQAFTLINLFKKLCNSPSLLLEDNFFSKLIKGEKEEIELLNKNT 510

Query: 316 -----------------IEKANAAPIIVAYHFNS-----------DLARLQKAFPQGRTL 347
                            I   N   ++V+ +  +           DL+ L+      + L
Sbjct: 511 LTTSSGKINILIPLLLEITSFNEKIVLVSNYTKTLDLLEAVLKKLDLSFLRLDGSTAKNL 570

Query: 348 DKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVT 407
                 + ++N+  I +      S G GLNL  G + L+ F   W+     Q + RI   
Sbjct: 571 RNK--LVNQFNKSNINVFLLSSKSGGMGLNL-VGASRLILFDNDWNPSVDLQSMSRI--- 624

Query: 408 RQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETIHV 458
              + G  R  F+Y ++   TIDE + QR   KS +    L+   + T  V
Sbjct: 625 --HRDGQTRPCFIYRILTTGTIDEKIFQRQLMKSKLSSKFLDNESQSTSDV 673


>gi|329954230|ref|ZP_08295324.1| helicase protein [Bacteroides clarus YIT 12056]
 gi|328527936|gb|EGF54922.1| helicase protein [Bacteroides clarus YIT 12056]
          Length = 562

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 111/480 (23%), Positives = 195/480 (40%), Gaps = 90/480 (18%)

Query: 6   HQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSE 65
           +Q + + + L HKRC      G GKT   L A+  + +      LVI P  +  + W  E
Sbjct: 108 YQKEGIAYALSHKRCIFGDQPGLGKT---LQAIGTVTIAKSYPCLVICPAALKIN-WQRE 163

Query: 66  VQRWSNFSHMNISVITGTVKQRTKVLKTPAV-LYVINFENLG-WLVQELKGTWPFA---- 119
            ++++    + +        QR   ++T    +++ N+E+L  + V ++K    F     
Sbjct: 164 FKKFAGKQALILDDKNKNTWQR--FIETKCCDIFITNYESLKKFFVLDVKDDVRFTMKSI 221

Query: 120 ----------TIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDL 169
                     ++++DES K KS + +Q SK    + K     E  +ELTGTP  N   DL
Sbjct: 222 SFDPRITLFKSVIIDESHKCKSTKTQQ-SKFVEGICKG---KEFILELTGTPVVNDNTDL 277

Query: 170 WGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL 229
             Q+  + + +  G  +++F  R+ N  +  S++            KE+  +L + C   
Sbjct: 278 IQQLKIMGRLEDFGG-YKTFTERFCNGPKKASNL------------KELNWRLWNTC--- 321

Query: 230 DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLA 289
               +   +K  ++T+   LP    +QY   + ++   L+ E  E     S  ++ L++ 
Sbjct: 322 ----FFRREKAKVLTQ---LPDKT-RQY--IEMDITTRLEYEKAE-----SDLIQYLRVF 366

Query: 290 NGAVYYDEEKHWKEVHDE---------------KIKALEVIIEKA--NAAPIIVAYHFNS 332
             A   D+EK  K +  E               KIKA    I         +IV  +   
Sbjct: 367 KNA---DDEKIAKSMRGEVMVRMGILKAISARGKIKAAAEFIHDVIDGGEKLIVFAYLKE 423

Query: 333 DLARLQKAFPQGRTLDKDPCTIQEW-------NEGKIPLLFAHPASCGHGLNLQYGGNIL 385
            +  L+K FPQ  T+  +   I++        N     L+  +  S G GL L     + 
Sbjct: 424 VVMELKKMFPQAVTVTGEDNAIRKQMSVDAFQNNPDCTLIILNYKSGGTGLTLTASSRV- 482

Query: 386 VFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
            F    W   + +Q  +R       + G K  V  YY + +NTIDE +   ++ K  I +
Sbjct: 483 AFIEFPWTFSDCEQAEDR-----AHRNGQKNNVNCYYFLGKNTIDEYMYDVIQRKKGIAN 537


>gi|327313991|ref|YP_004329428.1| SNF2 family N-terminal domain-containing protein [Prevotella
            denticola F0289]
 gi|326946179|gb|AEA22064.1| SNF2 family N-terminal domain protein [Prevotella denticola F0289]
          Length = 1340

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 106/440 (24%), Positives = 189/440 (42%), Gaps = 48/440 (10%)

Query: 26   MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK 85
            MG GKTV     L  +    + + L++AP  V  + W +E++R++    +N++V+  +  
Sbjct: 914  MGLGKTVQTTALL--LEQQEKGASLIVAPASVVPN-WCNELRRFA--PTLNVTVLNQSED 968

Query: 86   QRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
            +   + +  A   +I    L  + QE      +  + +DE+  +K+   +  SK A  L 
Sbjct: 969  RSKDIKEAKAGDIIIITYALLNIQQEDLTAHEWNVVCLDEAHTIKNANTKM-SKAAMRL- 1026

Query: 146  KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGA 205
                +++R + LTGTP  N L +LW    F++ G  LG   Q F  ++         I  
Sbjct: 1027 ----QAQRRVILTGTPIQNHLAELWNLFQFINPG-LLGSAEQ-FKKKF---------ILP 1071

Query: 206  VRYTAKETAQKEIEAQLSDCCLSLDIADY-QNIDKPILITKKVPLPQPVMKQYHKFQREL 264
            +     +  Q ++   +S   L    ++    + +   I   V L    M  Y   +RE 
Sbjct: 1072 IEGDNDKNRQSQLRKLISPFLLRRTKSEVIDELPEKNEIKLPVELSSDEMAMYEVRRRET 1131

Query: 265  YCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKAL----EVIIEKAN 320
               ++    +  ++ ++  +  Q+A      D  + WK +   K+ A     E + E  N
Sbjct: 1132 EERVRANVGDKMSTLAEITRLRQMACSCSLVD--RKWK-LPSSKVLAFIDLAESLDESGN 1188

Query: 321  AAPIIVAYHFNS---------DLARLQKAFPQGRT-LDKDPCTIQEWNEGKIPLLFAHPA 370
             A  +V   F S         D A+L   +  G T +      ++++  GK P       
Sbjct: 1189 RA--LVFSQFTSFFEEVKQAMDKAKLSYLYLDGSTPMAMREKLVKDFQTGKCPFFLISLK 1246

Query: 371  SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTID 430
            + G GLNL  G N ++    WW+       IE+    R  + G K+ V VY+LI+Q+TI+
Sbjct: 1247 AGGLGLNLT-GANYVIHLDPWWN-----PAIEQQATDRAYRIGQKQNVTVYHLISQHTIE 1300

Query: 431  ELVLQRLRTKSTIQDLLLNA 450
            E +L+  +TK  + D LL  
Sbjct: 1301 EKILRLHKTKRNLSDSLLEG 1320


>gi|295102130|emb|CBK99675.1| Superfamily II DNA/RNA helicases, SNF2 family [Faecalibacterium
            prausnitzii L2-6]
          Length = 1109

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 104/442 (23%), Positives = 188/442 (42%), Gaps = 57/442 (12%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK-SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
            MG GKTV VL+ L  +   G+    L++ P  +  + W  E Q+++    ++  V+ G  
Sbjct: 676  MGLGKTVQVLSYLLAMKQNGQTLPSLIVCPASLVLN-WAEECQKFT--PELSCVVVDGDA 732

Query: 85   KQRTKVLKT-PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARA 143
              R ++ ++ PA   V+   +L    + L     F   ++DE+  +K+   ++     + 
Sbjct: 733  AHRAELAESWPAADLVVTSYDLLRRDEALYEGQEFYACILDEAQAIKNHTTQKYKAVCKV 792

Query: 144  LAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHI 203
             ++      RF  LTGTP  N L +LW    FL  G      ++SF +R+          
Sbjct: 793  RSR-----VRFA-LTGTPVENRLGELWSIFSFLMPGYL--PPYKSFCSRFEKPIVQEEDQ 844

Query: 204  GAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPL-------------- 249
             AVR   + T    +    SD    L     +N+ +  L  ++  L              
Sbjct: 845  TAVRRLNQLTGPFILRRMKSDVLKELP-PKTENVYRIELEEEQRKLYLAAVVDAREKLQA 903

Query: 250  --PQPVMKQYHKFQR--ELYCD--LQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKE 303
              P+  M  +    R  E+ CD  L  +N E    ++K   C +L + AV   E  H   
Sbjct: 904  AKPEDKMAVFAVLMRLREICCDPRLIADNWEG--GSAKLDACAELVSSAV---EGGHRIL 958

Query: 304  VHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIP 363
            +  +    LE++ ++ +A  I    HF      LQ + P+    +     ++ +N G++ 
Sbjct: 959  LFSQFTSMLELLAKRLDAEGI---SHFT-----LQGSTPKPVRAE----LVRRFNGGEVS 1006

Query: 364  LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
            +      + G GLNL    +I++ +  WW++    Q  +R       + G +  V VY L
Sbjct: 1007 VFLISLRAGGTGLNLT-AADIVIHYDPWWNVAAQNQATDRA-----YRIGQQNPVQVYKL 1060

Query: 424  IAQNTIDELVLQRLRTKSTIQD 445
            IAQ+TI+E +++  + K ++ D
Sbjct: 1061 IAQDTIEEKIVELQQAKQSLAD 1082


>gi|315639730|ref|ZP_07894869.1| Snf2 family protein [Enterococcus italicus DSM 15952]
 gi|315484507|gb|EFU74964.1| Snf2 family protein [Enterococcus italicus DSM 15952]
          Length = 1055

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 95/427 (22%), Positives = 183/427 (42%), Gaps = 65/427 (15%)

Query: 26   MGSGKTVSVLTALSYIHLWGEKSV------LVIAPLRVAQSVWTSEVQRWSNFSHMNISV 79
            MG GKT   L A+ Y  L  EK        L++AP  +  + W  E+++++    ++  V
Sbjct: 632  MGLGKT---LQAICY--LLSEKQANESLQALIVAPASLTYN-WLQEIRKFA--PSLDAVV 683

Query: 80   ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            + GT ++R  +L+  A +Y+ ++ +L   + + +       +++DE+  +K+     G+K
Sbjct: 684  VNGTKEEREALLQQKADIYITSYASLRQDIDQYQAR-ALEYLILDEAQMVKN----SGTK 738

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
            TA+AL +     +RF  L+GTP  N L +LW     +  G    +     V R F+  +I
Sbjct: 739  TAQAL-RSLSVRQRFA-LSGTPIENNLDELWSLFQLIMPGFFPAKA----VYRQFSAEKI 792

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHK 259
               I           +++    LSD    +++  Y       L T +  +       Y  
Sbjct: 793  AQMIQPF------VLRRDKATVLSDLPEKIEMNYYST-----LTTDQKTI-------YLA 834

Query: 260  FQRELYCDLQGENIEAFNSASKTV-----KCLQLANGAVYYDEEKHWKEVHDEKIKALEV 314
            + R++  ++   +   F     ++     +  Q+      + +E        E++K L +
Sbjct: 835  YLRQMQEEISQMDSSTFKKNRISILAGLTRLRQICCDPRLFVDEYQGGSGKLEQVKDL-L 893

Query: 315  IIEKANAAPIIVAYHFNS---------DLARLQKAFPQGRTLDKDPC-TIQEWNEGKIPL 364
            +  K N   +++   F S         D   L   + +G T  KD    +  +NEG+  +
Sbjct: 894  LAAKENKRRVLLFSQFTSMLSLIADELDEMGLSHFYLRGSTPPKDRIEMVDAFNEGEADV 953

Query: 365  LFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLI 424
                  + G GLNL  G N ++ + LWW+       +E     R  + G K+ V ++ +I
Sbjct: 954  FLISLKAGGTGLNLT-GANTVILYDLWWN-----PAVEEQAAGRAHRMGQKQVVEIWRMI 1007

Query: 425  AQNTIDE 431
            ++ TI+E
Sbjct: 1008 SEGTIEE 1014


>gi|317498269|ref|ZP_07956568.1| SNF2 family domain-containing protein [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316894478|gb|EFV16661.1| SNF2 family domain-containing protein [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 438

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 100/434 (23%), Positives = 186/434 (42%), Gaps = 66/434 (15%)

Query: 47  KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT-------PAVLYV 99
           + VL+IAP  V  +VW  E + ++ F +     + G  K+R K L            + V
Sbjct: 21  EKVLIIAPTSVV-AVWPKEFKEFAEFKY-TCKTLLGAKKERIKALDDLMQFPFKAMKVAV 78

Query: 100 INFENLGWL--VQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERF-IE 156
           IN+E+  W   ++E    +    I+ DES ++K+    Q SK    L   A    R+ + 
Sbjct: 79  INYEST-WREGIKEKLQEFDADLIICDESQRIKTHDAAQ-SKAVHELGDQA----RYKLI 132

Query: 157 LTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARW-----FNTTQIGSHIGAVRYTAK 211
           L+GTP  N  ID++ Q  FLD     G+ F +F  ++     FN  QI  +         
Sbjct: 133 LSGTPVQNNAIDIFSQYRFLD-SSVFGKNFYAFKNKYAIMGGFNRKQIIGY--------- 182

Query: 212 ETAQKEIEAQL-SDCCLSLDIADYQNIDKP--ILITKKVPLPQPVMKQYHKFQRELYCDL 268
               K+++  +  +  ++  I   + ID P      +K+   +   + Y + +R+ Y DL
Sbjct: 183 ----KDLDGLIKKEHSIAFRITKDEAIDLPEQTFEVRKIAFDKKDRELYDRIKRDSYADL 238

Query: 269 Q-GENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEK---ANAAPI 324
             G++I A    +K ++  QL  G +  D+ +    V+  K+ AL  IIE     +   +
Sbjct: 239 DGGDHITATTVLTKLLRLQQLTGGFLLQDDSETPVLVNKAKLNALADIIEDYVIGSEKKL 298

Query: 325 IVAYHF----NSDLARLQKAFPQGR-------TLDKD--PCTIQEWNEGKIPLLF-AHPA 370
           ++   F     + +  + K  P+ +        + K+     ++++ E    ++F     
Sbjct: 299 VIFARFIPEVKAIIEMVDKLLPKNKKQVAIYGDIKKELRGGLVKQFQEDPDTMVFVGQID 358

Query: 371 SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY-LIAQNTI 429
           + G G+ L    +  V++S  ++   + Q + RI    QR       V  Y  L  + T+
Sbjct: 359 TAGTGITLT-AADTCVYYSKNYNYATYSQSLSRIHRIGQRN------VCTYIDLEVEKTV 411

Query: 430 DELVLQRLRTKSTI 443
           DE++ + L  K  +
Sbjct: 412 DEMINKALSKKEDM 425


>gi|291520743|emb|CBK79036.1| Superfamily II DNA/RNA helicases, SNF2 family [Coprococcus catus
            GD/7]
          Length = 1096

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 103/466 (22%), Positives = 182/466 (39%), Gaps = 87/466 (18%)

Query: 26   MGSGKTVSVLTALSYIHL-------WGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNIS 78
            MG GKT+ ++T L +  L        G    L+I P  +  + W SE++ ++    +   
Sbjct: 657  MGLGKTLQIITLLEHTRLTAAERTDGGHPVSLIICPSSLVYN-WDSEIEHFA--PALKTL 713

Query: 79   VITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK--GTWPFATIVVDESTKLKSFRLRQ 136
            +ITGT ++R  +L T A  Y +   +   L +++       F   ++DE+  +K+ R   
Sbjct: 714  LITGTAQERQDLL-THAADYDVLITSYDMLKRDITYYDALHFQYQIIDEAQYIKNHR--- 769

Query: 137  GSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKG----------------- 179
             ++ AR++   +  S     LTGTP  N L +LW    +L  G                 
Sbjct: 770  -TQAARSVC--SIHSVTRFALTGTPIENRLSELWSIFEYLMPGYLYPYAHFRSELEQPIV 826

Query: 180  --------KRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
                     RL ++ + F+ R   T         V     +  +  + AQ+++    L +
Sbjct: 827  ESKDPIATTRLQQLVRPFIMRRLKTD--------VLKELPDKLEHAVYAQMTEEQQKLYV 878

Query: 232  ADYQNIDKPILITKKVPLPQPVMKQYHKFQ--------RELYCDLQGENIEAFNSASKTV 283
            A+       + + K++      M +  K Q        R+L CD           ++K  
Sbjct: 879  AN------AVQLQKELESQNDSMFKASKIQILAELTKLRQLCCDPALIYKNYHGGSAKLD 932

Query: 284  KCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQ 343
             C+QL   A         K +   +  ++  IIE       I+ Y  +      Q+    
Sbjct: 933  TCIQLIQNA----RAGGHKILLFSQFTSMLDIIEHRLKLEHILYYRLDGSTKSEQRTR-- 986

Query: 344  GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
                      +  +NE  IP+      + G GLNL  G +I++ +  WW+     Q    
Sbjct: 987  ---------LVNAFNENAIPVFLISLKAGGTGLNLT-GADIVIHYDPWWNAAAQNQ---- 1032

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN 449
                R  + G    V VY LIA++TI+E +L+    K  + D +L+
Sbjct: 1033 -ATDRAHRIGQTHTVTVYKLIARHTIEEKILELQENKKALSDQILS 1077


>gi|229169956|ref|ZP_04297649.1| Helicase, SNF2/RAD54 [Bacillus cereus AH621]
 gi|228613474|gb|EEK70606.1| Helicase, SNF2/RAD54 [Bacillus cereus AH621]
          Length = 855

 Score = 67.8 bits (164), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 201/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   V+W+L  ++    A     MG GK++  +T L Y      ++   L++AP  
Sbjct: 388 LRPYQQHGVEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYAKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++    + + +  G+ + + +  K    +   ++    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PSLRVQLHYGSSRSKDESFKDFLQSADVILTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA---LEVI--IEKANAAPIIVAY 328
           +         K  Q+ N    Y +E+  + + +  +K    +E+I  I+  N + +I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKEEEPQNIVERSMKTKTVMELIENIKDQNESCLIFTQ 711

Query: 329 HF---NSDLARLQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           +    N   + L++ F Q      G    K+    I+++  G   +      + G GLNL
Sbjct: 712 YIGMGNMLKSMLEETFGQRVLFLNGSVPKKERDKMIEQFQNGTYDIFILSLKAGGTGLNL 771

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 772 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 825

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 826 RKQSLNNAVITS 837


>gi|256028234|ref|ZP_05442068.1| SWF/SNF family helicase [Fusobacterium sp. D11]
 gi|289766166|ref|ZP_06525544.1| SWF/SNF family helicase [Fusobacterium sp. D11]
 gi|289717721|gb|EFD81733.1| SWF/SNF family helicase [Fusobacterium sp. D11]
          Length = 899

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 97/458 (21%), Positives = 193/458 (42%), Gaps = 60/458 (13%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D+   A  A  MG GKT+  +  L+ +H   +K  +VI P  +  + W +E++R+S 
Sbjct: 459 YLTDNNLGACLADDMGLGKTLQAIALLTNLHEEKKKKSMVIMPKSLIYN-WENEIKRFS- 516

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
              + + V  G  +  + + K   +L        G +  +++      F  +V+DES  +
Sbjct: 517 -PKLKVGVYYGINRDFSLLKKVDIILTT-----YGTIRNDIENLLEQKFDLLVLDESQNI 570

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +++ + L+GTP  N L++L+    FL+  +  G V Q F
Sbjct: 571 KNI----NSQTTKAVL--LLNAKKRVALSGTPIENNLLELYSLFRFLN-PEMFGSV-QEF 622

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
              +    Q  S    +    K+         +KE+ A L D    L   D  +      
Sbjct: 623 TNDYIVPIQKYSDTSTIEELRKKIYPFLLRRVKKEVLADLPDKIEKLVYVDMND------ 676

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASK--TVKCLQLANGAVYYDEEKH 300
                       +++++ +R+ Y  L  +N  +  +  K   ++ +      V   E + 
Sbjct: 677 ----------EHRRFYEERRKYYYSLLEKNTLSQGNFDKFFVLQAINELRHIVSSPELES 726

Query: 301 WKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKD 350
            K +  +K   +E +IE   N   ++V  ++ S +  +  +  +         G+T D+ 
Sbjct: 727 KKIISSKKEVLIENVIEAIENNHKVLVFVNYLSSIESICDSLKENKIKYLKMTGQTKDRQ 786

Query: 351 PCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 410
               +  N+ +  +      + G GLNL     I ++   WW+       +E   + R  
Sbjct: 787 NLVDKFQNDSRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----TTVENQAIDRAY 840

Query: 411 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           + G  + VF Y +I +NTI+E +L+    K+ + D L+
Sbjct: 841 RLGQDKTVFAYKMIMRNTIEEKILKLQEIKNKLLDDLI 878


>gi|325853079|ref|ZP_08171228.1| SNF2 family N-terminal domain protein [Prevotella denticola CRIS
            18C-A]
 gi|325484453|gb|EGC87374.1| SNF2 family N-terminal domain protein [Prevotella denticola CRIS
            18C-A]
          Length = 1302

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 106/440 (24%), Positives = 190/440 (43%), Gaps = 48/440 (10%)

Query: 26   MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK 85
            MG GKTV     L  +    + + L++AP  V  + W +E++R++    +N++V+  +  
Sbjct: 876  MGLGKTVQTTALL--LEQQEKGASLIVAPASVVPN-WCNELRRFA--PTLNVTVLNQSED 930

Query: 86   QRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALA 145
            +   + +  A   +I    L  + QE      +  + +DE+  +K+   +  SK A  L 
Sbjct: 931  RSKDIKEAKAGDIIIITYALLNIQQEDLTAREWNVVCLDEAHTIKNANTKM-SKAAMRL- 988

Query: 146  KPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGA 205
                +++R + LTGTP  N L +LW    F++ G  LG   Q F  ++         I  
Sbjct: 989  ----QAQRRVILTGTPIQNHLAELWNLFQFINPG-LLGSAEQ-FKKKF---------ILP 1033

Query: 206  VRYTAKETAQKEIEAQLSDCCLSLDIADY-QNIDKPILITKKVPLPQPVMKQYHKFQREL 264
            +     +  Q ++   +S   L    ++    + +   I   V L    M  Y   +RE 
Sbjct: 1034 IEGDNDKNRQSQLRKLISPFLLRRTKSEVIDELPEKNEIKLPVELSSDEMAMYEVRRRET 1093

Query: 265  YCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKAL----EVIIEKAN 320
               ++    +  ++ ++  +  Q+A      D  + WK +   K+ A     E + E  N
Sbjct: 1094 EERVRANVGDKMSTLAEITRLRQMACSCSLVD--RKWK-LPSSKVLAFIDLAESLDESGN 1150

Query: 321  AAPIIVAYHFNSDLARLQKAFPQGRT----LDKD-PCTIQE-----WNEGKIPLLFAHPA 370
             A  +V   F S    +++A  + +     LD   P  ++E     +  GK P       
Sbjct: 1151 RA--LVFSQFTSFFEEVKQAMDKAKLSYLYLDGSMPMAMREKLVKDFQTGKCPFFLISLK 1208

Query: 371  SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTID 430
            + G GLNL  G N ++    WW+       IE+    R  + G K+ V VY+LI+Q+TI+
Sbjct: 1209 AGGLGLNLT-GANYVIHLDPWWN-----PAIEQQATDRAYRIGQKQNVTVYHLISQHTIE 1262

Query: 431  ELVLQRLRTKSTIQDLLLNA 450
            E +L+  +TK  + D LL  
Sbjct: 1263 EKILRLHKTKRNLSDSLLEG 1282


>gi|257126260|ref|YP_003164374.1| non-specific serine/threonine protein kinase [Leptotrichia buccalis
            C-1013-b]
 gi|257050199|gb|ACV39383.1| Non-specific serine/threonine protein kinase [Leptotrichia buccalis
            C-1013-b]
          Length = 1172

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 104/482 (21%), Positives = 206/482 (42%), Gaps = 62/482 (12%)

Query: 1    MNLAPHQTKIVDWI---LDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEK-SVLVIAPL 55
            +NL P+Q    +W+    D     I A  MG GKT+  ++ L+ I+      S L+I P 
Sbjct: 713  VNLFPYQKLGFNWLKNMYDIGFGGILADDMGLGKTLQTISLLNEIYQENRNFSALIIVPS 772

Query: 56   RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVIN-FENLGWLVQELKG 114
             +  + W  E+ +++  S    ++I GT  QR +++   +  ++I  ++ L   ++E K 
Sbjct: 773  SLLYN-WKEEIIKFTGISP---TLIEGTAAQRKEIISRKSKGFMITTYQALRNDIEEYKN 828

Query: 115  TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
               F  +V+DE+  +K+      S+  +A+ K    S+    LTGTP  N +++LW    
Sbjct: 829  -REFDVVVLDEAQNIKT----TTSQIKKAVMK--INSKVNFALTGTPVENNILELWSIFD 881

Query: 175  F-----LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSL 229
            F     LD   +  + ++  +    N+++I +    +        +KE+  +L D     
Sbjct: 882  FIIPGYLDNLTKFKKTYKEAIVNP-NSSKIHNLREIIAPFLLRRTKKEVLTELPD----- 935

Query: 230  DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLA 289
                   I+  +++T      Q  M    K + E+    + EN       +   K  Q+ 
Sbjct: 936  ------KIESNMVVTLSNEQKQLYMSYIKKAKSEMKKFNENEN-NRMKILAILTKLRQIC 988

Query: 290  NGAVYYDEEKHWKEVHDEKIKALEVIIE-----KANAAPIIVAYHFNSDLARLQKA---- 340
            N    +      KE +  ++  LEV+ +       N   +++   F   L  ++K     
Sbjct: 989  NSPTLF------KEDYKGEVAKLEVLRDLLPDITENGHRLLIFSQFVGTLKEIEKELVNM 1042

Query: 341  -----FPQGRTLDKDPCTI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDL 394
                 +  G    K+   I  ++N G+  ++     + G GLNL  G ++++ +  WW++
Sbjct: 1043 GIEYFYIDGSVKSKERVDICNKFNAGERQVVLISLKAGGTGLNL-VGADVVIHYDPWWNI 1101

Query: 395  EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454
                  +E     R  + G K++V V  L+ + TI+E +++    K  + + LL +   E
Sbjct: 1102 -----AVENQASDRAYRIGQKKSVQVIKLVTEGTIEEKIIKIQENKRQLSENLLESKDGE 1156

Query: 455  TI 456
             +
Sbjct: 1157 KV 1158


>gi|260495666|ref|ZP_05815790.1| SWF/SNF family helicase [Fusobacterium sp. 3_1_33]
 gi|260196849|gb|EEW94372.1| SWF/SNF family helicase [Fusobacterium sp. 3_1_33]
          Length = 899

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 97/458 (21%), Positives = 193/458 (42%), Gaps = 60/458 (13%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D+   A  A  MG GKT+  +  L+ +H   +K  +VI P  +  + W +E++R+S 
Sbjct: 459 YLTDNNLGACLADDMGLGKTLQAIALLTNLHEEKKKKSMVIMPKSLIYN-WENEIKRFS- 516

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
              + + V  G  +  + + K   +L        G +  +++      F  +V+DES  +
Sbjct: 517 -PKLKVGVYYGINRDFSLLKKVDIILTT-----YGTIRNDIENLLEQKFDLLVLDESQNI 570

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +++ + L+GTP  N L++L+    FL+  +  G V Q F
Sbjct: 571 KNI----NSQTTKAVL--LLNAKKRVALSGTPIENNLLELYSLFRFLN-PEMFGSV-QEF 622

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
              +    Q  S    +    K+         +KE+ A L D    L   D  +      
Sbjct: 623 TNDYIVPIQKYSDTLTIEELRKKIYPFLLRRVKKEVLADLPDKIEKLVYVDMND------ 676

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASK--TVKCLQLANGAVYYDEEKH 300
                       +++++ +R+ Y  L  +N  +  +  K   ++ +      V   E + 
Sbjct: 677 ----------EHRRFYEERRKYYYSLLEKNTSSQGNFDKFFVLQAINELRHIVSSPELES 726

Query: 301 WKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKD 350
            K +  +K   +E +IE   N   ++V  ++ S +  +  +  +         G+T D+ 
Sbjct: 727 KKIISSKKEVLIENVIEAIENNHKVLVFVNYLSSIESICDSLKENKIKYLKMTGQTKDRQ 786

Query: 351 PCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 410
               +  N+ +  +      + G GLNL     I ++   WW+       +E   + R  
Sbjct: 787 NLVDKFQNDSRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----TTVENQAIDRAY 840

Query: 411 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           + G  + VF Y +I +NTI+E +L+    K+ + D L+
Sbjct: 841 RLGQDKTVFAYKMIMRNTIEEKILKLQEIKNKLLDDLI 878


>gi|229063904|ref|ZP_04200205.1| Helicase, SNF2/RAD54 [Bacillus cereus AH603]
 gi|229136057|ref|ZP_04264813.1| Helicase, SNF2/RAD54 [Bacillus cereus BDRD-ST196]
 gi|228647378|gb|EEL03457.1| Helicase, SNF2/RAD54 [Bacillus cereus BDRD-ST196]
 gi|228716374|gb|EEL68082.1| Helicase, SNF2/RAD54 [Bacillus cereus AH603]
          Length = 855

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 201/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   V+W+L  ++    A     MG GK++  +T L Y      ++   L++AP  
Sbjct: 388 LRPYQQHGVEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYAKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++    + + +  G+ + + +  K    +   ++    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PSLRVQLHYGSNRSKDESFKDFLQSADVILTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA---LEVI--IEKANAAPIIVAY 328
           +         K  Q+ N    Y +E+  + + +  +K    +E+I  I+  N + +I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKEEEPQNIVERSMKTKTVMELIENIKDQNESCLIFTQ 711

Query: 329 HF---NSDLARLQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           +    N   + L++ F Q      G    K+    I+++  G   +      + G GLNL
Sbjct: 712 YIGMGNMLKSMLEETFGQRVLFLNGSVPKKERDKMIEQFQNGTYDIFILSLKAGGTGLNL 771

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 772 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 825

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 826 RKQSLNNAVITS 837


>gi|150388431|ref|YP_001318480.1| non-specific serine/threonine protein kinase [Alkaliphilus
            metalliredigens QYMF]
 gi|149948293|gb|ABR46821.1| Non-specific serine/threonine protein kinase [Alkaliphilus
            metalliredigens QYMF]
          Length = 1141

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 99/433 (22%), Positives = 181/433 (41%), Gaps = 52/433 (12%)

Query: 25   SMGSGKTVSVLTAL-SYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
             MG GKT+ +LT L       G+ + L+++P  +  + W +EV++++    + I  I G+
Sbjct: 706  DMGLGKTLQILTYLVDEKEKRGQGTALIVSPTSLVYN-WIAEVEKFT--PELRIKAIVGS 762

Query: 84   VKQRTKVLKT-PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTAR 142
              +R +++K       +I    L     EL  T  F   ++DE+  +K+  + Q +K  +
Sbjct: 763  KNEREEIMKEIDEYDIIITSYPLIRRDAELYETRSFRCCILDEAQHIKN-PVSQNAKAVK 821

Query: 143  ALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRL------GRVFQSFVARWFNT 196
            A+      + RF  LTGTP  N L +LW    F+  G  L      GR F+  + +  ++
Sbjct: 822  AIRA----THRFA-LTGTPIENSLTELWSIFDFVMPGYLLSHHKFKGR-FEKPIVKDRDS 875

Query: 197  TQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ 256
              + S    +R       ++++  +L +   S  +A+     K + +     +   + ++
Sbjct: 876  EALASLGKLIRPFVLRRMKRDVLQELPEKIESKMVAELTEDQKKLYLAYLKQIKGQIQEE 935

Query: 257  YHK--FQRELYCDLQGEN------------IEAFNSASKTVKCLQLANGAVYYDEEKHWK 302
              +  F+R     L G              +E +   S  +  L+    A    E  H  
Sbjct: 936  IEQNGFERSQMKILAGLTRLRQICCHPSLFVENYEGGSGKLDLLEEVVAASL--EAGHRI 993

Query: 303  EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKI 362
             +  +    L++I EK +   I  AY        L  + P    ++     ++E+NEGK 
Sbjct: 994  LLFSQFTSMLKMIREKLDQQGIEYAY--------LDGSTP----MEARGEIVKEFNEGKG 1041

Query: 363  PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
             +      + G GLNL  G + ++ F  WW+       +E     R  + G K  V V  
Sbjct: 1042 SIFLISLKAGGTGLNLT-GADTVIHFDPWWN-----PAVEDQATDRAYRIGQKNKVHVMK 1095

Query: 423  LIAQNTIDELVLQ 435
             IAQ TI+E + +
Sbjct: 1096 FIAQGTIEEKIFK 1108


>gi|47459148|ref|YP_016010.1| SWF/SNF family helicase [Mycoplasma mobile 163K]
 gi|47458477|gb|AAT27799.1| swf/snf family helicase-like protein [Mycoplasma mobile 163K]
          Length = 958

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 105/484 (21%), Positives = 198/484 (40%), Gaps = 109/484 (22%)

Query: 26  MGSGKTVSVLTALSYIHLWG--EKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
           MG GKT+  +  L  ++ +   +K  +VI P  +  + W +E +++S    + I VI G 
Sbjct: 525 MGLGKTIQTIALLDNLYNYENIKKPSIVICPSSLIYN-WKNEFKKFS--EKLKIVVIDGK 581

Query: 84  VKQRTKVL---KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKT 140
              RTK++   +   ++++ ++       +E +    F     DE   +K++ L + +K 
Sbjct: 582 KNLRTKLINDNRDNNIIFITSYHQFARDSKEFENV-EFYCSFADEGQMIKNY-LTKFTKE 639

Query: 141 ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLG-----RVF--------- 186
            + +        RF  L+GTP  N L++LW    F+     L      RVF         
Sbjct: 640 IKKINSKY----RF-ALSGTPLENNLLELWSIFDFILPNYLLSKNAYKRVFYKPFLEGNT 694

Query: 187 -------QSFVARWFNTTQIGS----HIGAVRYTAKETAQKEIEAQLSDCCLSLDI---- 231
                    F+ R   +  + S     I  ++   K   +   + +LS    SLDI    
Sbjct: 695 KHLLAKINPFILRRLKSEVLDSLSDKEIKVIKIKQKSDEKTFYQKELSKIKYSLDILKNN 754

Query: 232 ADYQNIDKPILITK-----KVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCL 286
           +     +K +++ K     K+    P +K                  + F+++ K   C+
Sbjct: 755 SSLTTNNKHLIVLKAINHLKIIASSPFVKS-----------------DKFDTSEKLNYCI 797

Query: 287 QLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQ--- 343
            L                    IK+++++ +K     +++   F  ++   +K F +   
Sbjct: 798 NL--------------------IKSIKLLKQK-----VLIFTQFTKNIPFFEKNFIKSNI 832

Query: 344 ------GRTLDKDPCTIQEW-NEGK-IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLE 395
                 G+T  K+   I E+ NE   I +L     +   GLNL    N+ + + +WW+  
Sbjct: 833 KYDIISGKTNKKERFKITEYFNESSDIDVLIISLRAGSLGLNLTSANNV-ILYDIWWN-- 889

Query: 396 EHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL-NALKKE 454
              Q +E   + R  + G KR V V+ LI ++TI+E V +    K  I D++L N+L+ +
Sbjct: 890 ---QSVESQAIDRVHRIGQKRGVNVFKLIMKDTIEEKVFELQSQKQKIIDIVLENSLETK 946

Query: 455 TIHV 458
            I +
Sbjct: 947 NIDL 950


>gi|297531489|ref|YP_003672764.1| SNF2-related protein [Geobacillus sp. C56-T3]
 gi|297254741|gb|ADI28187.1| SNF2-related protein [Geobacillus sp. C56-T3]
          Length = 924

 Score = 67.4 bits (163), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 116/493 (23%), Positives = 186/493 (37%), Gaps = 92/493 (18%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLW--GEKSVLVIAPL 55
            L P+Q + VDW++  +R    A     MG GKTV +L  L+Y+      +   L+I P 
Sbjct: 448 TLRPYQQRGVDWLVFLRRFGFGACLADDMGLGKTVQLLAYLTYVKEMERPDTPALLICPT 507

Query: 56  RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT 115
            V  + W  E  R++    + +       K    V        VI   NL  L Q+    
Sbjct: 508 SVIGN-WQKECARFTPDLRVYVHHGPNRAKNDAFVQTAGEADLVITSYNLAHLDQDDLKQ 566

Query: 116 WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
             +  I +DE+  +K+ + +Q     R   K        I L+GTP  N L +LW    F
Sbjct: 567 MHWHVICLDEAQNIKNAQTKQARAIRRLSGK------HKIALSGTPVENRLGELWSIFHF 620

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           L+ G                   +GS     R  A    +KE +A+          A  Q
Sbjct: 621 LNPG------------------YLGSAAEFERRFAGPI-EKEGDARKK--------AALQ 653

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-----------NIEAFNSASKTVK 284
            + +P L+ +        +    K +++ YC L  E            +E    AS   +
Sbjct: 654 ALIRPFLLRRTKTDEAVALNLPDKLEQKEYCPLTAEQAALYEQLVNDTLERAKEASPFAR 713

Query: 285 ---CLQLANG--------AVYYDEEKHWKEVHDEKIKALEVIIE-----KANAAPIIVAY 328
               LQ+ NG        A+Y  E +  + V  E+   LE +IE     + N    ++  
Sbjct: 714 RGLILQMLNGVKQICDHPALYLKERRPRQLV--ERSHKLEKLIELIEQIRTNDESCLIFT 771

Query: 329 HFN----------SDLARLQKAFPQG----RTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
            +           SDL   +  F  G    +T D+    + E+   K P+      + G 
Sbjct: 772 QYVRMGEMIQELLSDLFDERVLFLHGGVPKQTRDR---MVDEFQAKKAPIFLLSLKAGGT 828

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ F  WW+       +E     R  + G  + V V+ LI   TI+E + 
Sbjct: 829 GLNLTA-ANHVIHFDRWWN-----PAVENQATDRAYRIGQTKFVHVHKLITIGTIEEKID 882

Query: 435 QRLRTKSTIQDLL 447
           + L  K  + D++
Sbjct: 883 EMLEQKQALADII 895


>gi|296327606|ref|ZP_06870151.1| SWF/SNF family helicase [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
 gi|296155280|gb|EFG96052.1| SWF/SNF family helicase [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
          Length = 899

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 95/458 (20%), Positives = 190/458 (41%), Gaps = 60/458 (13%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D+   A  A  MG GKT+  +T +S +H   +K  +VI P  +  + W +E++R+S 
Sbjct: 459 YLTDNNLGACLADDMGLGKTLQAITLISKMHEEKKKKSMVIMPKSLIYN-WENEIKRFS- 516

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
              + + V  G  +  + + K   +L        G +  +++         +V+DES  +
Sbjct: 517 -PKLKVGVYYGINRDFSSLKKVDVILTT-----YGTIRNDIESLLKQKIDLLVLDESQNI 570

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +++ + L+GTP  N L++L+    FL     +    Q F
Sbjct: 571 KNI----NSQTTKAVL--LLNAKKRVALSGTPIENNLLELYSLFRFL--NPEMFDSVQKF 622

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
              +    Q  S    +    K+         +KE+ A L D    L   D  +      
Sbjct: 623 TNDYIVPIQKYSDTSTIEELRKKIYPFLLRRIKKEVLADLPDKIEKLVYVDMND------ 676

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASK--TVKCLQLANGAVYYDEEKH 300
                       +++++ +R+ Y  L  +N  +  +  K   ++ +      V   E + 
Sbjct: 677 ----------EHRRFYEERRKYYYSLLEKNTSSQGNFDKFFVLQAINELRHIVSSPELES 726

Query: 301 WKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKD 350
            K +  +K   +E +IE   N   ++V  ++ S +  +  +  +         G+T D+ 
Sbjct: 727 KKIISSKKEVLIENVIEAIENNHKVLVFVNYLSSIESICDSLKENKIKYLKMTGQTKDRQ 786

Query: 351 PCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 410
               +  N+ +  +      + G GLNL     I ++   WW+       +E   + R  
Sbjct: 787 NLVDKFQNDSRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----TTVENQAIDRAY 840

Query: 411 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           + G  + VF Y +I +NTI+E +L+    K+ + D L+
Sbjct: 841 RLGQDKTVFAYKMIMRNTIEEKILKLQEIKNKLLDDLI 878


>gi|317131242|ref|YP_004090556.1| SNF2-related protein [Ethanoligenens harbinense YUAN-3]
 gi|315469221|gb|ADU25825.1| SNF2-related protein [Ethanoligenens harbinense YUAN-3]
          Length = 1081

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 107/484 (22%), Positives = 188/484 (38%), Gaps = 80/484 (16%)

Query: 3    LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIH---LWGEKSVLVIAPL 55
            L  +Q K   W+    R  +       MG GKT+  +  L + H      ++  LV+ P 
Sbjct: 614  LRNYQKKAFRWLKTMARYGLGGILADDMGLGKTLETIAFLLHNHEESTENKRISLVVCPT 673

Query: 56   RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTK-VLKTPAVLYVINFENLGWLVQELKG 114
             +  + W SE+ R++    +    I G+  QR + V + P    +I    L     +L  
Sbjct: 674  SLVLN-WVSEIARFA--PGLQSLAIMGSAAQRAELVAQIPQYDIIITSYELLKRDIDLYK 730

Query: 115  TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
             + F   ++DE+  +K+      ++ ARA+ +    SE    LTGTP  N L +LW    
Sbjct: 731  PYTFDCEIIDEAQYVKN----ASTQNARAVKQ--IRSEHRFALTGTPVENSLAELWSIFD 784

Query: 175  FLDKG-------------------------KRLGRVFQSFVARWFNTT---QIGSHIGAV 206
            FL  G                          RL R+   F+ R   ++   ++      V
Sbjct: 785  FLMPGYLYSHAKFRETFELPVVKGGDEQALDRLRRMLSPFILRRLKSSVLRELPPKTETV 844

Query: 207  RYTAKETAQKEI-EAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELY 265
             Y   +  QK++  A L+     L     QN +K I++     L            R+L 
Sbjct: 845  LYAPLDGEQKKLYMANLASIRQEL-TGSLQNSNKLIVLAMLTRL------------RQLC 891

Query: 266  CDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPII 325
            CD      +    ++K   C++L        E  H   +  +    L +I ++     I 
Sbjct: 892  CDPSLYYEDYTGGSAKLELCMELLRSVT---ESGHKVLLFSQFTSMLSIIADRLTGDGIG 948

Query: 326  VAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNIL 385
              Y      ++ ++A    R           +N    P+      + G GLNL    +I+
Sbjct: 949  Y-YVLKGSTSKEERARLTTR-----------FNNDDTPVFLISLKAGGTGLNLT-AADIV 995

Query: 386  VFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
            + +  WW++    Q  +     R  + G K +V VY LIA++TI+E +L+  + K  + D
Sbjct: 996  IHYDPWWNVSAQNQATD-----RAHRIGQKSSVQVYKLIAKDTIEEKILKLQQDKLKLAD 1050

Query: 446  LLLN 449
             +++
Sbjct: 1051 SVIS 1054


>gi|19704721|ref|NP_604283.1| SWF/SNF family helicase [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|19715039|gb|AAL95582.1| SWF/SNF family helicase [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
          Length = 892

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 95/458 (20%), Positives = 190/458 (41%), Gaps = 60/458 (13%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D+   A  A  MG GKT+  +T +S +H   +K  +VI P  +  + W +E++R+S 
Sbjct: 452 YLTDNNLGACLADDMGLGKTLQAITLISKMHEEKKKKSMVIMPKSLIYN-WENEIKRFS- 509

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
              + + V  G  +  + + K   +L        G +  +++         +V+DES  +
Sbjct: 510 -PKLKVGVYYGINRDFSSLKKVDVILTT-----YGTIRNDIESLLKQKIDLLVLDESQNI 563

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +++ + L+GTP  N L++L+    FL     +    Q F
Sbjct: 564 KNI----NSQTTKAVL--LLNAKKRVALSGTPIENNLLELYSLFRFL--NPEMFDSVQKF 615

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
              +    Q  S    +    K+         +KE+ A L D    L   D  +      
Sbjct: 616 TNDYIVPIQKYSDTSTIEELRKKIYPFLLRRIKKEVLADLPDKIEKLVYVDMND------ 669

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASK--TVKCLQLANGAVYYDEEKH 300
                       +++++ +R+ Y  L  +N  +  +  K   ++ +      V   E + 
Sbjct: 670 ----------EHRRFYEERRKYYYSLLEKNTSSQGNFDKFFVLQAINELRHIVSSPELES 719

Query: 301 WKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKD 350
            K +  +K   +E +IE   N   ++V  ++ S +  +  +  +         G+T D+ 
Sbjct: 720 KKIISSKKEVLIENVIEAIENNHKVLVFVNYLSSIESICDSLKENKIKYLKMTGQTKDRQ 779

Query: 351 PCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 410
               +  N+ +  +      + G GLNL     I ++   WW+       +E   + R  
Sbjct: 780 NLVDKFQNDSRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----TTVENQAIDRAY 833

Query: 411 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           + G  + VF Y +I +NTI+E +L+    K+ + D L+
Sbjct: 834 RLGQDKTVFAYKMIMRNTIEEKILKLQEIKNKLLDDLI 871


>gi|315650529|ref|ZP_07903595.1| Snf2 family helicase [Eubacterium saburreum DSM 3986]
 gi|315487184|gb|EFU77500.1| Snf2 family helicase [Eubacterium saburreum DSM 3986]
          Length = 1142

 Score = 67.0 bits (162), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 98/458 (21%), Positives = 185/458 (40%), Gaps = 75/458 (16%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
             MG GKT+ V++ L      G     L++ P  +  + W+ E+ ++ N + + +SV+   
Sbjct: 707  DMGLGKTLQVISLLIDAKQNGRLTKALIVCPASLVYN-WSEEISKFDNENILKVSVLAAA 765

Query: 84   VKQRTKVLK--TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTA 141
             ++R K L+      +Y+ +++ L   +  L     F+  ++DE+  +K+    Q +  A
Sbjct: 766  KEERQKSLEENEDVDIYISSYDTLRRDIS-LYHDMRFSHQIIDEAQFIKN----QNTGVA 820

Query: 142  RALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL------------------------- 176
            +A+   A +++    LTGTP  N L +LW    ++                         
Sbjct: 821  KAV--KAVQADVKFALTGTPIENRLSELWSIFDYIMPGFLYSYTAFRTRYENDIVKTGNE 878

Query: 177  DKGKRLGRVFQSFVARWFNTT---QIGSHIGAVRYTAKETAQK-EIEAQLSDC-CLSLDI 231
            D  K L ++   FV R   +     +   I  VR +  +  Q+   + +LS+   + L  
Sbjct: 879  DSAKLLSKMIAPFVLRRLKSEVALDLPDKIEEVRVSRFDRKQQLAYDGELSNLKKILLGD 938

Query: 232  ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG 291
             DY N        KK+ +   + K      R++ CD      +    ++K   C+ L   
Sbjct: 939  KDYNN--------KKMIVLAEITK-----LRQICCDPNLIFDDYSGESAKLDTCIDLVKS 985

Query: 292  AVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDP 351
             +    E   K +   +  ++  II K      I ++       +           DK  
Sbjct: 986  GI----EAGHKILLFSQFSSMLDIISKRFEKEKITSFMITGSTPK-----------DKRL 1030

Query: 352  CTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
              + ++N     +      + G GLNL  G +I++ +  WW+     Q  +     R  +
Sbjct: 1031 TLVNKFNHDDTNVFLISLKAGGTGLNLT-GADIVIHYDPWWNFAAQNQATD-----RAHR 1084

Query: 412  AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN 449
             G K  V VY LIA+ TI+E +++   +K  + D +LN
Sbjct: 1085 IGQKNTVTVYRLIAKGTIEERIVKLQESKKDLADRVLN 1122


>gi|139438973|ref|ZP_01772433.1| Hypothetical protein COLAER_01439 [Collinsella aerofaciens ATCC
            25986]
 gi|133775684|gb|EBA39504.1| Hypothetical protein COLAER_01439 [Collinsella aerofaciens ATCC
            25986]
          Length = 1173

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 102/455 (22%), Positives = 199/455 (43%), Gaps = 61/455 (13%)

Query: 26   MGSGKTVSVLT-ALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT- 83
            MG GKT+ ++   L+ +     K  LV+ P  +  + WT+E++R++    +++  I G  
Sbjct: 737  MGLGKTLQMIAHILARVEAGDAKPTLVVCPASLVYN-WTAELERFA--PSLDVCAIVGAK 793

Query: 84   VKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARA 143
             ++R ++        VI   +L     +      FA +V+DE+  +K+  L Q +  A+ 
Sbjct: 794  AQRRVQIAGADEHNVVITSYDLMRRDIDEYAEQDFARVVLDEAQYIKN-PLTQVAHAAKR 852

Query: 144  LAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHI 203
            L  PA    RF  LTGTP  N L +LW    FL  G    R  +SF  R+ +  +     
Sbjct: 853  L--PA--GVRF-ALTGTPIENRLSELWSIFDFLMPGLLGSR--ESFAKRFESPVEHAEGD 905

Query: 204  GAVRYTA----------KETAQKEIEAQLSDCCLS--------LDIADYQNIDKPILITK 245
             A R  A          KE    ++  ++ D  ++        L +A+   I + +   +
Sbjct: 906  SAARLQALVSPFVLRRVKEDVVADLPEKIEDTVMAQLTGEQRKLYLANQDRIAQQVQHRE 965

Query: 246  KVPLPQPVMKQYHKFQ--RELYCD--LQGENIEAFNSASKTVKCLQLANGAVYYDEEKHW 301
                 +  +K   +    R++ CD  L  E+ +A   ++K   C++L +GA+   +  H 
Sbjct: 966  VSEFKKDKLKVLAELTKLRQICCDPHLHYEDYKA--GSAKLDACMELVHGAL---DGGHH 1020

Query: 302  KEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGK 361
              +  +    L++I ++              D+  L+       + +     + ++  G+
Sbjct: 1021 ILLFSQFTGMLDIIGKRLA----------KEDIGFLK--LTGASSKESRAKMVAQFQAGE 1068

Query: 362  IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY 421
            +P+      + G GLNL    ++++ +  WW++    Q  +     R  + G +  V VY
Sbjct: 1069 VPVFLISLKAGGVGLNLT-AADVVIHYDPWWNVAAQDQATD-----RAHRIGQQHTVTVY 1122

Query: 422  YLIAQNTIDELVLQRLRTKSTIQDLLLNALKKETI 456
             LIA++TI+E +   +R + + +DL+ + L  + I
Sbjct: 1123 KLIAKDTIEERI---MRMQESKRDLVNSVLGGDGI 1154


>gi|163942929|ref|YP_001647813.1| non-specific serine/threonine protein kinase [Bacillus
           weihenstephanensis KBAB4]
 gi|163865126|gb|ABY46185.1| Non-specific serine/threonine protein kinase [Bacillus
           weihenstephanensis KBAB4]
          Length = 918

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 103/492 (20%), Positives = 199/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   V+W+L  ++    A     MG GK++  +T L Y      ++   L++AP  
Sbjct: 451 LRPYQQHGVEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYAKENNLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++    + + +  G+ + + +  K    +   ++    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PSLRVQLHYGSNRSKDESFKDFLQSADVILTSYALAQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 622 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 679

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 680 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 714

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI-----IEKANAAPIIVAY 328
           +         K  Q+ N    Y +E+  + + +  +K   V+     I+  N + +I   
Sbjct: 715 RRGFILLMLNKLKQICNHPALYLKEEEPQNIVERSMKTKTVMELIENIKDQNESCLIFTQ 774

Query: 329 HF---NSDLARLQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           +    N   + L++ F Q      G    K+    I+++  G   +      + G GLNL
Sbjct: 775 YIGMGNMLKSMLEETFGQRVLFLNGSVPKKERDKMIEQFQNGTYDIFILSLKAGGTGLNL 834

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 835 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 888

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 889 RKQSLNNAVITS 900


>gi|229020462|ref|ZP_04177215.1| Helicase, SNF2/RAD54 [Bacillus cereus AH1273]
 gi|229026691|ref|ZP_04183032.1| Helicase, SNF2/RAD54 [Bacillus cereus AH1272]
 gi|228734643|gb|EEL85296.1| Helicase, SNF2/RAD54 [Bacillus cereus AH1272]
 gi|228740838|gb|EEL91083.1| Helicase, SNF2/RAD54 [Bacillus cereus AH1273]
          Length = 855

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 102/492 (20%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  +T L Y      ++   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTITYLLYAKENNLQTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G  + + +  K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGGNRAKDESFKDFLQSADVVLTSYALAQLDEEELS 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 TLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +     G ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVTPIEKDRDEGKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E+  +++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKEEEPQDIIERSMKTKTVMELIENIKDQNESCLIFTQ 711

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    K+    I+++  G   +      + G GLNL
Sbjct: 712 YIGMGNMLKRMLEEKFGQRVLFLNGSVPKKERDKMIEQFQNGTYDIFILSLKAGGTGLNL 771

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 772 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 825

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 826 RKQSLNNAVITS 837


>gi|56421797|ref|YP_149115.1| DNA/RNA helicase [Geobacillus kaustophilus HTA426]
 gi|56381639|dbj|BAD77547.1| DNA/RNA helicase (SNF2 family) [Geobacillus kaustophilus HTA426]
          Length = 919

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 116/493 (23%), Positives = 187/493 (37%), Gaps = 92/493 (18%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHL--WGEKSVLVIAPL 55
            L P+Q + VDW++  +R    A     MG GKTV +L  L+++      +   L+I P 
Sbjct: 443 TLRPYQQRGVDWLVFLRRFGFGACLADDMGLGKTVQLLAYLAHVKEIERPDTPALLICPT 502

Query: 56  RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT 115
            V  + W  E  R++    + +       K    V        VI   NL  L Q+    
Sbjct: 503 SVIGN-WQKECARFTPDLRVYVHHGPNRAKNDAFVQTAGEADLVITSYNLAHLDQDDLKQ 561

Query: 116 WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
             +  I +DE+  +K+ + +Q     R   K        I L+GTP  N L +LW    F
Sbjct: 562 IHWHAICLDEAQNIKNAQTKQARAIRRLSGK------HKIALSGTPVENRLGELWSIFHF 615

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           L+ G                   +GS     R  A    +KE +A+          A  Q
Sbjct: 616 LNPG------------------YLGSAAEFERRFAGPI-EKEGDARKK--------AALQ 648

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-----------NIEAFNSASKTVK 284
            + +P L+ +        +    K +++ YC L  E            +E    AS   +
Sbjct: 649 TLIRPFLLRRTKTDEAVALNLPDKLEQKEYCPLTAEQAALYEQLVNDTLERAKEASPFAR 708

Query: 285 ---CLQLANG--------AVYYDEEKHWKEVHDEKIKALEVIIE-----KANAAPIIVAY 328
               LQ+ NG        A+Y  E +  + V  E+   LE +IE     +AN    ++  
Sbjct: 709 RGLILQMLNGVKQICDHPALYLKERRPRQLV--ERSHKLEKLIELIEQIRANDESCLIFT 766

Query: 329 HFN----------SDLARLQKAFPQG----RTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
            +           SDL   +  F  G    +T D+    + E+   K P+      + G 
Sbjct: 767 QYVRMGEMIQELLSDLFDERVLFLHGGVPKQTRDR---MVDEFQAKKAPIFLLSLKAGGT 823

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ F  WW+       +E     R  + G  + V V+ LI   TI+E + 
Sbjct: 824 GLNLTA-ANHVIHFDRWWN-----PAVENQATDRAYRIGQTKFVHVHKLITTGTIEEKID 877

Query: 435 QRLRTKSTIQDLL 447
           + L  K  + D++
Sbjct: 878 EMLEQKQALADVI 890


>gi|315282593|ref|ZP_07870972.1| SNF2 family helicase [Listeria marthii FSL S4-120]
 gi|313613760|gb|EFR87525.1| SNF2 family helicase [Listeria marthii FSL S4-120]
          Length = 1072

 Score = 66.6 bits (161), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 104/465 (22%), Positives = 188/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRMAEMEEMKRGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNAGEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L+ + QK    G+TL     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILIFSQFTGMLSIIRQKLEEDGQTLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|108763874|ref|YP_633501.1| SNF2/helicase domain-containing protein [Myxococcus xanthus DK 1622]
 gi|108467754|gb|ABF92939.1| SNF2/helicase domain protein [Myxococcus xanthus DK 1622]
          Length = 1083

 Score = 66.6 bits (161), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 117/469 (24%), Positives = 186/469 (39%), Gaps = 82/469 (17%)

Query: 13   WILD-HKRCAIWAS-MGSGKTVSVLTALSYI-HLWGEKSVLVIAPLRVAQSVWTSEVQRW 69
            W L  H    I A  MG GKT+  L+ +  + +  G K  LV+AP  V  + W  E +R+
Sbjct: 631  WFLRRHGLSGILADDMGLGKTIQSLSLMQKVANDEGRKPSLVVAPTSVLAN-WEREAERF 689

Query: 70   SNFSHMNISVITG-TVKQRTKVLKTPAVL---YVINFENLGWLVQELKGTWPFATIVVDE 125
            +    +   V  G   K+R + LK   ++   Y +   +L  L Q       F  I++DE
Sbjct: 690  T--PGLKTMVWHGQDRKERAEDLKGMDLVLTSYALVRRDLDQLSQ-----VGFRYIILDE 742

Query: 126  STKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKG------ 179
            +  +K+     GS TA+A    A  SE  + LTGTP  N L +LW    FL  G      
Sbjct: 743  AQNIKN----AGSATAQACK--ALPSETRLALTGTPLENRLSELWSIFDFLMPGFLGSSD 796

Query: 180  -------------------KRLGRVFQSFVARWFNT---TQIGSHIGAVRYTAKETAQKE 217
                                RL R  Q F+ R   T     +     +V +   E  Q  
Sbjct: 797  GFGDRYEQPIQVANDSTAKDRLRRRIQPFILRRLKTEVAKDLPPKTESVAWCEMEPGQAA 856

Query: 218  IEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCD---LQGENIE 274
            +  ++ +         +++I+K      +V +   +M+      R++ CD   L+     
Sbjct: 857  LYREVLEESRR---KVHESIEKVGFKRSRVSILAALMR-----LRQVCCDPRLLKMPPGT 908

Query: 275  AFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDL 334
                ++K  + LQL    V    E H   V  +  + LE++ ++A             D 
Sbjct: 909  LMPPSAKVERFLQLVEDLVA---EGHRALVFSQFTEMLELLKQEA-------------DK 952

Query: 335  ARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDL 394
              L+  +  GRT D+     +  N    PL F    + G GLNL    + ++ F  WW+ 
Sbjct: 953  KGLRYLYLDGRTKDRMGKVDEYNNPDGPPLFFISLKAGGTGLNLT-AADYVIHFDPWWN- 1010

Query: 395  EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
                  +E     R  + G  RAV  Y LI + T++E +L   R K  +
Sbjct: 1011 ----PAVEDQATDRTHRIGQTRAVISYKLITRGTVEEKILALQRRKREL 1055


>gi|315917068|ref|ZP_07913308.1| SWF/SNF family helicase [Fusobacterium gonidiaformans ATCC 25563]
 gi|313690943|gb|EFS27778.1| SWF/SNF family helicase [Fusobacterium gonidiaformans ATCC 25563]
          Length = 1143

 Score = 66.6 bits (161), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 102/460 (22%), Positives = 187/460 (40%), Gaps = 79/460 (17%)

Query: 17   HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN 76
            H    +   MG GKT+  +  L+ +H   +KS L+I P  +  + W SE++++S    + 
Sbjct: 708  HLGACLADDMGLGKTLQAIAILTKLHQEKKKS-LIIMPKSLIYN-WQSEIEKFS--PGLK 763

Query: 77   ISVITGTVKQRTKVLKTPAVLYVI-NFENLGWLVQELKGTWPFATIVVDESTKLKSFRLR 135
            + +  G  +    + +   +L       N   L++E    + F  +++DES  +K+    
Sbjct: 764  VGIYYGNHRDLQVMEEQDVILTTYGTVRNDIVLLKE----FFFDLVILDESQNIKNIH-- 817

Query: 136  QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFN 195
              S+T RA+     +SE  I L+GTP  N L +L+    FL+ G  +    + F   +  
Sbjct: 818  --SQTTRAVM--LLQSENRIALSGTPIENNLSELYSLFRFLNPG--MFGSLEEFNNTYAL 871

Query: 196  TTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVP 248
              Q  ++  AV+   K+         +KE+   L D            I+K I I   V 
Sbjct: 872  PIQKENNPEAVQDLRKKIYPFILRRVKKEVLQDLPD-----------KIEKTIYIDMNVE 920

Query: 249  LPQPVMKQYHKFQRELYCDLQGENI-------------EAFNSASKTVKCLQLANGAVYY 295
                  K++++ +R  Y ++   +I             +A N   +   C ++ N  +  
Sbjct: 921  -----HKKFYEERRNYYYNMIHASIREKGLGKAQFFILQALNELRQITSCPEVKNSYI-- 973

Query: 296  DEEKHWKEVHDEKIKALEVIIEKA-NAAPIIVAYHFNSDLARLQKAFPQ---------GR 345
                       +K   +E I+E   N   ++V  ++   +  + K+  +         G 
Sbjct: 974  --------SSSKKEMLIEQIVEAVENDHKVLVFTNYIGSIENICKSLEEREIAYLSMTGS 1025

Query: 346  TLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIG 405
            T D+     +     K  +      + G GLNL     I + +  WW+     + +E   
Sbjct: 1026 TKDRQQLVNKFQKNEKYKVFVMTLKTGGVGLNLTAADTIFI-YDPWWN-----KTVENQA 1079

Query: 406  VTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
            + R  + G  R VF Y LI ++TI+E +LQ    KS + D
Sbjct: 1080 IDRAYRLGQDRTVFSYKLILKDTIEEKILQLQELKSKLLD 1119


>gi|257465912|ref|ZP_05630223.1| SWF/SNF family helicase [Fusobacterium gonidiaformans ATCC 25563]
          Length = 1134

 Score = 66.6 bits (161), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 102/460 (22%), Positives = 187/460 (40%), Gaps = 79/460 (17%)

Query: 17   HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN 76
            H    +   MG GKT+  +  L+ +H   +KS L+I P  +  + W SE++++S    + 
Sbjct: 699  HLGACLADDMGLGKTLQAIAILTKLHQEKKKS-LIIMPKSLIYN-WQSEIEKFS--PGLK 754

Query: 77   ISVITGTVKQRTKVLKTPAVLYVI-NFENLGWLVQELKGTWPFATIVVDESTKLKSFRLR 135
            + +  G  +    + +   +L       N   L++E    + F  +++DES  +K+    
Sbjct: 755  VGIYYGNHRDLQVMEEQDVILTTYGTVRNDIVLLKE----FFFDLVILDESQNIKNIH-- 808

Query: 136  QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFN 195
              S+T RA+     +SE  I L+GTP  N L +L+    FL+ G  +    + F   +  
Sbjct: 809  --SQTTRAVM--LLQSENRIALSGTPIENNLSELYSLFRFLNPG--MFGSLEEFNNTYAL 862

Query: 196  TTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVP 248
              Q  ++  AV+   K+         +KE+   L D            I+K I I   V 
Sbjct: 863  PIQKENNPEAVQDLRKKIYPFILRRVKKEVLQDLPD-----------KIEKTIYIDMNVE 911

Query: 249  LPQPVMKQYHKFQRELYCDLQGENI-------------EAFNSASKTVKCLQLANGAVYY 295
                  K++++ +R  Y ++   +I             +A N   +   C ++ N  +  
Sbjct: 912  -----HKKFYEERRNYYYNMIHASIREKGLGKAQFFILQALNELRQITSCPEVKNSYI-- 964

Query: 296  DEEKHWKEVHDEKIKALEVIIEKA-NAAPIIVAYHFNSDLARLQKAFPQ---------GR 345
                       +K   +E I+E   N   ++V  ++   +  + K+  +         G 
Sbjct: 965  --------SSSKKEMLIEQIVEAVENDHKVLVFTNYIGSIENICKSLEEREIAYLSMTGS 1016

Query: 346  TLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIG 405
            T D+     +     K  +      + G GLNL     I + +  WW+     + +E   
Sbjct: 1017 TKDRQQLVNKFQKNEKYKVFVMTLKTGGVGLNLTAADTIFI-YDPWWN-----KTVENQA 1070

Query: 406  VTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
            + R  + G  R VF Y LI ++TI+E +LQ    KS + D
Sbjct: 1071 IDRAYRLGQDRTVFSYKLILKDTIEEKILQLQELKSKLLD 1110


>gi|239828513|ref|YP_002951137.1| non-specific serine/threonine protein kinase [Geobacillus sp.
           WCH70]
 gi|239808806|gb|ACS25871.1| Non-specific serine/threonine protein kinase [Geobacillus sp.
           WCH70]
          Length = 925

 Score = 66.6 bits (161), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 115/493 (23%), Positives = 189/493 (38%), Gaps = 92/493 (18%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHL--WGEKSVLVIAPL 55
            L P+Q + VDW++  +R    A     MG GKTV +L  L+++      +   L+I P 
Sbjct: 449 TLRPYQQRGVDWLVFLRRFGFGACLADDMGLGKTVQLLAYLAHVKEIERPDTPALLICPT 508

Query: 56  RVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGT 115
            V  + W  E  R++    + +       K    V        VI   NL  L Q+    
Sbjct: 509 SVIGN-WQKECARFTPDLRVYVHHGPNRAKNDAFVQTAGEADLVITSYNLAHLDQDDLKQ 567

Query: 116 WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
             +  I +DE+  +K+ + +Q     R   K        I L+GTP  N L +LW    F
Sbjct: 568 IHWHAICLDEAQNIKNAQTKQARAIRRLSGK------HKIALSGTPVENRLGELWSIFHF 621

Query: 176 LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQ 235
           L+ G                   +GS     R  A    +KE +A+          A  Q
Sbjct: 622 LNPG------------------YLGSRAEFERRFAGPI-EKEGDARKK--------AALQ 654

Query: 236 NIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE-----------NIEAFNSASKTVK 284
            + +P L+ +        +    K +++ YC L  E            +E   +AS   +
Sbjct: 655 ALIRPFLLRRTKTDEAVALNLPDKLEQKEYCPLTAEQAALYEQLVNDTLERAKNASPFAR 714

Query: 285 ---CLQLANG--------AVYYDEEKHWKEVHDEKIKALEVIIE-----KANAAPIIVAY 328
               LQ+ NG        A+Y  E +  + V  E+   LE ++E     +AN    ++  
Sbjct: 715 RGLILQMLNGVKQICDHPALYLKERRPRQLV--ERSHKLEKLVELIEQIRANDESCLIFT 772

Query: 329 HFN----------SDLARLQKAFPQG----RTLDKDPCTIQEWNEGKIPLLFAHPASCGH 374
            +           SDL   +  F  G    +T D+    ++E+   K P+      + G 
Sbjct: 773 QYVRMGEMIQQLLSDLFDERVLFLHGGVPKQTRDR---MVEEFQARKAPIFLLSLKAGGT 829

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           GLNL    N ++ F  WW+       +E     R  + G  + V V+ LI   TI+E + 
Sbjct: 830 GLNLTA-ANHVIHFDRWWN-----PAVENQATDRAYRIGQTKFVHVHKLITVGTIEEKID 883

Query: 435 QRLRTKSTIQDLL 447
           + L  K  + D++
Sbjct: 884 EMLEQKQALADII 896


>gi|123415533|ref|XP_001304706.1| SNF2 family N-terminal domain containing protein [Trichomonas
           vaginalis G3]
 gi|121886177|gb|EAX91776.1| SNF2 family N-terminal domain containing protein [Trichomonas
           vaginalis G3]
          Length = 572

 Score = 66.2 bits (160), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 109/452 (24%), Positives = 192/452 (42%), Gaps = 65/452 (14%)

Query: 25  SMGSGKTVSVLTALSYIH---LWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN-ISVI 80
            MG GKT   L A+S  H   +      L+ AP  V    W SEVQ++  FS +N I +I
Sbjct: 96  DMGLGKTYQTLCAISTYHYNSINDSPKSLIFAPTNVIYH-WASEVQKF--FSWLNTIKII 152

Query: 81  TGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKT 140
            G   Q + +        +I    L      LK T+ F  IV+DE   +K    +  SK 
Sbjct: 153 KG--DQLSSININNFTGLIITSYGLARHFTNLKVTFKF--IVLDEGHLIK----KPDSKK 204

Query: 141 ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKG-----KRLGRVFQSFVARWFN 195
           A+ +      SE  + LTGTP  NG +DLW    FL  G     +R  +++++ + + F+
Sbjct: 205 AQYITN--LSSEHKLILTGTPIQNGPMDLWSLFNFLMPGYLGTKERFVKLYKNPIDKMFD 262

Query: 196 TTQIGSHIGAVRYTAKETAQKEIEAQL---------SDCCLSL-------DIADYQNIDK 239
                 +    +    E A +++ +Q+         +D   SL       + A   +I K
Sbjct: 263 -----KNASEQQTKQGEKALEDLHSQVLPLILRRLKTDVLKSLPPKIPNIESAFLSDIQK 317

Query: 240 PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEK 299
            IL  K+       + ++ K   E+  ++  E +E       T KC+   +G +     K
Sbjct: 318 KILEAKRNEYETNRISEFEKQDFEMKLNIHPELVEP------TCKCIIEESGKLV--ALK 369

Query: 300 H------WKEVHDEKIKALEVII-EKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPC 352
           H      + +  +  ++   VI  E   A  +I+ Y   + +      F     + ++  
Sbjct: 370 HLLHRIGYGKDREGILRRKAVIFCESEEAINMIIKYVIPTLVDTEYIQFSSSTDIAENAK 429

Query: 353 TIQEWNEGKIPLLF-AHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQ 411
            I+E+++   P LF A   +  HG+NL    +I++FF L W+ +   Q  +R+    Q  
Sbjct: 430 KIEEFSKEDGPDLFIATTTAAAHGINLT-SASIVIFFELNWNPKIDLQAEDRVHRLTQT- 487

Query: 412 AGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
               + V ++ ++  +TID+ +++    K  I
Sbjct: 488 ----KTVDIFKIVMIDTIDQRIIEAQERKDKI 515


>gi|213963570|ref|ZP_03391823.1| Non-specific serine/threonine protein kinase [Capnocytophaga
           sputigena Capno]
 gi|213953850|gb|EEB65179.1| Non-specific serine/threonine protein kinase [Capnocytophaga
           sputigena Capno]
          Length = 951

 Score = 66.2 bits (160), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 113/494 (22%), Positives = 205/494 (41%), Gaps = 95/494 (19%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIH------------LWGE 46
           L P+Q + V+W+L H    + A     MG GKT+  +  L  IH            L+  
Sbjct: 477 LRPYQVEGVEWLLQHYHNGVGACLADDMGLGKTLQTIALLVAIHDTLPLKENNFTDLFSA 536

Query: 47  KS-------VLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQR-TKVLKTPAVLY 98
                    VLVI P  +  + W  E +R++   H   +   G+  +R TKV +      
Sbjct: 537 TEPQKEALKVLVILPSSLLFN-WYDETKRFA--PHFKCTQYIGSSSERKTKVRRLTNYDV 593

Query: 99  VIN----FENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERF 154
           V       E  G  +++L+    F  I++DES ++K+    + SKT +A+   A ++E  
Sbjct: 594 VFTSYPIVERDGKELEKLE----FRYIILDESQRIKN----KNSKTFKAIN--ALKAEHR 643

Query: 155 IELTGTPSPNGLIDLWGQIWFLDKGKRLG------RVFQSFVARWFN-------TTQIGS 201
           I L+GTP  N L DLW Q+ F++   +LG      + ++  +++  N        T +G 
Sbjct: 644 IALSGTPIENALSDLWAQMQFINPN-QLGTYPFFYKHYEVEISKKKNPQALEELKTLVGK 702

Query: 202 HIGAVRYTAKETAQK--EIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHK 259
           HI  +R T ++      +IE QL+ C +S   A +   +K  +  + +   +P       
Sbjct: 703 HI--LRRTKEQVLSDLPDIEEQLAYCPMSEAQAQWYEREKSKVRNQLLEASEP------- 753

Query: 260 FQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKE-VHDEKIKALEVIIEK 318
                        I  FN+     K  Q++N  V  D E       + E I  +E +   
Sbjct: 754 -------------ISEFNALQMLTKLRQISNHPVLADAESTIPSGKYQEVISYMETLHTA 800

Query: 319 ANAAPIIVAYHFNSDL-------ARLQKAFPQGRTLDKDPCTIQE--WNEGKIPLLFAHP 369
            + A I  ++  + +L        +++ +   G T   +  +  E   N+  +   F   
Sbjct: 801 QHKALIFSSFVKHLELFEAWCKTHKIKYSKLTGATATHERKSQVEAFQNQEDVSFFFISL 860

Query: 370 ASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTI 429
            +   GLNL     +L+    WW+        ER  + R  + G +  V V   +++++I
Sbjct: 861 KAGEVGLNLTKASYVLL-LDPWWN-----PFSERQAIARAHRIGQENKVNVIRFVSKDSI 914

Query: 430 DELVLQRLRTKSTI 443
           +E +++    K+ +
Sbjct: 915 EEKIIKLQENKTEL 928


>gi|293571575|ref|ZP_06682597.1| Snf2 family protein [Enterococcus faecium E980]
 gi|291608381|gb|EFF37681.1| Snf2 family protein [Enterococcus faecium E980]
          Length = 1064

 Score = 66.2 bits (160), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 96/426 (22%), Positives = 184/426 (43%), Gaps = 63/426 (14%)

Query: 26   MGSGKTVSVLT-ALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
            MG GKT+  +   LS        S L++AP  +  + W +EV++++    +NI VI G  
Sbjct: 639  MGLGKTLQTIAFLLSEKEERESFSALIVAPASLIYN-WQAEVKKFA--PSLNIQVINGNK 695

Query: 85   KQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARAL 144
            K+R ++L     + V ++ +L   + + + +     +++DE+  +K+      +KTA+AL
Sbjct: 696  KEREELLAKDTDIRVTSYASLRQDLADYQ-SQKIDYLILDEAQMVKN----SSTKTAQAL 750

Query: 145  AKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIG 204
             + A   +RF  L+GTP  N L +LW              +F + +  +F T        
Sbjct: 751  RELAV-PQRFA-LSGTPIENNLEELWS-------------LFATIMPGFFPT-------- 787

Query: 205  AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ----YHKF 260
              +   +E A +EI   +    L     D Q + K +    ++ L   + ++    Y  +
Sbjct: 788  --KTKFRELAAEEIAQMIRPFILR---RDKQTVLKDLPEKTEMNLYSALTEEQKTVYLAY 842

Query: 261  QRELYCDLQGENIEAFNSA-----SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI 315
             R++  ++   + EAF        +   +  Q+      + E+        E++K L ++
Sbjct: 843  LRQMREEISSMDSEAFKKNRIGILAGLTRLRQICCDPRLFIEDYQGGSGKLEQVKDL-LV 901

Query: 316  IEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQEWNEGKIPLL 365
              K N   +++   F   L  LQ+   +         G T  +D  + +  +N G+  + 
Sbjct: 902  AAKENKRRVLLFSQFTGMLTILQEELAELGISTFYLRGSTKPQDRLSMVDAFNAGEKDVF 961

Query: 366  FAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIA 425
                 + G GLNL  G + ++ + LWW+       IE     R  + G K  V V+ +I+
Sbjct: 962  LISLKAGGTGLNLT-GADTVILYDLWWN-----PAIEEQAAGRAHRIGQKNVVEVWRMIS 1015

Query: 426  QNTIDE 431
            + TI+E
Sbjct: 1016 EGTIEE 1021


>gi|330506407|ref|YP_004382835.1| SNF2 family helicase [Methanosaeta concilii GP-6]
 gi|328927215|gb|AEB67017.1| SNF2 family helicase [Methanosaeta concilii GP-6]
          Length = 1035

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 107/488 (21%), Positives = 196/488 (40%), Gaps = 88/488 (18%)

Query: 2   NLAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIH--LWGEKSVLVIAPL 55
            L P+Q + V W++   R  + A     MG GKT+ ++  L +    + G    L+I P+
Sbjct: 550 TLRPYQLRGVSWLMYLNRLGLGACLADDMGLGKTIELIAFLLHERETMKGPGPTLLICPM 609

Query: 56  RVAQSVWTSEVQRWSN----FSHMNISVITG----TVKQRTKVLKTPAVLYVINFENLGW 107
            VA + W  E++R++       H  +  ++G       ++  V+ T   L   + E L  
Sbjct: 610 SVAGN-WEREIERFAPGLKVLMHHGLGRLSGQDFEKAAEKADVVITTYSLAQRDEEELNA 668

Query: 108 LVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLI 167
           +      +W    IV+DE+  +K+   RQ     R       ++ + I LTGTP  N L 
Sbjct: 669 V------SW--GHIVLDEAQSIKNQSARQTQSIKR------LKATQKIALTGTPVENRLS 714

Query: 168 DLWGQIWFLDKGKRLGRVFQSF-------VARWFNTTQIGSHIGAVRYTAKETAQKEIEA 220
           +LW  + FL+ G  LG  F+SF       + R+ N     +H  A+R   +    + ++ 
Sbjct: 715 ELWSIMDFLNPGY-LGS-FESFRRDFVLPIERYNNR----AHSEALRSLIQPFVLRRLK- 767

Query: 221 QLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSA- 279
             +D  +  D+ +   +     +T +              Q  LY  +  + +    S+ 
Sbjct: 768 --TDTTVIKDLPEKTEMKVGYNLTPE--------------QASLYAAVVEDMLSRIESSE 811

Query: 280 ---------SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKA----NAAPIIV 326
                    +   K  Q+ N    + ++    E    K+  LE ++++A    + A I  
Sbjct: 812 GMKRRGQILAALTKLKQICNHPALFLQDGSPLEGRSGKLSRLEEMLDEAISVGDRALIFT 871

Query: 327 AYHFNSDLAR--------LQKAFPQGRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLN 377
            +     + R        ++  F  G+T  K     IQ + +G  P+      + G GLN
Sbjct: 872 QFAGMGAMLRHQLQEKLGVEVLFLHGKTSRKQREEMIQRFQQGSSPIFILSLKAGGFGLN 931

Query: 378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRL 437
           L    N +  F  WW+       +E     R  + G K+ VFV+  +   T++E + Q +
Sbjct: 932 LT-AANHVFHFDRWWN-----PAVENQATDRAFRIGQKKNVFVHKFVCAGTLEERIDQMI 985

Query: 438 RTKSTIQD 445
             K  + +
Sbjct: 986 EQKKALAE 993


>gi|257899587|ref|ZP_05679240.1| Snf2 family protein [Enterococcus faecium Com15]
 gi|257837499|gb|EEV62573.1| Snf2 family protein [Enterococcus faecium Com15]
          Length = 1067

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 96/426 (22%), Positives = 184/426 (43%), Gaps = 63/426 (14%)

Query: 26   MGSGKTVSVLT-ALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
            MG GKT+  +   LS        S L++AP  +  + W +EV++++    +NI VI G  
Sbjct: 642  MGLGKTLQTIAFLLSEKEERESFSALIVAPASLIYN-WQAEVKKFA--PSLNIQVINGNK 698

Query: 85   KQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARAL 144
            K+R ++L     + V ++ +L   + + + +     +++DE+  +K+      +KTA+AL
Sbjct: 699  KEREELLAKDTDIRVTSYASLRQDLADYQ-SQKIDYLILDEAQMVKN----SSTKTAQAL 753

Query: 145  AKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIG 204
             + A   +RF  L+GTP  N L +LW              +F + +  +F T        
Sbjct: 754  RELAV-PQRFA-LSGTPIENNLEELWS-------------LFATIMPGFFPT-------- 790

Query: 205  AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ----YHKF 260
              +   +E A +EI   +    L     D Q + K +    ++ L   + ++    Y  +
Sbjct: 791  --KTKFRELAAEEIAQMIRPFILR---RDKQTVLKDLPEKTEMNLYSALTEEQKTVYLAY 845

Query: 261  QRELYCDLQGENIEAFNSA-----SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI 315
             R++  ++   + EAF        +   +  Q+      + E+        E++K L ++
Sbjct: 846  LRQMREEISSMDSEAFKKNRIGILAGLTRLRQICCDPRLFIEDYQGGSGKLEQVKDL-LV 904

Query: 316  IEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQEWNEGKIPLL 365
              K N   +++   F   L  LQ+   +         G T  +D  + +  +N G+  + 
Sbjct: 905  AAKENKRRVLLFSQFTGMLTILQEELAELGISTFYLRGSTKPQDRLSMVDAFNAGEKDVF 964

Query: 366  FAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIA 425
                 + G GLNL  G + ++ + LWW+       IE     R  + G K  V V+ +I+
Sbjct: 965  LISLKAGGTGLNLT-GADTVILYDLWWN-----PAIEEQAAGRAHRIGQKNVVEVWRMIS 1018

Query: 426  QNTIDE 431
            + TI+E
Sbjct: 1019 EGTIEE 1024


>gi|325126030|gb|ADY85360.1| SNF2-related domain:Helicase, C-terminal:SWIM Zn-finger
           [Lactobacillus delbrueckii subsp. bulgaricus 2038]
          Length = 637

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 110/487 (22%), Positives = 198/487 (40%), Gaps = 85/487 (17%)

Query: 3   LAPHQTKIVDW---ILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           L P+Q     W   +  H    I A  MG GKT+ V++ L+      ++  L++AP  + 
Sbjct: 179 LRPYQKTGTAWMNRLAQHGFGGILADEMGLGKTLQVISLLAS---QKDQPSLIVAPASLV 235

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT-PAVLYVINFENLGWLVQELKGTWP 117
            + W +E ++++    M   V++G+ K+R+  L     +  VI F +L  L +++    P
Sbjct: 236 LN-WEAEFKKFA--PEMKTLVLSGSKKERSGQLADLTDIDVVITFYDL--LKRDIANYEP 290

Query: 118 --FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF 175
             FA  V+DE+  +K+ R      TA A +    +++    LTGTP  N L +LW    F
Sbjct: 291 HTFAYEVIDEAQMIKNPR------TAAAKSVSVVKAKHRFALTGTPIENRLSELWSIFNF 344

Query: 176 LDKG-------------------------KRLGRVFQSFVARWFNTT---QIGSHIGAVR 207
           +  G                          RL ++   F+ R         +   +  VR
Sbjct: 345 VMPGFLKSYREFKKDFESPIVKEDDQDCLNRLSQMVGPFILRRLKKDVLKDLPDKLEEVR 404

Query: 208 YTAKETAQKEI-EAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYC 266
           Y      Q+ + +A+++     +   D + I +  +          ++    +  RE+ C
Sbjct: 405 YVGVGKEQRRLYDAEIARLKNKVMAEDDEGIKREQI---------EILAALTRI-REICC 454

Query: 267 DLQGENIEAFNSAS-KTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPII 325
           D  G   E +   S K + C+ L   A+   +E H   +  +    L+++ E   A  I 
Sbjct: 455 D-PGLLYEDYKGESEKRLACVDLIKSAI---DEGHKVLLFSQFTSMLDLLEESLKAEEI- 509

Query: 326 VAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIP--LLFAHPASCGHGLNLQYGGN 383
                     R+    P+ R L      +  +N    P  +      + G GLNL  G +
Sbjct: 510 -------GFLRIDGQTPKARRL----TLVNVFNHKDSPAKVFLISLKAGGTGLNLT-GAD 557

Query: 384 ILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
            ++ +  WW++    Q        R  + G ++ V VY LIA++T++E +L     KS +
Sbjct: 558 TVIHYDPWWNVAAQNQ-----ATDRAHRIGQEKKVTVYKLIAKDTVEEAILDLQEAKSLL 612

Query: 444 QDLLLNA 450
              +L A
Sbjct: 613 AQGILTA 619


>gi|294891643|ref|XP_002773666.1| DNA helicase, putative [Perkinsus marinus ATCC 50983]
 gi|239878870|gb|EER05482.1| DNA helicase, putative [Perkinsus marinus ATCC 50983]
          Length = 741

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 102/188 (54%), Gaps = 25/188 (13%)

Query: 3   LAPHQTKIVDWIL---DHKRCAIWA-SMGSGKTVSVLTALSYIHLWGEKSV----LVIAP 54
           L  +Q K V+W++   ++K   I A SMG GKTV  ++ L+Y+H    K +    +++AP
Sbjct: 163 LRDYQLKGVEWLVSLFNNKLNGILADSMGLGKTVQTISLLAYLH--EHKGIQGPHMIVAP 220

Query: 55  LRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENL----GWLVQ 110
           L   +S W  E +RW       I +  G  +QR ++ ++ A  Y++ F+ L     ++++
Sbjct: 221 LSTLRSNWEQEFERW--LPSFKIVLYDGNKQQRKELRESEA--YMLPFQVLLTTDAYVLR 276

Query: 111 ELKGTWPFA--TIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLID 168
           + +    FA   ++VDE+ +LK+ +    SK  + L K  + ++R + LTGTP  N + +
Sbjct: 277 DKQYLRKFAWEYLIVDEAHRLKNPK----SKLVQVLNK-QYITKRRLALTGTPLQNDIQE 331

Query: 169 LWGQIWFL 176
           +W  + FL
Sbjct: 332 VWALLNFL 339


>gi|294055867|ref|YP_003549525.1| SNF2-related protein [Coraliomargarita akajimensis DSM 45221]
 gi|293615200|gb|ADE55355.1| SNF2-related protein [Coraliomargarita akajimensis DSM 45221]
          Length = 843

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 123/478 (25%), Positives = 193/478 (40%), Gaps = 82/478 (17%)

Query: 3   LAPHQTKIVDWILDHKRCA----IWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           L P+Q   V W+ + +R +    +   MG GKT+ VLT L    + G KS L++ P  V 
Sbjct: 380 LRPYQAHGVQWMSNLRRHSCHGLLADEMGLGKTLQVLTLLHASPVPG-KSSLIVCPASVV 438

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
             VW SE  RW  +  M+ +V+     Q    +  P  L++ ++  L    + L  +  F
Sbjct: 439 -PVWESEAARW--YPEMDTAVLRSN--QTFDDVGAPK-LWIASYTQL-RRHKHLLDSAEF 491

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
              V+DE+  +K+      +K   A    A ++E  I LTGTP  N L+DLW    FL  
Sbjct: 492 GYAVLDEAQYIKN----PDAKVTHACC--AIQAECRIALTGTPLENRLLDLWTLFRFLMP 545

Query: 179 GKRLG--RVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIA---- 232
           G  LG  R F+  V                     E    E  AQ  +  L + IA    
Sbjct: 546 GL-LGNRRRFEDAV---------------------ELEDSERRAQFEE-RLRMQIAPFLL 582

Query: 233 ----DYQNIDKPILITKKVPLPQPVMKQ------YHKFQRELYCDLQGE-NIEAFNSASK 281
               D    D P  +   +  P   +++       +K + EL  DLQ     +A N  + 
Sbjct: 583 RRKKDAVGADLPAKVEMDLICPISDLQRQVYEGLLNKGREELGDDLQAAMQSQATNFFTL 642

Query: 282 TVKCLQLANGAVYYDEEKHWKEVHDEKIKAL----EVIIEKANAAPIIVAYHFNSDLARL 337
             +  Q         E     E    KI+ L    E  +E A A  +++   F   L RL
Sbjct: 643 LTRLRQACCDPGLIPEVAAPLE-QSGKIQTLLIHLEEALEGAGARKVVIFSQFVQLLTRL 701

Query: 338 QKA----FPQ-------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNIL 385
           +      FP+       G+T D+  P    +  +G   +L +  A  G G+ L +  + +
Sbjct: 702 KPEIKAKFPKVALLELTGQTRDRSKPVETFQNKDGPAVILVSLRAG-GTGITL-HAADYV 759

Query: 386 VFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI 443
                WW+     Q ++R+      + G ++ VFVY +I Q TI+E +    R K  +
Sbjct: 760 FLLDPWWNPAVENQAVDRV-----HRIGQQKRVFVYRMITQGTIEERIQHLKREKREL 812


>gi|260890109|ref|ZP_05901372.1| hypothetical protein GCWU000323_01271 [Leptotrichia hofstadii
           F0254]
 gi|260860132|gb|EEX74632.1| putative SNF2 family N- domain protein [Leptotrichia hofstadii
           F0254]
          Length = 988

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 102/474 (21%), Positives = 202/474 (42%), Gaps = 66/474 (13%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEK-SVLVIAPLRV 57
           L P+Q    +W+ +             MG GKT+  ++ L+ I+      S L+I P  +
Sbjct: 531 LFPYQKLGFNWLKNMYDIGFGGVLADDMGLGKTLQTISLLNEIYQENRDFSALIIVPSSL 590

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVIN-FENLGWLVQELKGTW 116
             + W  E+ +++  S    ++I GT  QR +++   +  ++I  ++ L   ++E K + 
Sbjct: 591 LYN-WKEEIIKFTGISP---TLIEGTAAQRKEIISKKSRGFMITTYQALRNDIEEYK-SR 645

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWF- 175
            F  +V+DE+  +K+      S+  +A+ K    S+    LTGTP  N +++LW    F 
Sbjct: 646 DFEVVVLDEAQNIKT----TTSQIKKAVMK--INSKVNFALTGTPVENNILELWSIFDFV 699

Query: 176 ----LDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
               LD   +  + ++  +    N+++I +    +        +KE+  +L D       
Sbjct: 700 IPGYLDNLTKFKKTYKEAIVNP-NSSKIHNLREIIAPFLLRRTKKEVLTELPD------- 751

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANG 291
                I+  +++T      Q  M    K + E+    + EN       +   K  Q+ N 
Sbjct: 752 ----KIESNMVVTLSNEQKQLYMSYIKKAKSEMKKFNENEN-NRMKILAILTKLRQICNS 806

Query: 292 AVYYDEEKHWKEVHDEKIKALEV-------IIEKANAAPIIVAYHFNSDLARLQKA---- 340
              +      KE +  ++  LEV       IIE  N   +++   F   L  ++K     
Sbjct: 807 PTLF------KEDYKGEVAKLEVLRDLMPDIIE--NGHRLLIFSQFVGTLKEIEKELENM 858

Query: 341 -----FPQGRTLDKDPCTI-QEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDL 394
                +  G    K+   I  ++N G+  ++     + G GLNL  G ++++ +  WW++
Sbjct: 859 GIEYFYIDGSVKSKERVDICNKFNAGERQVVLISLKAGGTGLNL-VGADVVIHYDPWWNI 917

Query: 395 EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                 +E     R  + G K++V V  L+ + TI+E +++   +K  + + LL
Sbjct: 918 -----AVENQASDRAYRIGQKKSVQVIKLVTEGTIEEKIIKIQESKRKLSENLL 966


>gi|227893708|ref|ZP_04011513.1| Snf2 family helicase [Lactobacillus ultunensis DSM 16047]
 gi|227864568|gb|EEJ71989.1| Snf2 family helicase [Lactobacillus ultunensis DSM 16047]
          Length = 1180

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 102/479 (21%), Positives = 210/479 (43%), Gaps = 69/479 (14%)

Query: 3    LAPHQTKIVDW---ILDHKRCAIWAS-MGSGKTVSVLTAL--SYIHLWGEKSVLVIAPLR 56
            L P+Q +  +W   I+++    + A  MG GKT+ ++  L      +      LV+AP  
Sbjct: 718  LRPYQKEGFNWLSTIVNYNFGGLLADEMGLGKTLQIIALLLSRKEQISSNLPSLVVAPAS 777

Query: 57   VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVL-KTPAV-LYVINFENLGWLVQELKG 114
            V  + W +E+Q+++   H+++ ++ G   +R K+L ++P   LY+ ++++L   ++    
Sbjct: 778  VIYN-WQAELQKFA--PHLSVCILDGNKNKREKMLMESPKYDLYISSYQSLNHDLESY-D 833

Query: 115  TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
               F   ++DE+  +K+      + TA+++     ++   + LTGTP  N L +LW    
Sbjct: 834  NLTFDLQIIDEAQNIKNHE----AITAKSVK--VIKAHHKLALTGTPIENKLSELWSIFD 887

Query: 175  FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
            +L  G         F+  + +  +    I  V+        ++ EA LS+  +   +   
Sbjct: 888  YLMPG---------FLGSYLDFKK-KFEIPIVK-----KKDEDAEALLSNMIMPFTL--- 929

Query: 235  QNIDKPILITKKVPLPQPVMKQYHKFQRELY--------CDLQGENIEAFNSA-----SK 281
            + + K +L+       Q ++ + +K Q  LY          L G+    F  +     ++
Sbjct: 930  RRLKKNVLLDLPAKDEQVILVKMNKKQEGLYQLQTQKLIAQLNGQEETDFKKSRFEIFAQ 989

Query: 282  TVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI-IEKANAAPIIVAYHFNSDLARLQKA 340
             +K  ++        E  H K   ++ I  +++I     N   I++   F S L  LQ  
Sbjct: 990  IIKLREICCDPRLLYENYHGKS--NKLITTVDLIKTNLENGHKILLFSQFTSMLEILQSK 1047

Query: 341  FPQGRT----------LDKDPCTIQEWNEGKIPLLF-AHPASCGHGLNLQYGGNILVFFS 389
              + +            +K    I+E+N  + P +F     + G G+NL    ++++ + 
Sbjct: 1048 LKKAKIPLFMLTGSTPKEKRQEYIREFNTMEQPGVFLISLKAGGTGINLT-SADVVIHYD 1106

Query: 390  LWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
             WW+L    Q        R  + G K +V VY ++ +NTI+E +++  + K+ +   +L
Sbjct: 1107 PWWNLAAENQ-----ATDRAHRIGQKHSVKVYKMVTKNTIEERIIKLQQKKAELAQAIL 1160


>gi|46907873|ref|YP_014262.1| SNF2 family helicase [Listeria monocytogenes serotype 4b str. F2365]
 gi|254931583|ref|ZP_05264942.1| helicase [Listeria monocytogenes HPB2262]
 gi|46881142|gb|AAT04439.1| helicase, Snf2 family [Listeria monocytogenes serotype 4b str. F2365]
 gi|293583138|gb|EFF95170.1| helicase [Listeria monocytogenes HPB2262]
 gi|332312085|gb|EGJ25180.1| Helicase, Snf2 family [Listeria monocytogenes str. Scott A]
          Length = 1072

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 104/465 (22%), Positives = 187/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRIAEMEEMKHGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNASEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK    G+TL     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEDGQTLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|47093680|ref|ZP_00231434.1| helicase, Snf2 family [Listeria monocytogenes str. 4b H7858]
 gi|47017941|gb|EAL08720.1| helicase, Snf2 family [Listeria monocytogenes str. 4b H7858]
 gi|328465005|gb|EGF36284.1| SNF2 family helicase [Listeria monocytogenes 1816]
          Length = 1072

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 104/465 (22%), Positives = 187/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PTIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRIAEMEEMKHGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNASEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK    G+TL     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEDGQTLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|46447008|ref|YP_008373.1| hypothetical protein pc1374 [Candidatus Protochlamydia amoebophila
            UWE25]
 gi|46400649|emb|CAF24098.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila
            UWE25]
          Length = 1161

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 101/449 (22%), Positives = 189/449 (42%), Gaps = 67/449 (14%)

Query: 17   HKRCAIWASMGSGKTV-SVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHM 75
            H    +   MG GKT+ +++T   Y     ++  +V+ P  +  + W  E+ +++    +
Sbjct: 716  HLNGILADDMGLGKTLQAIITLTQYKMDHPKQPSIVVCPTSLVYN-WQEEITKFN--PKL 772

Query: 76   NISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK--GTWPFATIVVDESTKLKSFR 133
             +  + G   QR K+L       VI   +   L ++++   T PF  I++DE+  +K+  
Sbjct: 773  KVLPVDGNPSQRKKLLNDLDYYDVI-ITSYTLLQKDIEFYKTVPFGYIILDEAQHIKN-- 829

Query: 134  LRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARW 193
              +G++ A+++ K    + R I LTGTP  N L +LW    FL  G  L   +  FV ++
Sbjct: 830  --RGTRNAQSV-KMIQAAHRLI-LTGTPIENSLEELWSLFDFLMPG--LLSSYDRFVEKY 883

Query: 194  FNTTQI---GSHIGAVRYTAKETAQKEIEAQLSD-----------CCLSLDIADYQNIDK 239
               + I   G ++  +R        + ++  + D           C LS +I   Q + +
Sbjct: 884  IRQSTISQGGKNLDNLRRKVAPFILRRMKKDVLDDLPPVSEIVYHCHLS-NIQ--QELYR 940

Query: 240  PILITKKVPLPQPVMKQ-YHKFQ----------RELYCD--LQGENIEAFNSASKTVKCL 286
                + +  L Q V K+ + + Q          +++ C   +  ++      +SK    L
Sbjct: 941  SYAASAREELSQLVKKEGFERVQIHVLATLTRLKQICCHPAIFAKDRPENGDSSKYEMLL 1000

Query: 287  QLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRT 346
            +L    +   E KH   +  +  + L ++ E      I   Y   S   RL       + 
Sbjct: 1001 ELLQTLM---ESKHKTVIFSQYTRMLNIMREDLEKQGIRFEYLDGSSKNRLSIV----KK 1053

Query: 347  LDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGV 406
             ++DP          IP+      + G GLNL  G + ++ + +WW+     Q  +R+  
Sbjct: 1054 FNEDP---------NIPIFLVSLKAGGSGLNL-VGADTVIHYDMWWNPAVENQATDRV-- 1101

Query: 407  TRQRQAGFKRAVFVYYLIAQNTIDELVLQ 435
                + G K +V  Y LI  NTI+E +L+
Sbjct: 1102 ---HRLGQKNSVSSYKLITLNTIEEKILE 1127


>gi|226224245|ref|YP_002758352.1| SNF2-type helicase [Listeria monocytogenes Clip81459]
 gi|225876707|emb|CAS05416.1| Putative SNF2-type helicase [Listeria monocytogenes serotype 4b str.
            CLIP 80459]
          Length = 1072

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 104/465 (22%), Positives = 187/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PTIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRIAEMEEMKHGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNASEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK    G+TL     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEDGQTLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|196233486|ref|ZP_03132329.1| Non-specific serine/threonine protein kinase [Chthoniobacter flavus
           Ellin428]
 gi|196222482|gb|EDY17009.1| Non-specific serine/threonine protein kinase [Chthoniobacter flavus
           Ellin428]
          Length = 815

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 111/472 (23%), Positives = 191/472 (40%), Gaps = 86/472 (18%)

Query: 11  VDWILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRW 69
           + ++  H    I A  MG GKTV    AL+++   G ++++V     V    W  E  R+
Sbjct: 370 LQFLATHGLAGIIADEMGLGKTVQ---ALAFLRALGGRALIVCPSSLVFN--WAREAARF 424

Query: 70  SNFSHMNISVITGTVKQRTKVLKTP---AVLYVINFENLGWLVQELKGTWPFATIVVDES 126
           +      +  I G  + RTK+   P   A L + ++  L   V+  +  W FA  V+DE+
Sbjct: 425 T--PERKVLAIVG--EGRTKLFGPPLEQAELVITSYPLLRRDVERYR-DWEFAAAVLDEA 479

Query: 127 TKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKG------- 179
             +K+    Q ++ A AL        RF+ LTGTP  N L DLW  + FL  G       
Sbjct: 480 QHIKNPD-SQNAQAACALRA----KNRFL-LTGTPIENSLKDLWSLMHFLMPGYLGSAKD 533

Query: 180 ------------------KRLGRVFQSFVARWFN---TTQIGSHIGAVRYTAKETAQKEI 218
                             KRL +  + FV R       T++   I  V Y    + QK++
Sbjct: 534 FRERYERDIQNDPLGATSKRLLQRIRPFVLRRTKRAVATELPEKIEQVSYCELTSRQKDV 593

Query: 219 EAQLSDCCLSL--DIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQ---GENI 273
            A+L         D+A  ++  K      ++ +   +++      R+  CDL+    ++I
Sbjct: 594 YAELVKATRRTLSDLAGGKDQGK-----ARIAMLTALLR-----LRQACCDLRLLGQDDI 643

Query: 274 EAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSD 333
           E+  +++K     +L   AV   +  H   +  + +  L ++ E      I   Y     
Sbjct: 644 ESEQASAKIELLRELLAEAV---DGGHRVLIFSQFVSMLTLLREALTEDEIPYCYL---- 696

Query: 334 LARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWD 393
                     G T D+    +  +  G+ P       + G GLNL    + ++ F  WW+
Sbjct: 697 ---------DGSTKDR-AAEVDRFQAGETPAFLISLKAGGVGLNLT-AADTVIHFDPWWN 745

Query: 394 LEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
                  +E     R  + G ++ V  Y LIA++T++E +L   + K  + D
Sbjct: 746 -----PAVEAQATDRAHRIGQQKVVTAYKLIARDTVEEKILALQQKKRALVD 792


>gi|254304002|ref|ZP_04971360.1| SWF/SNF family helicase [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|148324194|gb|EDK89444.1| SWF/SNF family helicase [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
          Length = 401

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 111/470 (23%), Positives = 193/470 (41%), Gaps = 102/470 (21%)

Query: 1   MNLAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE---KSVLVIAPL-R 56
           M L  +Q +++D    HK        G+GKT+     +S  H W     K +L++AP  +
Sbjct: 1   MKLYKYQQELID--NSHKNYIYPLDTGTGKTI-----ISINHYWKHAQGKKLLIVAPAQK 53

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           V +  W  E++++ +++   I  I   V    K       L  +N  N+       + T+
Sbjct: 54  VREGGWDREIKKFKDYNK--IDNIDYKVISYNK-------LKNVNGNNI-------QNTY 97

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQI--- 173
               ++ DE   +K+++  Q SK A  L K A   + F  L+ TP+ NG  DL       
Sbjct: 98  ----LIFDECHYIKNYKKTQRSKYALNLCKKA---DGFCLLSATPASNGYQDLGNYFIIF 150

Query: 174 WFLDKGKRLGRVF--QSF-------VARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSD 224
            F   G +  + F  + F       +  W NT +I     ++   + +   KE      D
Sbjct: 151 GFYPSGYKYEKEFAVKRFNNIGFWEIKEWRNTEKIDEMWKSI---SSKALMKE------D 201

Query: 225 CCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVK 284
           C           +D P L+ ++        K+Y   +++ Y      N   F++ SK + 
Sbjct: 202 C-----------VDLPPLVFEECYFD--AGKEYLSIKKDRYW-----NGIIFDNTSKVIA 243

Query: 285 CLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANA-APIIVAYHFNSDLARLQKAFPQ 343
            L+ + G    D+ ++ KE              +AN  A I++ Y+FN +   ++K    
Sbjct: 244 GLRQSAGLK--DKLEYLKEF-------------RANTEANILIFYNFNREAREIKKIIKV 288

Query: 344 GRTLDKDPCTIQEWNE-----GKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQ 398
              +      I ++++     GK  L+     + G G+ LQY   + +FFS  W  +++ 
Sbjct: 289 DFEVSGAVSNIPKFDDYDTLKGKTTLV--QIQAGGAGIELQYNSEV-IFFSPTWSFQDYS 345

Query: 399 QMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           Q      + R  + G K  V VY  I + TI+E V  RL  K    + LL
Sbjct: 346 Q-----ALGRAYRIGQKNKVTVYKYIGKRTIEERVYARLDEKKDFAEKLL 390


>gi|254304375|ref|ZP_04971733.1| Snf2 family helicase [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|148324567|gb|EDK89817.1| Snf2 family helicase [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
          Length = 899

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 94/458 (20%), Positives = 192/458 (41%), Gaps = 60/458 (13%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           ++ D+   A  A  MG GKT+  +  LS +H   +K  +VI P  +  + W +E+++++ 
Sbjct: 459 YLTDNNLGACLADDMGLGKTLQAIALLSNLHEEKKKKSMVIMPKSLIYN-WENEIKKFA- 516

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP--FATIVVDESTKL 129
              + + V  G  +  + + K   +L        G +  +++      F  +++DES  +
Sbjct: 517 -PKLKVGVYYGINRDFSSLKKVDVILTT-----YGTIRNDIENLLEHKFDLLILDESQNI 570

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K+      S+T +A+      +++ + L+GTP  N L++L+    FL+  +  G V Q F
Sbjct: 571 KNI----NSQTTKAVL--LLNAKKRVALSGTPIENNLLELYSLFRFLN-PEMFGSV-QRF 622

Query: 190 VARWFNTTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPIL 242
              +    Q  S    +    K+         +KE+   L D    L   D  +      
Sbjct: 623 TNSYILPIQKYSDTSTIEELKKKIYPFLLRRVKKEVLEDLPDKIEKLVYVDMND------ 676

Query: 243 ITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASK--TVKCLQLANGAVYYDEEKH 300
                       +++++ +R+ Y  L  +N  +  +  K   ++ +      V   E + 
Sbjct: 677 ----------EHRRFYEERRKYYYSLLEKNTSSQGNFDKFFVLQAINELRHIVSSPELET 726

Query: 301 WKEVHDEKIKALEVIIEK-ANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKD 350
            K +  +K   +E +IE   N   ++V  ++ S +  +  +  +         G+T D+ 
Sbjct: 727 KKIISSKKEVLIENVIEAIENNHKVLVFVNYLSSIESICDSLKENKIKYLKMTGQTKDRQ 786

Query: 351 PCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQR 410
               +  N+ +  +      + G GLNL     I ++   WW+       +E   + R  
Sbjct: 787 NLVDKFQNDSRYKVFVMTLKTGGVGLNLVSADTIFIY-DPWWN-----TTVENQAIDRAY 840

Query: 411 QAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           + G  + VF Y +I +NTI+E +L+    K+ + D L+
Sbjct: 841 RLGQDKTVFAYKMIMRNTIEEKILKLQEIKNKLLDDLI 878


>gi|295103966|emb|CBL01510.1| Superfamily II DNA/RNA helicases, SNF2 family [Faecalibacterium
            prausnitzii SL3/3]
          Length = 1098

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 102/441 (23%), Positives = 184/441 (41%), Gaps = 53/441 (12%)

Query: 25   SMGSGKTVSVLTALSYIHLWGEK-SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
             MG GKTV VL+ L  +   G++   L++ P  +  + W  E Q+++    +    + G 
Sbjct: 665  DMGLGKTVQVLSYLLAMKEGGQQLPSLIVCPASLVLN-WQEECQKFT--PQLQSVAMDGD 721

Query: 84   VKQRTKVLKTPA-VLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTAR 142
               R  ++   A    VI   +L    ++L     F   ++DE+  +K+   ++     R
Sbjct: 722  AAHRAALVDGWAQADIVITSYDLLRRDEKLYAGQSFYACILDEAQAIKNHTTQKYKAVCR 781

Query: 143  ALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSH 202
              ++      RF  LTGTP  N L +LW    FL  G      +++F AR+         
Sbjct: 782  VNSR-----VRFA-LTGTPVENRLGELWSIFSFLMPGYL--PPYKTFCARFEKPIVQDED 833

Query: 203  IGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPL------------- 249
              AVR   + T    +    S+    L     +N+ +  L T++  L             
Sbjct: 834  ANAVRRLNQFTGPFILRRMKSEVLRELP-PKTENVRRVELETEQRKLYLAAVVDAREKLR 892

Query: 250  ---PQPVMKQYHKFQ--RELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEV 304
               P+  M  +      RE+ CD +        S++K   CL+L   AV      H   +
Sbjct: 893  AAKPEDKMTVFAVLMRLREICCDPRLVADNWTGSSAKLEACLELVTEAV---AGGHRILL 949

Query: 305  HDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPL 364
              +    LE++ ++ + A +    HF      LQ + P+    ++    ++ +N+G+  +
Sbjct: 950  FSQFTSMLELLAKRLDEAGV---SHFT-----LQGSTPKPVRAEQ----VRRFNQGEADV 997

Query: 365  LFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLI 424
                  + G GLNL    +I++ +  WW+L    Q  +R       + G +  V VY LI
Sbjct: 998  FLISLRAGGTGLNLT-AADIVIHYDPWWNLAAQNQATDRA-----YRIGQRNPVQVYRLI 1051

Query: 425  AQNTIDELVLQRLRTKSTIQD 445
            AQ+TI+E +++  + K ++ D
Sbjct: 1052 AQDTIEEKIVELQQAKQSLAD 1072


>gi|254829448|ref|ZP_05234135.1| helicase [Listeria monocytogenes FSL N3-165]
 gi|258601864|gb|EEW15189.1| helicase [Listeria monocytogenes FSL N3-165]
          Length = 1072

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 104/465 (22%), Positives = 187/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRMAEMEEMKHGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNAGEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK    G+TL     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEDGQTLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|253581922|ref|ZP_04859146.1| SWF/SNF family helicase [Fusobacterium varium ATCC 27725]
 gi|251836271|gb|EES64808.1| SWF/SNF family helicase [Fusobacterium varium ATCC 27725]
          Length = 926

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 109/480 (22%), Positives = 182/480 (37%), Gaps = 103/480 (21%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           +++D+      A  MG GKT+  +  L+ +H    K  LVI P  +  + W  E++R+S 
Sbjct: 485 YLMDNNLGGCLADDMGLGKTLQAIAVLTRLHEEKGKKSLVIMPKSLIYN-WEGEIKRFS- 542

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKS 131
              + + +  G  +    + K   +L    +  +   ++ LK    F TI++DES  +K+
Sbjct: 543 -PKLKVGIYYGNFRNIDIIKKNSVIL--TTYGTIRNDIETLK-EMKFDTIILDESQNIKN 598

Query: 132 FRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVA 191
                 ++T +A+      S+  I L+GTP  N L +L+                   + 
Sbjct: 599 I----NAQTTKAIM--LLNSKNRIALSGTPIENNLGELYS------------------LF 634

Query: 192 RWFNTTQIGSHIGAVRYTA----KETAQKEIEA-----------QLSDCCLSLDIADYQN 236
           R+ N    G+      Y A    KE  Q+ IE            ++    L  D+ D   
Sbjct: 635 RFLNPAMFGTAEEFNNYYAVPIQKENDQEAIEELKKKIYPFILRRVKKEVLK-DLPD--K 691

Query: 237 IDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENI-------------EAFNSASKTV 283
           I+K + I   V       K+ ++ +R  Y  +    I             +A N   +  
Sbjct: 692 IEKTMFIEMNVE-----QKKLYEERRSYYYKMVNSQIRENGIGKTQFFILQALNELRQIT 746

Query: 284 KCLQ-------------LANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHF 330
            C +             L N  V   E  H   V    I ++E I E             
Sbjct: 747 SCPEAKSNGVTSSKREVLVNNIVEAVENGHKVLVFTNYINSIENICE------------- 793

Query: 331 NSDLARLQKAFPQ--GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFF 388
             DL R    +    G T D+     +   + K  +      + G GLNL     I ++ 
Sbjct: 794 --DLKRYGINYLSMTGSTKDRQSLVDRFQKDNKYKVFIMTLKTGGVGLNLTAADTIFIY- 850

Query: 389 SLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
             WW+     + +E   + R  + G  R VF Y LI ++TI+E +LQ   TKS + D L+
Sbjct: 851 DPWWN-----KTVENQAIDRAYRLGQDRTVFSYKLILKDTIEEKILQLQDTKSKLLDNLI 905


>gi|326798503|ref|YP_004316322.1| SNF2-related protein [Sphingobacterium sp. 21]
 gi|326549267|gb|ADZ77652.1| SNF2-related protein [Sphingobacterium sp. 21]
          Length = 970

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 116/453 (25%), Positives = 193/453 (42%), Gaps = 65/453 (14%)

Query: 25  SMGSGKTVSVLTALSY-IHLWGEKSV----LVIAPLRVAQSVWTSEVQRWSNFSHMNISV 79
            MG GKTV  L  L        EK +    L+I P  +  + W SE ++++    +NI +
Sbjct: 534 DMGLGKTVQTLALLQKEREELQEKGIQGTSLIIMPTSLIYN-WQSEAEKFA--PALNILI 590

Query: 80  ITGTVKQRTKVLKTPAVL-YVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGS 138
            TGT   R KV         VI    +  + +EL   + F  I++DES  +K+      S
Sbjct: 591 HTGT--NRPKVNDHFGKFDVVITTYGIARVDEELLQGFYFHYIILDESQNIKN----PSS 644

Query: 139 KTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGR--VFQS-FV--ARW 193
           K+ +A+ +    S+  + L+GTP  N + DLW Q+ FL+ G  LG    FQS FV     
Sbjct: 645 KSFKAVKE--LRSKYRLTLSGTPVENSVGDLWSQMSFLNPG-LLGSHAHFQSDFVIPIEK 701

Query: 194 FNTTQIGSHIGAV------RYTAKETAQK--EIEAQLSDCCLSLDIADYQNIDKPILITK 245
               +    + A+      R T  + AQ+      Q+  C +S + A+Y   +K     +
Sbjct: 702 KKDEEKARKLQAIIKPFVLRRTKDQVAQELPPKSEQIFYCKMSDEQAEY--YEKIKSEYR 759

Query: 246 KVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVH 305
            V L Q + +   K Q ++   LQG             K  QLAN     DE+   +   
Sbjct: 760 NVLLEQSLDELMVKSQIQV---LQG-----------LTKLRQLANHPRMVDEDYEGESGK 805

Query: 306 DEK-IKALEVIIEKANAAPIIVAY---------HFNSDLARLQKAFPQGRTLDKDPCTIQ 355
            E  +  L+ ++ + +   I   +         HF  D  +++ A+  G T +++     
Sbjct: 806 FENVVHTLDSVLSRGHKVLIFSQFVKQLEIFRRHF--DKKKIRYAYLDGSTRNREDVVND 863

Query: 356 EWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFK 415
             N  ++ L      + G GLNL     + +    WW+    QQ I+     R  + G  
Sbjct: 864 FRNNEEVKLFLISIKAGGVGLNLIEADYVFI-LDPWWNPAVEQQAID-----RSHRIGQT 917

Query: 416 RAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           + VF+Y  I +++++E +L     K TI + L+
Sbjct: 918 KNVFIYKFITKDSVEEKILALQDRKKTIANQLI 950


>gi|160942559|ref|ZP_02089806.1| hypothetical protein FAEPRAM212_00034 [Faecalibacterium prausnitzii
            M21/2]
 gi|158446143|gb|EDP23146.1| hypothetical protein FAEPRAM212_00034 [Faecalibacterium prausnitzii
            M21/2]
          Length = 1098

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 102/441 (23%), Positives = 184/441 (41%), Gaps = 53/441 (12%)

Query: 25   SMGSGKTVSVLTALSYIHLWGEK-SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
             MG GKTV VL+ L  +   G++   L++ P  +  + W  E Q+++    +    + G 
Sbjct: 665  DMGLGKTVQVLSYLLAMKEGGQQLPSLIVCPASLVLN-WQEECQKFT--PQLQSVAMDGD 721

Query: 84   VKQRTKVLKTPA-VLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTAR 142
               R  ++   A    VI   +L    ++L     F   ++DE+  +K+   ++     R
Sbjct: 722  AAHRAALVDGWAQADIVITSYDLLRRDEKLYAGQSFYACILDEAQAIKNHTTQKYKAVCR 781

Query: 143  ALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSH 202
              ++      RF  LTGTP  N L +LW    FL  G      +++F AR+         
Sbjct: 782  VNSR-----VRFA-LTGTPVENRLGELWSIFSFLMPGYL--PPYKTFCARFEKPIVQDED 833

Query: 203  IGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPL------------- 249
              AVR   + T    +    S+    L     +N+ +  L T++  L             
Sbjct: 834  ANAVRRLNQFTGPFILRRMKSEVLRELP-PKTENVRRVELETEQRKLYLAAVVDAREKLR 892

Query: 250  ---PQPVMKQYHKFQ--RELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEV 304
               P+  M  +      RE+ CD +        S++K   CL+L   AV      H   +
Sbjct: 893  AAKPEDKMTVFAVLMRLREICCDPRLVADNWTGSSAKLDACLELVTEAV---AGGHRILL 949

Query: 305  HDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPL 364
              +    LE++ ++ + A +    HF      LQ + P+    ++    ++ +N+G+  +
Sbjct: 950  FSQFTSMLELLAKRLDEAGV---SHFT-----LQGSTPKPVRAEQ----VRRFNQGEADV 997

Query: 365  LFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLI 424
                  + G GLNL    +I++ +  WW+L    Q  +R       + G +  V VY LI
Sbjct: 998  FLISLRAGGTGLNLT-AADIVIHYDPWWNLAAQNQATDRA-----YRIGQRNPVQVYRLI 1051

Query: 425  AQNTIDELVLQRLRTKSTIQD 445
            AQ+TI+E +++  + K ++ D
Sbjct: 1052 AQDTIEEKIVELQQAKQSLAD 1072


>gi|317063195|ref|ZP_07927680.1| SWF/SNF family helicase [Fusobacterium ulcerans ATCC 49185]
 gi|313688871|gb|EFS25706.1| SWF/SNF family helicase [Fusobacterium ulcerans ATCC 49185]
          Length = 926

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 107/476 (22%), Positives = 185/476 (38%), Gaps = 95/476 (19%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           +++D+      A  MG GKT+  +  L+ +H    K  LVI P  +  + W  E++R+S 
Sbjct: 485 YLMDNNLGGCLADDMGLGKTLQAIAVLTRLHEEKGKKSLVIMPKSLIYN-WEGEIKRFS- 542

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKS 131
              + + +  G  +    + K   +L    +  +   ++ LK    F TI++DES  +K+
Sbjct: 543 -PKLKVGIYYGNFRNVDIIKKNSVIL--TTYGTIRNDIETLK-EMKFDTIILDESQNIKN 598

Query: 132 FRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVA 191
                 ++T +A+     +S+  I L+GTP  N L                G ++  F  
Sbjct: 599 I----NAQTTKAIM--LLDSKNRIALSGTPIENNL----------------GELYSLF-- 634

Query: 192 RWFNTTQIGSHIGAVRYTA----KETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKV 247
           R+ N    G+      Y A    KE  Q+ IE +L        +   + + K +L     
Sbjct: 635 RFLNPAMFGTAEEFNNYYAVPIQKENDQEAIE-ELKKKIYPFIL---RRVKKEVLKDLPD 690

Query: 248 PLPQPVMKQYHKFQRELYCDLQG-----------EN---------IEAFNSASKTVKCLQ 287
            + + +  + +  Q++LY + +            EN         ++A N   +   C +
Sbjct: 691 KIEKTMFIEMNAEQKKLYEERRSYYYKMVNSQIRENGIGKTQFFILQALNELRQITSCPE 750

Query: 288 -------------LANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDL 334
                        L N  V   E  H   V    I ++E I E               DL
Sbjct: 751 AKSNGVTSSKREVLVNNIVEAVENGHKVLVFTNYINSIENICE---------------DL 795

Query: 335 ARLQKAFPQ--GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWW 392
            R    +    G T D+     +   + K  +      + G GLNL     I ++   WW
Sbjct: 796 KRYGINYLSMTGSTKDRQSLVDRFQKDNKYKVFIMTLKTGGVGLNLTAADTIFIY-DPWW 854

Query: 393 DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           +     + +E   + R  + G  R VF Y LI ++TI+E +LQ   TKS + D L+
Sbjct: 855 N-----KTVENQAIDRAYRLGQDRTVFSYKLILKDTIEEKILQLQDTKSKLLDNLI 905


>gi|257468947|ref|ZP_05633041.1| SWF/SNF family helicase [Fusobacterium ulcerans ATCC 49185]
          Length = 915

 Score = 65.5 bits (158), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 107/476 (22%), Positives = 185/476 (38%), Gaps = 95/476 (19%)

Query: 13  WILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSN 71
           +++D+      A  MG GKT+  +  L+ +H    K  LVI P  +  + W  E++R+S 
Sbjct: 474 YLMDNNLGGCLADDMGLGKTLQAIAVLTRLHEEKGKKSLVIMPKSLIYN-WEGEIKRFS- 531

Query: 72  FSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKS 131
              + + +  G  +    + K   +L    +  +   ++ LK    F TI++DES  +K+
Sbjct: 532 -PKLKVGIYYGNFRNVDIIKKNSVIL--TTYGTIRNDIETLK-EMKFDTIILDESQNIKN 587

Query: 132 FRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVA 191
                 ++T +A+     +S+  I L+GTP  N L                G ++  F  
Sbjct: 588 I----NAQTTKAIM--LLDSKNRIALSGTPIENNL----------------GELYSLF-- 623

Query: 192 RWFNTTQIGSHIGAVRYTA----KETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKV 247
           R+ N    G+      Y A    KE  Q+ IE +L        +   + + K +L     
Sbjct: 624 RFLNPAMFGTAEEFNNYYAVPIQKENDQEAIE-ELKKKIYPFIL---RRVKKEVLKDLPD 679

Query: 248 PLPQPVMKQYHKFQRELYCDLQG-----------EN---------IEAFNSASKTVKCLQ 287
            + + +  + +  Q++LY + +            EN         ++A N   +   C +
Sbjct: 680 KIEKTMFIEMNAEQKKLYEERRSYYYKMVNSQIRENGIGKTQFFILQALNELRQITSCPE 739

Query: 288 -------------LANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDL 334
                        L N  V   E  H   V    I ++E I E               DL
Sbjct: 740 AKSNGVTSSKREVLVNNIVEAVENGHKVLVFTNYINSIENICE---------------DL 784

Query: 335 ARLQKAFPQ--GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWW 392
            R    +    G T D+     +   + K  +      + G GLNL     I ++   WW
Sbjct: 785 KRYGINYLSMTGSTKDRQSLVDRFQKDNKYKVFIMTLKTGGVGLNLTAADTIFIY-DPWW 843

Query: 393 DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
           +     + +E   + R  + G  R VF Y LI ++TI+E +LQ   TKS + D L+
Sbjct: 844 N-----KTVENQAIDRAYRLGQDRTVFSYKLILKDTIEEKILQLQDTKSKLLDNLI 894


>gi|332876880|ref|ZP_08444634.1| protein, SNF2 family [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332685163|gb|EGJ58006.1| protein, SNF2 family [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 952

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 102/495 (20%), Positives = 209/495 (42%), Gaps = 93/495 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIH-LWGEKS--------- 48
           L P+Q + V+W+L H    + A     MG GKT+  +  L  IH    EKS         
Sbjct: 478 LRPYQIEGVEWLLQHYHNGVGACLADDMGLGKTLQTIALLVNIHDSLPEKSIDSSDLFSG 537

Query: 49  ---------VLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLK--TPAVL 97
                    VLVI P  +  + W  E +R++   H+  +   GT  +R + ++  T   L
Sbjct: 538 VEVQKEALKVLVILPSSLIFN-WYDETKRFA--PHLKCTQYVGTGIERKRKIRRLTNYDL 594

Query: 98  YVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIEL 157
              ++  +   ++EL+    F  I++DES ++K+    + SKT +A+   + ++   I L
Sbjct: 595 VFTSYPIVERDIKELQ-QLDFRYIILDESQRIKN----KNSKTFKAIN--SLKAPHRIAL 647

Query: 158 TGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVR--------YT 209
           +GTP  N L DLW Q+ F++    + + + SF   +        ++ A+         + 
Sbjct: 648 SGTPIENSLSDLWSQMQFINPN--ILKSYPSFHKNYEIEISKKKNLQALEELKTIISPFL 705

Query: 210 AKETAQK------EIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRE 263
            + T ++      E+EAQ+  C L+ + A +   +K  +  + + +  P+ +        
Sbjct: 706 LRRTKEQVLDDLPEMEAQIIYCPLAEEQAKWYESEKSKVRNQLLQIAAPITE-------- 757

Query: 264 LYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKE-VHDEKIKALEVIIEKANAA 322
                       FN+ +   K  Q++N  +  D++       ++E +  ++ +++ ++ A
Sbjct: 758 ------------FNALNMLTKLRQISNHPMLADKDSLIPSGKYEEVVNCMQELVQASHKA 805

Query: 323 PIIVAY--HFN----------SDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPA 370
            I  ++  H +             A+L  + P     ++     Q     ++   F    
Sbjct: 806 LIFSSFVSHLSIYEQWCKENGVKYAKLTGSTPTAERKNEVEAFQQ---NPEVTFFFISLK 862

Query: 371 SCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTID 430
           +   GLNL     +L+    WW+        E+  + R  + G K  V V   ++++T++
Sbjct: 863 AGEVGLNLTQASYVLL-LDPWWN-----PFSEKQAIARAHRLGQKNKVNVVRFVSKDTVE 916

Query: 431 ELVLQRLRTKSTIQD 445
           E +++  + K+ + D
Sbjct: 917 EKIIRLQKAKTDLAD 931


>gi|315303447|ref|ZP_07874044.1| DNA/RNA helicase protein [Listeria ivanovii FSL F6-596]
 gi|313628192|gb|EFR96728.1| DNA/RNA helicase protein [Listeria ivanovii FSL F6-596]
          Length = 1072

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 100/465 (21%), Positives = 190/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL++ P  +  + W SE+ +++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELENNPNLKPVLIVTPASLLYN-WQSELGKFAPM--IPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   +K      +Y+I++ +L   +  L     F+++++DES  +K++  +  S+
Sbjct: 698  GTKESRMAEMKEMKRGHVYLISYPSLRQDILNLADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              ++Q+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IYQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y+NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YENIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGENIEAF-------------NSASKTVKCLQLANG-----AVYYDE 297
               K +  LY +L  E    +             +S + + + ++L  G      +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEESSGNASEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARLQKAFPQ-GRTL----D 348
                +    E  K L++       + N   I++   F   LA +++   + G+T      
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILIFSQFTGMLAIIRRKLEEDGQTFFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSRTRLDMVNSFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|317058831|ref|ZP_07923316.1| SWF/SNF family helicase [Fusobacterium sp. 3_1_5R]
 gi|313684507|gb|EFS21342.1| SWF/SNF family helicase [Fusobacterium sp. 3_1_5R]
          Length = 1009

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 105/465 (22%), Positives = 189/465 (40%), Gaps = 89/465 (19%)

Query: 17  HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN 76
           H    +   MG GKT+  +  L+ +H   +KS L+I P  +  + W SE++++S    + 
Sbjct: 574 HLGACLADDMGLGKTLQAIAILTKLHQEKKKS-LIIMPKSLIYN-WQSEIEKFS--PGLK 629

Query: 77  ISVITGTVKQRTKVLKTPAVLYVI-NFENLGWLVQELKGTWPFATIVVDESTKLKSFRLR 135
           + +  G  +    + +   +L       N   L++E    + F  +++DES  +K+    
Sbjct: 630 VGIYYGNHRDLQVMEEQDVILTTYGTVRNDIVLLKE----FFFDLVILDESQNIKNIH-- 683

Query: 136 QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFN 195
             S+T RA+     +S+  I L+GTP  N L +L+    FL+ G     +F S     FN
Sbjct: 684 --SQTTRAVM--LLQSQNRIALSGTPIENNLSELYSLFRFLNPG-----MFGSL--EEFN 732

Query: 196 TT-----QIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPILI 243
            T     Q  ++  AV+   K+         +KE+   L D            I+K I I
Sbjct: 733 NTYALPIQKENNPEAVQDLRKKIYPFILRRVKKEVLQDLPD-----------KIEKTIYI 781

Query: 244 TKKVPLPQPVMKQYHKFQRELYCDLQGENI-------------EAFNSASKTVKCLQLAN 290
              V       K++++ +R  Y ++   +I             +A N   +   C ++ N
Sbjct: 782 DMNVE-----HKKFYEERRNYYYNMIHASIREKGLGKAQFFILQALNELRQITSCPEVKN 836

Query: 291 GAVYYDEEKHWKEVHDEKIKALEVIIEKA-NAAPIIVAYHFNSDLARLQKAFPQ------ 343
             +             +K   +E I+E   N   ++V  ++   +  + K+  +      
Sbjct: 837 SYI----------SSSKKEMLIEQIVEAVENDHKVLVFTNYIGSIENICKSLEEREIAYL 886

Query: 344 ---GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQM 400
              G T D+     +     K  +      + G GLNL     I + +  WW+     + 
Sbjct: 887 SMTGSTKDRQQLVNKFQKNEKYKVFVMTLKTGGVGLNLTAADTIFI-YDPWWN-----KT 940

Query: 401 IERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
           +E   + R  + G  R VF Y LI ++TI+E +LQ    KS + D
Sbjct: 941 VENQAIDRAYRLGQDRTVFSYKLILKDTIEEKILQLQELKSKLLD 985


>gi|257452288|ref|ZP_05617587.1| SWF/SNF family helicase [Fusobacterium sp. 3_1_5R]
          Length = 1134

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 101/460 (21%), Positives = 187/460 (40%), Gaps = 79/460 (17%)

Query: 17   HKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN 76
            H    +   MG GKT+  +  L+ +H   +KS L+I P  +  + W SE++++S    + 
Sbjct: 699  HLGACLADDMGLGKTLQAIAILTKLHQEKKKS-LIIMPKSLIYN-WQSEIEKFS--PGLK 754

Query: 77   ISVITGTVKQRTKVLKTPAVLYVI-NFENLGWLVQELKGTWPFATIVVDESTKLKSFRLR 135
            + +  G  +    + +   +L       N   L++E    + F  +++DES  +K+    
Sbjct: 755  VGIYYGNHRDLQVMEEQDVILTTYGTVRNDIVLLKE----FFFDLVILDESQNIKNIH-- 808

Query: 136  QGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFN 195
              S+T RA+     +S+  I L+GTP  N L +L+    FL+ G  +    + F   +  
Sbjct: 809  --SQTTRAVM--LLQSQNRIALSGTPIENNLSELYSLFRFLNPG--MFGSLEEFNNTYAL 862

Query: 196  TTQIGSHIGAVRYTAKET-------AQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVP 248
              Q  ++  AV+   K+         +KE+   L D            I+K I I   V 
Sbjct: 863  PIQKENNPEAVQDLRKKIYPFILRRVKKEVLQDLPD-----------KIEKTIYIDMNVE 911

Query: 249  LPQPVMKQYHKFQRELYCDLQGENI-------------EAFNSASKTVKCLQLANGAVYY 295
                  K++++ +R  Y ++   +I             +A N   +   C ++ N  +  
Sbjct: 912  -----HKKFYEERRNYYYNMIHASIREKGLGKAQFFILQALNELRQITSCPEVKNSYI-- 964

Query: 296  DEEKHWKEVHDEKIKALEVIIEKA-NAAPIIVAYHFNSDLARLQKAFPQ---------GR 345
                       +K   +E I+E   N   ++V  ++   +  + K+  +         G 
Sbjct: 965  --------SSSKKEMLIEQIVEAVENDHKVLVFTNYIGSIENICKSLEEREIAYLSMTGS 1016

Query: 346  TLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIG 405
            T D+     +     K  +      + G GLNL     I + +  WW+     + +E   
Sbjct: 1017 TKDRQQLVNKFQKNEKYKVFVMTLKTGGVGLNLTAADTIFI-YDPWWN-----KTVENQA 1070

Query: 406  VTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQD 445
            + R  + G  R VF Y LI ++TI+E +LQ    KS + D
Sbjct: 1071 IDRAYRLGQDRTVFSYKLILKDTIEEKILQLQELKSKLLD 1110


>gi|47096999|ref|ZP_00234573.1| helicase, Snf2 family [Listeria monocytogenes str. 1/2a F6854]
 gi|254898188|ref|ZP_05258112.1| hypothetical protein LmonJ_00195 [Listeria monocytogenes J0161]
 gi|254912319|ref|ZP_05262331.1| helicase [Listeria monocytogenes J2818]
 gi|254936646|ref|ZP_05268343.1| helicase [Listeria monocytogenes F6900]
 gi|47014621|gb|EAL05580.1| helicase, Snf2 family [Listeria monocytogenes str. 1/2a F6854]
 gi|258609243|gb|EEW21851.1| helicase [Listeria monocytogenes F6900]
 gi|293590301|gb|EFF98635.1| helicase [Listeria monocytogenes J2818]
          Length = 1072

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 103/465 (22%), Positives = 188/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRMAEMEEMKRGRVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNAGEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK   +G+ L     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEEGQPLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E + +  + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFELQKKKQALVDELI 1044


>gi|325570841|ref|ZP_08146524.1| Snf2 family protein [Enterococcus casseliflavus ATCC 12755]
 gi|325156351|gb|EGC68533.1| Snf2 family protein [Enterococcus casseliflavus ATCC 12755]
          Length = 1054

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 91/428 (21%), Positives = 182/428 (42%), Gaps = 67/428 (15%)

Query: 26   MGSGKTVSVLTALSYIHLWGEK------SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISV 79
            MG GKTV  ++     +L  EK      + L++AP  +  + W  E++R++    ++ +V
Sbjct: 630  MGLGKTVQTIS-----YLLSEKQEHQKLNALIVAPASLTFN-WQQEIKRFA--PSISATV 681

Query: 80   ITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            I+GT ++R   +   A + + ++ +L   +   +     + +++DE+  +K+      +K
Sbjct: 682  ISGTKEEREAQMAQSADVRITSYASLRQDIDAYQA-LELSCLILDEAQMVKN----SATK 736

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
            TA+AL   + E  +   L+GTP  N L +LW              +FQ  +  +F   Q 
Sbjct: 737  TAQALR--SLEVPQRFALSGTPIENNLEELWS-------------LFQMIMPGFFPNKQ- 780

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIAD-YQNIDKPILITKKVPLPQPVMKQYH 258
                       KE + +EI   +    L  D      ++ + +       L +   K Y 
Sbjct: 781  ---------KFKELSTQEIAKMIKPFILRRDKKSVLHDLPQKLETNYYSVLTEEQKKIYL 831

Query: 259  KFQRELYCDLQGENIEAFNSASKTV-----KCLQLANGAVYYDEEKHWKEVHDEKIKALE 313
             + R++  ++   +  +F     ++     +  Q+      + E+        E++K L 
Sbjct: 832  AYLRQMREEIAQMDSTSFRKNRISILAGLTRLRQICCDPRLFVEDYEGSSGKLEQVKDL- 890

Query: 314  VIIEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQEWNEGKIP 363
            ++  K N   +++   F S L+ +++   Q         G T  +D  T +  +N G+  
Sbjct: 891  LLAAKENGRRVLLFSQFTSMLSIIEEELAQEGFESFYLRGSTPPQDRLTMVNAFNSGEKD 950

Query: 364  LLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYL 423
            +      + G GLNL  G + ++ + LWW+       +E     R  + G K  V V+ +
Sbjct: 951  VFLISLKAGGTGLNLT-GADTVILYDLWWN-----PAVEEQAAGRAHRIGQKNVVEVWRM 1004

Query: 424  IAQNTIDE 431
            IA+ TI+E
Sbjct: 1005 IAEGTIEE 1012


>gi|254832046|ref|ZP_05236701.1| hypothetical protein Lmon1_11855 [Listeria monocytogenes 10403S]
          Length = 1072

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 103/465 (22%), Positives = 188/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRMAEMEEMKRGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNAGEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK   +G+ L     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEEGQPLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E + +  + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFELQKKKQALVDELI 1044


>gi|313676698|ref|YP_004054694.1| snf2-related protein [Marivirga tractuosa DSM 4126]
 gi|312943396|gb|ADR22586.1| SNF2-related protein [Marivirga tractuosa DSM 4126]
          Length = 976

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 112/498 (22%), Positives = 200/498 (40%), Gaps = 86/498 (17%)

Query: 3   LAPHQTKIVDWI-----LDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSV-LVIAPLR 56
           L P+Q +  +W+      +   C +   MG GKTV  L  L      G  +  L+I P  
Sbjct: 518 LRPYQKEGFNWLQFLNQYNFGGC-LADDMGLGKTVQTLAMLQSEKESGRTAASLLIMPTS 576

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTW 116
           +  + W SE ++++    + I V TGT + +         L + ++  +  L  E+   +
Sbjct: 577 LVYN-WQSEAEKFT--PELKIFVYTGTNRIKDSKQFEDYDLILTSY-GITRLDVEILSEF 632

Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
            F  I++DES  +K+      S  A+A+ K   +S R + LTGTP  N  +DLW Q+ F+
Sbjct: 633 LFNYIILDESQAIKN----PDSHIAKAVKK--LKSRRKLVLTGTPVENSTMDLWSQMSFV 686

Query: 177 DKG-------------------------KRLGRVFQSFVARWFNT---TQIGSHIGAVRY 208
           + G                         ++L  + + F+ R   +   T++   I  V Y
Sbjct: 687 NPGLLGNKKFFKDEFVTPIEKKRDEQKSQKLATLIKPFILRRHKSQVATELPDKIENVHY 746

Query: 209 TAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPV--MKQYHKFQRELYC 266
           +   T Q+E   ++ +    + I D   I+K  + + ++ L Q +  ++Q     + +  
Sbjct: 747 SGMTTMQEEKYEEVKNYFRDM-ILD--EIEKKGIRSSQMILLQGLTQLRQIANHPKMVDP 803

Query: 267 DLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIV 326
           + QG+       + K      +    +    E H   +  + +K L +  E    + I  
Sbjct: 804 EYQGD-------SGKMEDVTHMLTSII---SEGHKVLIFSQFVKHLSLFKEFMERSHIKY 853

Query: 327 AYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILV 386
           AY               G T D+            + +      + G GLNL    + + 
Sbjct: 854 AY-------------LDGTTKDRQKQVKLFQENQDLSVFLISLKAGGLGLNLT-AADYVF 899

Query: 387 FFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTI-QD 445
               WW+       IE+  V R  + G K+ VF Y  I +NT++E +L     K T+ +D
Sbjct: 900 LLDPWWN-----PAIEQQAVDRAHRIGQKQQVFTYKFITKNTVEEKILALQEKKLTLARD 954

Query: 446 LL------LNALKKETIH 457
           L+      + +L KE I 
Sbjct: 955 LISTEESFMKSLSKEDIQ 972


>gi|16803684|ref|NP_465169.1| hypothetical protein lmo1644 [Listeria monocytogenes EGD-e]
 gi|16411080|emb|CAC99722.1| lmo1644 [Listeria monocytogenes EGD-e]
          Length = 1072

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 103/465 (22%), Positives = 188/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRMAEMEEMKRGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNAGEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK   +G+ L     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEEGQPLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E + +  + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFELQKKKQALVDELI 1044


>gi|284802036|ref|YP_003413901.1| hypothetical protein LM5578_1791 [Listeria monocytogenes 08-5578]
 gi|284995178|ref|YP_003416946.1| hypothetical protein LM5923_1743 [Listeria monocytogenes 08-5923]
 gi|284057598|gb|ADB68539.1| hypothetical protein LM5578_1791 [Listeria monocytogenes 08-5578]
 gi|284060645|gb|ADB71584.1| hypothetical protein LM5923_1743 [Listeria monocytogenes 08-5923]
          Length = 1072

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 103/465 (22%), Positives = 188/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRMAEMEEMKHGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNAGEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK   +G+ L     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEEGQPLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E + +  + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFELQKKKQALVDELI 1044


>gi|227505607|ref|ZP_03935656.1| helicase [Corynebacterium striatum ATCC 6940]
 gi|227197760|gb|EEI77808.1| helicase [Corynebacterium striatum ATCC 6940]
          Length = 1087

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 111/482 (23%), Positives = 184/482 (38%), Gaps = 63/482 (13%)

Query: 2    NLAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRV 57
             L P+Q     W+   +R          MG GKT+ +L   S I   G    LV+AP  V
Sbjct: 626  TLRPYQEDGFRWLASLRRRGFGGVLADDMGLGKTIQIL---SMILDSGAGPWLVVAPTSV 682

Query: 58   AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT---PAVLYVINFENLGWLVQELKG 114
              S W +E  +++    + ++V+  TVK+R   L +    A + V ++  L     E + 
Sbjct: 683  V-SNWKAEAAKFA--PSLRVTVVEATVKRRQDSLASLAESADVLVTSYTLLRLEASEYQA 739

Query: 115  TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
                A +V+DE+  +K+    +     R L  P         +TGTP  N L D W Q  
Sbjct: 740  LG-VAGVVLDEAQNVKN-PTSKIYAAVRDLQAPV-----LYAVTGTPIENSLKDAWSQFS 792

Query: 175  FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
                G  L   FQ F  R+         I        +T   E+  ++    L    AD 
Sbjct: 793  LAAPG--LLGSFQQFRERFEKP------IAGNDTELSKTRMAELRRRVEPFLLRRRKADV 844

Query: 235  QNIDKPILITKKVPLPQP----------VMKQYHKFQRELYCDLQGENIEAFNSASKTVK 284
              +D P +  + VP+             + ++  +  R L  D +   +E     +   +
Sbjct: 845  A-LDLPPIQEQVVPVELAPAHRNLYDVHLARERQRVLRLLTEDPESNRVEVL---AALTR 900

Query: 285  CLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEK--ANAAPIIVAYHFNSDLARLQK--- 339
              QLA      + E         K+ A+  ++    A    +++   F S LA ++    
Sbjct: 901  LRQLAISPTLVEPESG---APSSKLDAMTGLLRDILAEEHRVLIFSQFTSYLAEIRARLE 957

Query: 340  ------AFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWD 393
                  ++  G T D+D   I+ + EG   +      + G GLNL     ++V    WW+
Sbjct: 958  AEGVSFSYLDGGTRDRD-AAIRAFTEGNTQVFLISLKAGGVGLNLTQADYVIV-ADPWWN 1015

Query: 394  LEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
                 Q I+     R  + G  + V VY L++ NTI++ V+    TK  +    L     
Sbjct: 1016 PAAEAQAID-----RAHRIGQTQPVTVYRLVSANTIEDKVVALQDTKRALSSAFLEPTGS 1070

Query: 454  ET 455
             T
Sbjct: 1071 AT 1072


>gi|152977445|ref|YP_001376962.1| non-specific serine/threonine protein kinase [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|152026197|gb|ABS23967.1| Non-specific serine/threonine protein kinase [Bacillus cytotoxicus
           NVH 391-98]
          Length = 918

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 109/498 (21%), Positives = 192/498 (38%), Gaps = 98/498 (19%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYI--HLWGEKSVLVIAPLR 56
           L P+Q   V W+L  +     A     MG GK++  +T L Y+  +       L++AP  
Sbjct: 451 LRPYQEHGVSWLLYLRELGFGALLADDMGLGKSIQTITYLLYVKENKLQTGPALIVAPTS 510

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   H+ + +  G+ + + +  K        V+    L  L +E   
Sbjct: 511 VLGN-WQKEFERFA--PHLKVILHYGSNRAKGEAFKEFLQGADVVLTSYALSQLDEEELS 567

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           T  + +I++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 568 TLCWDSIILDEAQNIKNPHTKQ-SKAVRKL-----KANHKIALTGTPMENRLAELWSIFD 621

Query: 175 FLDKG--KRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIA 232
           FL+ G    LG+  + FV          + I   R  AK                   I 
Sbjct: 622 FLNHGYLGSLGQFQRRFV----------TPIEKDRDEAK-------------------IQ 652

Query: 233 DYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNS 278
             Q    P L+ +        +    K +++ YC L GE              N+E  N 
Sbjct: 653 QVQRFISPFLLRRTKQDQTVALNLPDKQEQKAYCPLTGEQASLYEQLVQDTLKNVENLNG 712

Query: 279 ASKT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI-----IEKANAAPIIV 326
             +         K  Q+ N    Y +E   K++    +K   ++     I+  N + +I 
Sbjct: 713 IERRGFILLMLNKLKQICNHPALYLKEDVPKDIVQRSMKMQTLMDLIENIKNQNESCLIF 772

Query: 327 AYH--------------FNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASC 372
             +              F   +  L  + P+ +  DK    I+++      +      + 
Sbjct: 773 TQYIGMGHMLQTVLEETFGQRVLYLNGSVPK-KERDK---MIEQFQNRTYDIFILSLKAG 828

Query: 373 GHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDEL 432
           G GLNL    N ++ +  WW+       +E     R  + G KR V V+ LI   T++E 
Sbjct: 829 GTGLNLT-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEK 882

Query: 433 VLQRLRTKSTIQDLLLNA 450
           + + L  K ++ + ++ +
Sbjct: 883 IDEMLERKQSLNNAVITS 900


>gi|313623518|gb|EFR93710.1| SNF2 family helicase [Listeria innocua FSL J1-023]
          Length = 650

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 98/464 (21%), Positives = 190/464 (40%), Gaps = 101/464 (21%)

Query: 25  SMGSGKTVSVLTALS--YIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG 82
            MG GKTV  ++ L+         K VL++ P  +  + W SE+++++    + ++V+ G
Sbjct: 220 DMGLGKTVQTISFLASELEENPNLKPVLIVTPASLLYN-WQSELEKFA--PEIPVTVLHG 276

Query: 83  TVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKT 140
           T + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+ 
Sbjct: 277 TKQARMAEVEEIKHGHVYLISYPSLRQDIIHFADV-AFSSVIIDESQAIKNYHTK-ASQA 334

Query: 141 ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIG 200
            RAL +          L+GTP  N + +LW              +FQ+ +  +F + +  
Sbjct: 335 VRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRKF 376

Query: 201 SHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQY 257
             I                              Y+NI K   P L+ +   L Q V+K+ 
Sbjct: 377 KEI-----------------------------PYENIAKMIRPFLLRR---LKQDVVKEL 404

Query: 258 -HKFQRELYCDLQGENIEAFNSASKTVKC-LQLANG-----------------AVYYDEE 298
             K +  LY +L  E    + +  + ++  L+ +NG                  +  D  
Sbjct: 405 PDKIETNLYSELTDEQKTIYLAYLEKIQADLEESNGNASEERIKLLAGLTRLRQICCDPS 464

Query: 299 KHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARLQKAFPQ-GRTL----DK 349
              +    E  K L++       + N   I++   F   LA +++   + G++L     K
Sbjct: 465 LFVENYQGESGKLLQLFDTIQTARENGKRILIFSQFTGMLAIIRRKLEEDGQSLFYMDGK 524

Query: 350 DPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERI 404
            P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E  
Sbjct: 525 TPAKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEEQ 578

Query: 405 GVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
              R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 579 ATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 622


>gi|310828799|ref|YP_003961156.1| hypothetical protein ELI_3224 [Eubacterium limosum KIST612]
 gi|308740533|gb|ADO38193.1| hypothetical protein ELI_3224 [Eubacterium limosum KIST612]
          Length = 573

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 98/478 (20%), Positives = 203/478 (42%), Gaps = 64/478 (13%)

Query: 19  RCA--IWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHM 75
           RC    +  MG GK+++ +     ++L  + +++L++APL V   VW  E   ++ + + 
Sbjct: 110 RCGYGFFFEMGCGKSLTAVAVAGQLYLEKQIRTLLIVAPLSVI-PVWPREFGDYAGYPY- 167

Query: 76  NISVITGTVKQRTKVL------KTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKL 129
           +++V+  + +++          K    +  IN+E+   L  EL   + F  I+ DE  ++
Sbjct: 168 SVTVLDDSSRKKKLEKLKAAKGKPGLCVVAINYESCWRLETELL-AFGFDMIIADEGQRI 226

Query: 130 KSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF 189
           K       SK ++AL     ++   ++LTGTP  N  +D + Q  F+D+ +  G  + +F
Sbjct: 227 KD----PLSKQSKALHHLGDQARYKLDLTGTPVSNSPLDYFSQYRFMDR-EIFGDSWYAF 281

Query: 190 VARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDC-----CLSLDIADYQNIDKPILIT 244
              +    Q  +H      T K  +Q      L D       ++  +   Q +D P  + 
Sbjct: 282 RGNYAFMGQGTNHA-----TGKTYSQVIGYRNLGDLVTKAHSIAYRVTKEQALDLPDQLD 336

Query: 245 KKV--PLPQPVMKQYHKFQRELYCDLQGENIEAFNSA---SKTVKCLQLANGAVYYDEEK 299
           + +      P  + Y    ++   +L  +N+ A  +    ++ ++  Q+  G V  D E 
Sbjct: 337 ETLYCHFEAPAARAYRDLVKDSIAEL--DNLPAVTAQHVITQLLRLSQICGGFVKLDTEG 394

Query: 300 HWKE--------VHDEKIKALEVIIE---KANAAPIIVAYHFNSDLARLQKAFPQG---- 344
           +  +        +   KIK  E ++          ++V   F +++  L++   +     
Sbjct: 395 YENDPNAGKLIPISKAKIKLFEELLGDLLSVEGKKVVVFARFTAEIKLLREVLEKQLGAD 454

Query: 345 --RTLDKD-PCTIQ-EWNEG-----KIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLE 395
             R +D   P  ++ E+ E       I +  A   + G G+ L    +  V++S  +   
Sbjct: 455 GYRMIDGSVPKDVRGEYVEDFQKNPAIRVFLAQIQTAGLGITLT-AADTTVYYSTDYSYA 513

Query: 396 EHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKK 453
            ++Q        R  + G K      +L+ ++T+DE +L+ L  K +I DL ++  +K
Sbjct: 514 AYEQ-----SRARTHRIGQKNNCTYIHLVVKDTVDEKILEALSQKKSIADLCVDNYQK 566


>gi|311070141|ref|YP_003975064.1| putative ATP-binding SNF2 helicase or protein kinase [Bacillus
           atrophaeus 1942]
 gi|310870658|gb|ADP34133.1| putative ATP-binding SNF2 helicase or protein kinase [Bacillus
           atrophaeus 1942]
          Length = 924

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 117/495 (23%), Positives = 206/495 (41%), Gaps = 92/495 (18%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKSV--LVIAPLR 56
           L P+QT  ++W+L  +     A     MG GKT+ ++    +I   G +    L+IAP  
Sbjct: 450 LRPYQTYGMNWLLFLRESGFGACLADDMGLGKTIQMIAYFIHIKESGHQKTPSLIIAPTS 509

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT---PAVLYVINFENLGWLVQELK 113
           V  + W  E+Q ++    +++++  G  +++ +        A + + ++        EL 
Sbjct: 510 VLGN-WQRELQTFA--PQLSVALHYGPRRKKGEGFAEYYKDADVVLTSYGLSHTDADELS 566

Query: 114 G-TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQ 172
             TW  +TI +DE+  +K+   +Q    +RA+ K   +    I L+GTP  N L +LW  
Sbjct: 567 SVTW--STICLDEAQNIKNAHTKQ----SRAIRK--LKGHHHIALSGTPMENRLTELWSI 618

Query: 173 IWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIA 232
             F++KG  LG +              G H   V    K+  +K IE QL          
Sbjct: 619 FDFMNKG-YLGSL-------------TGFHKRYVLPIEKDRDEKRIE-QL---------- 653

Query: 233 DYQNIDKPILITK-----KVPLPQPVMKQYHKF------QRELYCDLQGENIEAFNSASK 281
             Q + +P L+ +     +V L  P   +  +F      Q  LY  L  +  E  +S + 
Sbjct: 654 --QQLIRPFLLRRTKRDEEVALNLPDKLEQKEFIPLSAEQASLYEQLVKDTFEHMSSLTG 711

Query: 282 TV-KCLQLA----------NGAVYYDEEK----HWKEVHDEKIKALEVIIEKANAAPIIV 326
              K L L+          + A+Y  E++      + V  EK+  L   I   N + +I 
Sbjct: 712 MQRKALILSMLGRLKQICDHPALYLKEDQTELLAGRSVKLEKLLELMTAIRDQNESCLIF 771

Query: 327 AYHF---NSDLARLQKAFPQGRTL--------DKDPCTIQEWNEGKIPLLFAHPASCGHG 375
             +    N     L+K F +            D+D   ++++ + + P L     + G G
Sbjct: 772 TQYIQMGNMMKKLLEKTFGEPVQFLNGSLSKQDRDSL-VEKFQKKEYPTLILSLKAGGTG 830

Query: 376 LNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQ 435
           LNL    N ++ +  WW+       +E     R  + G +R V V+ +I   TI+E +  
Sbjct: 831 LNLTA-ANHVIHYDRWWN-----PAVENQATDRAYRIGQERFVHVHKMITTGTIEEKIDM 884

Query: 436 RLRTKSTIQDLLLNA 450
            L TK T+ D ++ +
Sbjct: 885 MLETKQTLNDQIIQS 899


>gi|323340857|ref|ZP_08081108.1| SWF/SNF family helicase [Lactobacillus ruminis ATCC 25644]
 gi|323091708|gb|EFZ34329.1| SWF/SNF family helicase [Lactobacillus ruminis ATCC 25644]
          Length = 975

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 101/448 (22%), Positives = 180/448 (40%), Gaps = 51/448 (11%)

Query: 26  MGSGKTVSVLTAL-----SYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVI 80
           MG GKT+  +T L       I        L++ P  +  + W +E + ++    +   VI
Sbjct: 539 MGLGKTLQTITLLLAAKDDKISQVSSGQALIVTPAALLYN-WQNEFENFA--PTLKTLVI 595

Query: 81  TGTVKQRTKVLKTPAVLYVINFENLGWLVQELKG--TWPFATIVVDESTKLKSFRLRQGS 138
            GT KQR  +L   A  Y I       L ++ +      F   ++DE+  +K+    Q S
Sbjct: 596 NGTKKQRHDLLADVAD-YDIVLTTYDQLKRDFEDYLELEFEYEIIDEAQNIKN-STTQAS 653

Query: 139 KTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQ 198
           K  +A+        RF  LTGTP  N L +LW    ++  G      +  F  ++     
Sbjct: 654 KAVKAIDAKT----RFA-LTGTPIENRLSELWSIFDYVMPGYLFS--YNEFREQFERPIM 706

Query: 199 IGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYH 258
           I    G  +   K      +  + S     L     + I++P        + +     Y 
Sbjct: 707 IDEEKGMQKALIKMIVPFVLRRKKSQVLKDLP----EKIERPYY----AEMSKKQAGLYQ 758

Query: 259 KFQRELYCDLQGENIEAFNSA-----SKTVKCLQLA-NGAVYYDEEKHWKEVHDEKIKAL 312
               EL  +L  ++ + F  +     +K  K  Q+  + ++ Y +        D  ++ +
Sbjct: 759 AMVNELRTELSQKSADEFKQSKIEILAKLTKIRQICCDPSLVYSDYDGESGKTDNCMELI 818

Query: 313 EVIIEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPC-TIQEWNEGKI 362
           E  +  +    IIV   F S L+ L+K   Q         G T  ++    ++E+N+  +
Sbjct: 819 ESAL--SGGHRIIVFSQFVSMLSILEKKLKQRKIEFYKIVGETPKEERFKMVEEFNQNDV 876

Query: 363 PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
           P+      + G GLNL  G ++++ +  WW+     Q        R  + G  + V VY 
Sbjct: 877 PIFLISLKAGGTGLNL-VGADVIIHYDPWWNEAAQNQ-----ATDRAHRIGQTKNVLVYK 930

Query: 423 LIAQNTIDELVLQRLRTKSTIQDLLLNA 450
           LI ++TI+E +L+    KS + D +L+ 
Sbjct: 931 LIVKDTIEEKILKMQEQKSKLADDILSG 958


>gi|171915261|ref|ZP_02930731.1| helicase, Snf2 family protein [Verrucomicrobium spinosum DSM 4136]
          Length = 914

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 105/476 (22%), Positives = 197/476 (41%), Gaps = 69/476 (14%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSV 61
           L P+Q   + +     R  +   MG GKT+  +    ++    + + VLV+ P  + +S 
Sbjct: 336 LLPYQLDGIAFAAGKGRAVLADEMGLGKTIQGVGVAEFLARHADVRRVLVVCPASL-KSQ 394

Query: 62  WTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENL--GWLVQELKGTWPFA 119
           W  E++R   F   ++ +++G   +R  +    A   + N+E +   +L  E + +W   
Sbjct: 395 WKLEIER---FCGRSVQIVSGKTSERNALYSGDAFFTLCNYEQVLRDYLDIE-RTSWDL- 449

Query: 120 TIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKG 179
            I++DE+ ++K++     +KT+R +      S   + LTGTP  N L DL+  + F+D  
Sbjct: 450 -IILDEAQRIKNWE----AKTSRIIK--GLRSPFALVLTGTPLENRLDDLFSVVEFVDD- 501

Query: 180 KRLGRVFQSFVARWFNTTQIGSHIGAVR-YTAKETAQKEIEAQL---SDCCLSLDIADYQ 235
           +RLG  +     R+F++ ++ +  G V  Y   +  ++++E  L   +   ++LD+    
Sbjct: 502 RRLGPAY-----RFFHSHRVATETGRVSGYKNLDALRQQLEPVLLRRTRASIALDL---- 552

Query: 236 NIDKPILITKKVPLPQ-PVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQL----AN 290
               P   T+ V +P     +Q H         +  +   +     +  K L +    AN
Sbjct: 553 ----PPRTTEIVRIPATEEQQQLHNSHMVTVNAITSKKFLSEMDLLRLQKALLMARMSAN 608

Query: 291 GAVYYDEEKHWKEVHDEKIKALEVIIEKANAAP---II--------------VAYHFNSD 333
                D++         K+  L  ++E  +A P   II              +      D
Sbjct: 609 STYLVDKQSPG---FSSKLDRLAELLEALSAEPERKIILFTEWTTMLNLIEPILERLKMD 665

Query: 334 LARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWD 393
             RL     Q     K    + E+       +F    +   GLNLQ   + ++   L W+
Sbjct: 666 FVRLDGQVAQ----KKRQALVSEFQGNPKCRVFLTTNAGSTGLNLQ-AADTVINVDLPWN 720

Query: 394 LEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN 449
               +Q I      R  + G KR V V+ L+ + TI+E +L  L  K  +   +L+
Sbjct: 721 PALLEQRI-----ARAHRMGQKRKVQVHLLVTEGTIEENLLATLGAKHELASAVLD 771


>gi|331003253|ref|ZP_08326760.1| hypothetical protein HMPREF0491_01622 [Lachnospiraceae oral taxon 107
            str. F0167]
 gi|330412906|gb|EGG92286.1| hypothetical protein HMPREF0491_01622 [Lachnospiraceae oral taxon 107
            str. F0167]
          Length = 1137

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 94/452 (20%), Positives = 190/452 (42%), Gaps = 63/452 (13%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE-KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
             MG GKT+ +++ L      G  +  +++ P  +  + W+ E+ ++   + + +SV+   
Sbjct: 702  DMGLGKTLQIISFLMDAKKCGRLRKAIIVCPASLVYN-WSEEISKFDTENILTVSVLAAG 760

Query: 84   VKQRTKVLK--TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTA 141
             ++R K+L+      +Y+ +++ L   +  L     F+  ++DE+  +K+    Q +  A
Sbjct: 761  KEERQKILEEHDGVDIYISSYDTLRRDIS-LYHDIKFSHQIIDEAQFIKN----QNTGVA 815

Query: 142  RALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGS 201
            +A+   A +++    LTGTP  N L +LW    ++  G      + SF +++ N+     
Sbjct: 816  KAV--KALKADVKFALTGTPIENRLSELWSIFDYIMPG--FLYSYNSFRSKYENSIVKDG 871

Query: 202  HIGAVRYTAKETA-------QKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLP--QP 252
               + +  +K  +       + E+   L D    +  + +   DK   +   + L   + 
Sbjct: 872  DENSAKLLSKMISPFVLRRLKSEVAMDLPDKIEEIRTSRF---DKEQQLVYDIELSRLKE 928

Query: 253  VM---KQYHKFQ----------RELYCD--LQGENIEAFNSASKTVKCLQLANGAVYYDE 297
            V+   K+Y+  +          R++ CD  L  EN      A+K   C+ L    +    
Sbjct: 929  VLEGDKEYNSSKMIILSEITKLRQICCDPGLIFENYSG--GAAKLETCVDLVKSGI---- 982

Query: 298  EKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEW 357
            E   K +   +  ++  IIEK      I +Y      ++           +K    + ++
Sbjct: 983  EAGHKILLFSQFTSMLDIIEKRFKEENISSYMITGSTSK-----------EKRIQLVNDF 1031

Query: 358  NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
            N     +      + G GLNL  G +I++ +  WW+     Q        R  + G K  
Sbjct: 1032 NNDDTNVFLISLKAGGTGLNL-VGADIVIHYDPWWNFAAQNQ-----ATDRAHRIGQKNN 1085

Query: 418  VFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN 449
            V VY LI + TI+E +++   +K  + D +LN
Sbjct: 1086 VTVYRLITKGTIEERIVKLQESKKDLADRVLN 1117


>gi|229105848|ref|ZP_04236475.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock3-28]
 gi|228677569|gb|EEL31819.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock3-28]
          Length = 855

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 101/492 (20%), Positives = 199/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L Y+     K+   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRKLGFGALLADDMGLGKSIQTISYLLYVKENKLKTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGDSFKDFLQSADVVLTSYALAQLDEEELT 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+    +       ++   +  +   +     D  ++L++ D 
Sbjct: 559 FINHG-YLGSLGQ-FQRRFVTPIEKDRDERKIQQVQRFISPFLLRRTKKDQTVALNLPDK 616

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q                         +++ YC L GE              N+E  +   
Sbjct: 617 Q-------------------------EQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIVERSMKTKTVMELIENIKDQNESCLIFTQ 711

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    K+    I+++  G   +      + G GLNL
Sbjct: 712 YISMGNMLKSILEETFGQRVLFLNGSVPKKERDKMIEQFQNGTYDIFILSLKAGGTGLNL 771

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 772 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 825

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 826 RKQSLNNAVITS 837


>gi|78186764|ref|YP_374807.1| DEAD/DEAH box helicase-like [Chlorobium luteolum DSM 273]
 gi|78166666|gb|ABB23764.1| DEAD/DEAH box helicase-like protein [Chlorobium luteolum DSM 273]
          Length = 1006

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 109/455 (23%), Positives = 183/455 (40%), Gaps = 65/455 (14%)

Query: 26  MGSGKTVSVLTALSYIHLWGEK-SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
           MG GKTV  L  L      GEK  VL+I P  V  + W  E  +++    + + V  G  
Sbjct: 559 MGLGKTVQTLALLQEERNRGEKRPVLLICPTSVINN-WRKEAAQFT--PDLPVLVHHGAD 615

Query: 85  KQRTKVLKTPAVLYVINFENLGWLVQELK--GTWPFATIVVDESTKLKSFRLRQGSKTAR 142
           + +   LK  +    +   + G L +++    +  +A +++DE+  +K+   +Q +K AR
Sbjct: 616 RLKAAHLKKASNASALVISSYGLLFRDIAVLSSMHWAGVILDEAQNIKNPETKQ-AKAAR 674

Query: 143 ALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSH 202
           +L      S+  I LTGTP  N + DLW  + FL+ G    + F  F  R+FN  Q+   
Sbjct: 675 SL-----RSDYRIALTGTPVENHVGDLWALMDFLNPGFLGTQAF--FKDRFFNPIQLYQD 727

Query: 203 IGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQR 262
            GA       TA   +    +D  +  D+ D                    MKQY    R
Sbjct: 728 SGASDRLKAMTAPFILRRLKTDRTIITDLPDKIE-----------------MKQYCTLTR 770

Query: 263 E---LY---CDLQGENIEAFNSASKT-------VKCLQLANGAVYYDEEKHWKEVHDEKI 309
           E   LY    D   E IE+     +        VK  Q+ N  V +  +         K+
Sbjct: 771 EQASLYKAVVDELQEKIESSEGIERRGMVLALLVKLKQVCNHPVQFLGDNSSVADRSGKL 830

Query: 310 -KALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGR------------TLDKDPCTIQE 356
            + LE++ E   ++   + +    ++  L +A  Q R            +  K    I+ 
Sbjct: 831 QRLLELLAEIRESSERTLVFTQFREMGSLLQAHLQERLGEEVFFLHGSLSRKKRDEMIEA 890

Query: 357 WNEG-KIPLLFAHP-ASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGF 414
           +  G   P +F     + G GLNL    ++ + +  WW+       +E     R  + G 
Sbjct: 891 FQNGDDAPRIFILSLKAGGSGLNLTKASHV-IHYDRWWN-----PAVENQATDRAFRIGQ 944

Query: 415 KRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN 449
           K  V V+  I   T++E + + +  K+T+   +L 
Sbjct: 945 KHNVEVHKFITAGTLEERIDEMIEKKTTVSGTVLG 979


>gi|218282742|ref|ZP_03488939.1| hypothetical protein EUBIFOR_01525 [Eubacterium biforme DSM 3989]
 gi|218216387|gb|EEC89925.1| hypothetical protein EUBIFOR_01525 [Eubacterium biforme DSM 3989]
          Length = 1054

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 86/181 (47%), Gaps = 15/181 (8%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           L  +Q + + W+ D K   +       MG GKT+ VL      ++  +K  L++ P  + 
Sbjct: 598 LRTYQQQGIQWLYDLKNMGLNGILADDMGLGKTLQVLVFYKQ-YVSKDKPSLIVCPSSLM 656

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
            + W SE++++     +N   +TG  + R  ++K    LY+  ++ L   V EL     F
Sbjct: 657 YN-WMSEIEKFK--IDVNAVCVTGMQEARKDIIKENYELYITTYDYLRRDV-ELYAPMEF 712

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             I++DE+  +K+       KT  A +  + +S   + LTGTP  NGL +LW    FL  
Sbjct: 713 EYIILDEAQFIKN------PKTKNAQSVKSLKSRHRLALTGTPIENGLSELWSIFDFLLP 766

Query: 179 G 179
           G
Sbjct: 767 G 767



 Score = 37.0 bits (84), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 6/76 (7%)

Query: 373  GHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDEL 432
            G GLNL      ++ F  WW++    Q        R  + G  + V VY L+ +NTI+E 
Sbjct: 963  GTGLNLT-KAQAVIHFDPWWNVSAQNQ-----ATDRAYRIGQTKNVLVYQLLMKNTIEEK 1016

Query: 433  VLQRLRTKSTIQDLLL 448
            + +  + K  + DL +
Sbjct: 1017 IYEMQKRKKEMSDLFV 1032


>gi|229118736|ref|ZP_04248087.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock1-3]
 gi|228664704|gb|EEL20195.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock1-3]
          Length = 855

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L Y+     K+   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRQLGFGALLADDMGLGKSIQTISYLLYVKENKLKTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGDSFKDFLQSADVVLTSYALAQLDEEELT 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+            V    K+  +++I+               
Sbjct: 559 FINHG-YLGSLGQ-FQRRF------------VTPIEKDRDERKIQQ-------------V 591

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q    P L+ +        +    K +++ YC L GE              N+E  +   
Sbjct: 592 QRFISPFLLRRTKKDQTVALNLPDKQEQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIVERSMKTKTVMELIENIKDQNESCLIFTQ 711

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    K+    I+++  G   +      + G GLNL
Sbjct: 712 YISMGNMLKSILEETFGQRVLFLNGSVPKKERDKMIEQFQNGTYDIFILSLKAGGTGLNL 771

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 772 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 825

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 826 RKQSLNNAVITS 837


>gi|83286649|ref|XP_730253.1| hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
 gi|23489925|gb|EAA21818.1| SNF2 family N-terminal domain, putative [Plasmodium yoelii yoelii]
          Length = 1350

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 106/496 (21%), Positives = 212/496 (42%), Gaps = 92/496 (18%)

Query: 3   LAPHQTKIVDWILD---HKRCAIWAS-MGSGKTVSVLTALSYIHLWG--EKSVLVIAPLR 56
           + P+Q + ++W+     HK   I A  MG GKT+  ++ L Y+      ++  ++I P R
Sbjct: 244 MKPYQIEGLNWLYQLYRHKINGILADEMGLGKTLQTISLLCYLRFNKNIKRKNIIICP-R 302

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVL---YVINFENLGWLVQELK 113
                W  E+++W   S M      G+ +QR ++ KT  VL   Y +       ++++  
Sbjct: 303 STLDNWYEEIKKWC--SEMKPFKYYGSKEQRKELNKT--VLHSDYDVLLTTYEIVIKDKS 358

Query: 114 GTWPFA--TIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWG 171
             +      +V+DE+ ++K+       K+  + +    +SE  + +TGTP  N L +LW 
Sbjct: 359 ALYDIDWFFLVIDEAHRIKN------DKSVLSSSVRFLKSENRLLITGTPLHNNLKELWS 412

Query: 172 QIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
            + FL     + ++F        N+ +  +     + +  +  Q EI  QL         
Sbjct: 413 LLNFL-----MPKIFD-------NSEEFDNLFNISKISTNDNKQSEIITQL--------- 451

Query: 232 ADYQNIDKPILITK-KVPLPQ--PVMKQYH------KFQRELYCDLQGENIEAFNSASKT 282
                I KP ++ + KV + Q  P  ++ +      K Q++LY D+  +NI+  N+ + +
Sbjct: 452 ---HTILKPFMLRRLKVEVEQSLPPKREIYIFVGMSKLQKKLYSDILSKNIDVINAMTGS 508

Query: 283 --------VKCLQLANGAVYYD--------EEKHWKEVHDEKIKALEVI---IEKANAAP 323
                   ++  +  N    +D        E  H  E    K+  L+ +   ++K N+  
Sbjct: 509 KNQMLNILMQLRKCCNHPYLFDGIEEPPYIEGNHLIETSG-KMSLLDKLLPRLKKENSRV 567

Query: 324 IIVA-----YHFNSDLARLQK---AFPQGRTL-DKDPCTIQEWNE--GKIPLLFAHPASC 372
           ++ +          D  R +K       G T+ D+    I ++NE   K  +      + 
Sbjct: 568 LLFSQMTRLLDIIDDYCRWKKYEYLRIDGSTVGDERQIRINKFNEPNSKYFIFLLSTRAG 627

Query: 373 GHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDEL 432
           G G+NL     +++F S      ++   ++   + R  + G K+ V VY  + QN+++E 
Sbjct: 628 GIGINLTTADIVILFDS------DYNPQMDIQAMDRAHRIGQKKRVIVYRFVTQNSVEEK 681

Query: 433 VLQRLRTKSTIQDLLL 448
           +++R   K  +  L++
Sbjct: 682 IVERAAKKLKLDSLII 697


>gi|16800753|ref|NP_471021.1| hypothetical protein lin1685 [Listeria innocua Clip11262]
 gi|16414172|emb|CAC96916.1| lin1685 [Listeria innocua Clip11262]
          Length = 1072

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 98/464 (21%), Positives = 189/464 (40%), Gaps = 101/464 (21%)

Query: 25   SMGSGKTVSVLTALS--YIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG 82
             MG GKTV  ++ L+         K VL++ P  +  + W SE+++++    + ++V+ G
Sbjct: 642  DMGLGKTVQTISFLASELEENPNLKPVLIVTPASLLYN-WQSELEKFA--PEIPVTVLHG 698

Query: 83   TVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKT 140
            T + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+ 
Sbjct: 699  TKQARMAEMEEIKHGHVYLISYPSLRQDIIHFADV-AFSSVIIDESQAIKNYHTK-ASQA 756

Query: 141  ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIG 200
             RAL +          L+GTP  N + +LW              +FQ+ +  +F + +  
Sbjct: 757  VRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRKF 798

Query: 201  SHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQY 257
              I                              Y+NI K   P L+ +   L Q V+K+ 
Sbjct: 799  KEIP-----------------------------YENIAKMIRPFLLRR---LKQDVVKEL 826

Query: 258  -HKFQRELYCDLQGENIEAFNSASKTVKC-LQLANG-----------------AVYYDEE 298
              K +  LY +L  E    + +  + ++  L+ +NG                  +  D  
Sbjct: 827  PDKIETNLYSELTDEQKTIYLAYLEKIQADLEESNGNASEERIKLLAGLTRLRQICCDPS 886

Query: 299  KHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARLQKAFPQ-GRTL----DK 349
               +    E  K L++       + N   I++   F   LA +++   + G+ L     K
Sbjct: 887  LFVENYQGESGKLLQLFDTIQTARENGKRILIFSQFTGMLAIIRRKLEEDGQPLFYMDGK 946

Query: 350  DPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERI 404
             P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E  
Sbjct: 947  TPAKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEEQ 1000

Query: 405  GVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
               R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1001 ATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|293379105|ref|ZP_06625256.1| SNF2 family N-terminal domain protein [Enterococcus faecium PC4.1]
 gi|292642246|gb|EFF60405.1| SNF2 family N-terminal domain protein [Enterococcus faecium PC4.1]
          Length = 705

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 95/426 (22%), Positives = 184/426 (43%), Gaps = 63/426 (14%)

Query: 26  MGSGKTVSVLT-ALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
           MG GKT+  +   LS        S L++AP  +  + W +EV++++    ++I VI G  
Sbjct: 280 MGLGKTLQTIAFLLSEKEERESFSALIVAPASLIYN-WQAEVKKFA--PSLSIQVINGNK 336

Query: 85  KQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARAL 144
           K+R ++L     + V ++ +L   + + + +     +++DE+  +K+      +KTA+AL
Sbjct: 337 KEREELLAKDTDIRVTSYASLRQDLADYQ-SQKIDYLILDEAQMVKN----SSTKTAQAL 391

Query: 145 AKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIG 204
            + A   +RF  L+GTP  N L +LW              +F + +  +F T        
Sbjct: 392 RELAV-PQRFA-LSGTPIENNLEELWS-------------LFATIMPGFFPT-------- 428

Query: 205 AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ----YHKF 260
             +   +E A +EI   +    L     D Q + K +    ++ L   + ++    Y  +
Sbjct: 429 --KTKFRELAAEEIAQMIRPFILR---RDKQTVLKDLPEKTEMNLYSALTEEQKTVYLAY 483

Query: 261 QRELYCDLQGENIEAFNSA-----SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI 315
            R++  ++   + EAF        +   +  Q+      + E+        E++K L ++
Sbjct: 484 LRQMREEISSMDSEAFKKNRIGILAGLTRLRQICCDPRLFIEDYQGGSGKLEQVKDL-LV 542

Query: 316 IEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQEWNEGKIPLL 365
             K N   +++   F   L  LQ+   +         G T  +D  + +  +N G+  + 
Sbjct: 543 AAKENKRRVLLFSQFTGMLTILQEELAELGISTFYLRGSTKPQDRLSMVDAFNAGEKDVF 602

Query: 366 FAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIA 425
                + G GLNL  G + ++ + LWW+       IE     R  + G K  V V+ +I+
Sbjct: 603 LISLKAGGTGLNLT-GADTVILYDLWWN-----PAIEEQAAGRAHRIGQKNVVEVWRMIS 656

Query: 426 QNTIDE 431
           + TI+E
Sbjct: 657 EGTIEE 662


>gi|229076456|ref|ZP_04209418.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock4-18]
 gi|228706642|gb|EEL58853.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock4-18]
          Length = 855

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L Y+     K+   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRQLGFGALLADDMGLGKSIQTISYLLYVKENKLKTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGDSFKDFLQSADVVLTSYALAQLDEEELT 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+            V    K+  +++I+               
Sbjct: 559 FINHG-YLGSLGQ-FQRRF------------VTPIEKDRDERKIQQ-------------V 591

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q    P L+ +        +    K +++ YC L GE              N+E  +   
Sbjct: 592 QRFISPFLLRRTKKDQTVALNLPDKQEQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIVERSMKTKTVMELIENIKDQNESCLIFTQ 711

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    K+    I+++  G   +      + G GLNL
Sbjct: 712 YISMGNMLKSILEETFGQRVLFLNGSVPKKERDKMIEQFQNGTYDIFILSLKAGGTGLNL 771

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 772 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 825

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 826 RKQSLNNAVITS 837


>gi|282862053|ref|ZP_06271116.1| SNF2-related protein [Streptomyces sp. ACTE]
 gi|282563078|gb|EFB68617.1| SNF2-related protein [Streptomyces sp. ACTE]
          Length = 979

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 100/449 (22%), Positives = 188/449 (41%), Gaps = 56/449 (12%)

Query: 26  MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVK 85
           MG GKT++V+    ++H       LV+ P  +  + W  E+ R++    + +S   GT +
Sbjct: 540 MGLGKTITVIAL--HLHRAHPAPTLVVCPASLLGN-WHREINRFA--PGVPVSRFHGTDR 594

Query: 86  QRTKVLKTPAVLYVINFENLGWLVQELKG-TWPFATIVVDESTKLKSFRLRQGSKTARAL 144
             +          +  +  +    + L G TW    +V DE+  +K+      S TARAL
Sbjct: 595 DLSGAGPG---FVLTTYGTMRSSAERLAGHTW--GLVVADEAQHVKNPH----SSTARAL 645

Query: 145 AKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLG--RVFQSFVARWFNTTQIGSH 202
                 +   + LTGTP  N L +LW  + +   G  LG  + F++  AR    T   + 
Sbjct: 646 RT--IPAPARVALTGTPVENNLSELWALLDWTTPGL-LGPLKAFRARHARIVENTGTAAG 702

Query: 203 IG---AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHK 259
           +G   AV   ++      +  + SD  ++ ++      D P+ +T++    Q  +  Y  
Sbjct: 703 LGNDEAVERLSRLVRPFLLRRKKSDPGIAPELPPKTETDHPVFLTRE----QATL--YEA 756

Query: 260 FQRELYCDLQGENIEAFNSASKTVKCL----QLAN-GAVYYDEEKHWKEVHDEKIKALEV 314
             RE    +  E+ E        +K L    Q+ N  A Y  EE         K+  L+ 
Sbjct: 757 AVRETMTFI--ESAEGIARRGLIMKLLGSLKQICNHPAQYLKEEPTRLAGRSGKLALLDE 814

Query: 315 IIEK--ANAAPIIVAYHFNSDLARL------QKAFPQ-----GRTLDKDPCTIQEWNEGK 361
           +++   A    +++   + S +ARL       +A P      G  + +    +  +   +
Sbjct: 815 LLDTILAEDGSVLIFTQYVS-MARLLSAHLASRAIPSQLLHGGTPVAERERMVDRFQSAE 873

Query: 362 IPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVY 421
           +P+      + G GLNL    ++ + +  WW+       +E     R  + G  + V V+
Sbjct: 874 VPVFLLSLKAAGTGLNLTRAAHV-IHYDRWWN-----PAVEEQATDRAYRIGQTQPVQVH 927

Query: 422 YLIAQNTIDELVLQRLRTKSTIQDLLLNA 450
            LIA+ T+++ + + LR+K  + D +L +
Sbjct: 928 RLIAEGTVEDRISELLRSKRALADAVLGS 956


>gi|254824296|ref|ZP_05229297.1| helicase [Listeria monocytogenes FSL J1-194]
 gi|255520940|ref|ZP_05388177.1| hypothetical protein LmonocFSL_06916 [Listeria monocytogenes FSL
            J1-175]
 gi|293593530|gb|EFG01291.1| helicase [Listeria monocytogenes FSL J1-194]
          Length = 1072

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 103/465 (22%), Positives = 187/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRMAEMEEMKRGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNAGEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK   +G+ L     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEEGQPLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|227552615|ref|ZP_03982664.1| Snf2 family helicase [Enterococcus faecium TX1330]
 gi|227178241|gb|EEI59213.1| Snf2 family helicase [Enterococcus faecium TX1330]
          Length = 1064

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 95/426 (22%), Positives = 184/426 (43%), Gaps = 63/426 (14%)

Query: 26   MGSGKTVSVLT-ALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
            MG GKT+  +   LS        S L++AP  +  + W +EV++++    ++I VI G  
Sbjct: 639  MGLGKTLQTIAFLLSEKEERESFSALIVAPASLIYN-WQAEVKKFA--PSLSIQVINGNK 695

Query: 85   KQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARAL 144
            K+R ++L     + V ++ +L   + + + +     +++DE+  +K+      +KTA+AL
Sbjct: 696  KEREELLAKDTDIRVTSYASLRQDLADYQ-SQKIDYLILDEAQMVKN----SSTKTAQAL 750

Query: 145  AKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIG 204
             + A   +RF  L+GTP  N L +LW              +F + +  +F T        
Sbjct: 751  RELAV-PQRFA-LSGTPIENNLEELWS-------------LFATIMPGFFPT-------- 787

Query: 205  AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ----YHKF 260
              +   +E A +EI   +    L     D Q + K +    ++ L   + ++    Y  +
Sbjct: 788  --KTKFRELAAEEIAQMIRPFILR---RDKQTVLKDLPEKTEMNLYSALTEEQKTVYLAY 842

Query: 261  QRELYCDLQGENIEAFNSA-----SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI 315
             R++  ++   + EAF        +   +  Q+      + E+        E++K L ++
Sbjct: 843  LRQMREEISSMDSEAFKKNRIGILAGLTRLRQICCDPRLFIEDYQGGSGKLEQVKDL-LV 901

Query: 316  IEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQEWNEGKIPLL 365
              K N   +++   F   L  LQ+   +         G T  +D  + +  +N G+  + 
Sbjct: 902  AAKENKRRVLLFSQFTGMLTILQEELAELGISTFYLRGSTKPQDRLSMVDAFNAGEKDVF 961

Query: 366  FAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIA 425
                 + G GLNL  G + ++ + LWW+       IE     R  + G K  V V+ +I+
Sbjct: 962  LISLKAGGTGLNLT-GADTVILYDLWWN-----PAIEEQAAGRAHRIGQKNVVEVWRMIS 1015

Query: 426  QNTIDE 431
            + TI+E
Sbjct: 1016 EGTIEE 1021


>gi|25144179|ref|NP_498468.2| yeast ISW (imitation SWI) homolog family member (isw-1)
           [Caenorhabditis elegans]
 gi|21264515|sp|P41877|ISW1_CAEEL RecName: Full=Chromatin-remodeling complex ATPase chain isw-1;
           AltName: Full=Nucleosome-remodeling factor subunit isw-1
 gi|16950408|gb|AAA50636.2| Yeast isw (imitation swi) homolog protein 1 [Caenorhabditis
           elegans]
          Length = 1009

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 113/494 (22%), Positives = 210/494 (42%), Gaps = 89/494 (18%)

Query: 3   LAPHQTKIVDWI--LDHKRC-AIWAS-MGSGKTVSVLTALSYIHLWGEKSV--LVIAPLR 56
           +  +Q + ++W+  L H +   I A  MG GKT+  ++ + Y+  +  K+   LVI P  
Sbjct: 132 MRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKASPHLVIVPKS 191

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT---PAVLYV--INFENLGWLVQE 111
             Q+ W +E ++W     +N  V+ G    R +VL+    P    V    +E +  +  +
Sbjct: 192 TLQN-WANEFKKWC--PSINAVVLIGDEAARNQVLRDVILPQKFDVCCTTYEMMLKVKTQ 248

Query: 112 LKG-TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLW 170
           LK   W +  I++DE+ ++K+ + +  S+T R L      SE  + +TGTP  N L +LW
Sbjct: 249 LKKLNWRY--IIIDEAHRIKNEKSKL-SETVREL-----NSENRLLITGTPLQNNLHELW 300

Query: 171 GQIWFLDKGKRLGRVFQSF--VARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLS 228
             + FL     L  +F S      WF+   +  +   V+   K      +    SD   S
Sbjct: 301 ALLNFL-----LPDIFTSSDDFDSWFSNDAMSGNTDLVQRLHKVLQPFLLRRIKSDVEKS 355

Query: 229 LDIADYQNIDKPILITKKVPLPQPVMKQY---HKFQRELYCDLQGENIEAFNSASKT--- 282
           L                   LP+  +K Y    K QRE Y  +  ++I+  N A K    
Sbjct: 356 L-------------------LPKKEVKVYVGLSKMQREWYTKVLMKDIDIINGAGKVEKA 396

Query: 283 ---------VKCLQ---LANGA---VYYDEEKHWKEVHDEKIKALEVIIE-KANAAPIIV 326
                     KC+    L +GA     +  ++H  +   + +   +++++ K   + +++
Sbjct: 397 RLMNILMHLRKCVNHPYLFDGAEPGPPFTTDQHLVDNSGKMVVLDKLLMKFKEQGSRVLI 456

Query: 327 AYHFNSDLARLQK---------AFPQGRTLDKDPCT-IQEWN--EGKIPLLFAHPASCGH 374
              F+  L  L+              G T  +D    I+ +N  + K  +      + G 
Sbjct: 457 FSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGL 516

Query: 375 GLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVL 434
           G+NL     ++++ S W    + Q M       R  + G K+ V V+ LI +NT+DE ++
Sbjct: 517 GINLATADVVIIYDSDWNPQSDLQAM------DRAHRIGQKKQVRVFRLITENTVDERII 570

Query: 435 QRLRTKSTIQDLLL 448
           ++   K  + ++++
Sbjct: 571 EKAEAKLRLDNIVI 584


>gi|300811728|ref|ZP_07092202.1| SNF2 family N-terminal domain protein [Lactobacillus delbrueckii
            subsp. bulgaricus PB2003/044-T3-4]
 gi|300497304|gb|EFK32352.1| SNF2 family N-terminal domain protein [Lactobacillus delbrueckii
            subsp. bulgaricus PB2003/044-T3-4]
          Length = 1185

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 106/486 (21%), Positives = 198/486 (40%), Gaps = 83/486 (17%)

Query: 3    LAPHQTKIVDW---ILDHKRCAIWAS-MGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
            L P+Q     W   +  H    I A  MG GKT+ V++ L+      ++  L++AP  + 
Sbjct: 727  LRPYQKTGTAWMNRLAQHGFGGILADEMGLGKTLQVISLLAS---QKDQPSLIVAPASLV 783

Query: 59   QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWP- 117
             + W +E ++++    M   V++G+ K+R+  L     + V+   +   L +++    P 
Sbjct: 784  LN-WEAEFKKFA--PEMKTLVLSGSKKERSGQLADLTDIDVV-ITSYDLLKRDITNYEPH 839

Query: 118  -FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFL 176
             FA  V+DE+  +K+ R      TA A A    +++    LTGTP  N L +LW    F+
Sbjct: 840  TFAYEVIDEAQMIKNPR------TAAAKAVSVVKAKHRFALTGTPIENRLSELWSIFNFV 893

Query: 177  DKG-------------------------KRLGRVFQSFVARWFNTT---QIGSHIGAVRY 208
              G                          RL ++   F+ R         +   +  VRY
Sbjct: 894  MPGFLKSYREFKKDFESPIVKEDDQDCLNRLSQMVGPFILRRLKKDVLKDLPDKLEEVRY 953

Query: 209  TAKETAQKEI-EAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCD 267
                  Q+++ +A+++     +   D + I +  +          ++    +  RE+ CD
Sbjct: 954  VGMGKEQRKLYDAEIARLKNKVMAEDDEGIKREQI---------EILAALTRI-REICCD 1003

Query: 268  LQGENIEAFNSAS-KTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIV 326
              G   E +   S K + C+ L   A+   +  H   +  +    L+++ E   A  I+ 
Sbjct: 1004 -PGLLYEDYKGESEKRLACVDLIKSAI---DGGHKVLLFSQFTSMLDLLEESLKAEEIV- 1058

Query: 327  AYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKIP--LLFAHPASCGHGLNLQYGGNI 384
                     R+    P+ + L      +  +N    P  +      + G GLNL  G + 
Sbjct: 1059 -------FLRIDGQTPKAKRL----TLVNVFNHKDSPAKVFLISLKAGGTGLNLT-GADT 1106

Query: 385  LVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQ 444
            ++ +  WW++    Q  +     R  + G ++ V VY LIA++T++E +L     KS + 
Sbjct: 1107 VIHYDPWWNVAAQNQATD-----RAHRIGQEKKVTVYKLIAKDTVEEAILDLQEAKSQLA 1161

Query: 445  DLLLNA 450
              +L A
Sbjct: 1162 QGILTA 1167


>gi|75764646|ref|ZP_00744080.1| SWF/SNF family helicase [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
 gi|74487868|gb|EAO51650.1| SWF/SNF family helicase [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
          Length = 340

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 85/358 (23%), Positives = 156/358 (43%), Gaps = 41/358 (11%)

Query: 94  PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESER 153
           P  + +IN++ + W   ELK    F TI++D+S+ +K+       K+ R+       +E 
Sbjct: 12  PESVLIINYDKV-WRRDELKKLKDF-TIMLDQSSMIKN------EKSNRSKFILGLNAEN 63

Query: 154 FIELTGTPSPNGLIDLWGQIWFL--DKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAK 211
            I L+GTP+     +LW Q+  L  +  K+L  + Q  V  W +  Q    +    Y   
Sbjct: 64  VILLSGTPTGGKYEELWSQLHLLGWNISKKLF-LKQFVVQEWDDKNQ---QMKITGYKNV 119

Query: 212 ETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE 271
           E  + +++   +    + ++ D  N       T ++P+  PV K Y++F++    ++  E
Sbjct: 120 ERLKAKLKKHGAVFMKTEEVFDLPN-------TNEIPVKIPVTKMYNEFKKHHIIEIGEE 172

Query: 272 NIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAPIIVAYHFN 331
            +     A+K +   QLA     Y+E          K++ ++ +IE  N   II+ Y+F 
Sbjct: 173 LLIGDTPAAKKLYLRQLAGS---YNE---------HKLQYIKDLIESTNDR-IIIFYNFK 219

Query: 332 SDLARLQKAFPQG-RTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSL 390
            +   L     +   T++ D   +  + +    +      +   GLNLQ   N +V+F+L
Sbjct: 220 KEYMALVDLIERPIATINGDIKDLSAYEKHDNSVTLIQYQAGAMGLNLQ-KANKIVYFTL 278

Query: 391 WWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
               E  +Q        R  + G KR  F YYL+   +I+  +L  L+ +    D L 
Sbjct: 279 TDKSELFEQ-----SKKRTLRIGQKRLGFYYYLLTDGSIEWRMLDVLKERRDYTDALF 331


>gi|229099671|ref|ZP_04230598.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock3-29]
 gi|228683741|gb|EEL37692.1| Helicase, SNF2/RAD54 [Bacillus cereus Rock3-29]
          Length = 855

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 200/492 (40%), Gaps = 86/492 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWA----SMGSGKTVSVLTALSYIHLWGEKS--VLVIAPLR 56
           L P+Q   ++W+L  ++    A     MG GK++  ++ L Y+     K+   L++AP  
Sbjct: 388 LRPYQQHGIEWLLYLRQLGFGALLADDMGLGKSIQTISYLLYVKENKLKTGPALIVAPTS 447

Query: 57  VAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKT--PAVLYVINFENLGWLVQELKG 114
           V  + W  E +R++   ++ + +  G+ + +    K    +   V+    L  L +E   
Sbjct: 448 VLGN-WQKEFERFA--PNLRVQLHYGSNRDKGDSFKDFLQSADVVLTSYALAQLDEEELT 504

Query: 115 TWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIW 174
           +  +  +++DE+  +K+   +Q SK  R L     ++   I LTGTP  N L +LW    
Sbjct: 505 SLCWDAVILDEAQNIKNPHTKQ-SKAVRNL-----QANHKIALTGTPMENRLAELWSIFD 558

Query: 175 FLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADY 234
           F++ G  LG + Q F  R+            V    K+  +++I+               
Sbjct: 559 FINHG-YLGSLGQ-FQRRF------------VTPIEKDRDERKIQQ-------------V 591

Query: 235 QNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGE--------------NIEAFNSAS 280
           Q    P L+ +        +    K +++ YC L GE              N+E  +   
Sbjct: 592 QRFISPFLLRRTKKDQTVALNLPDKQEQKAYCPLTGEQASLYEQLVQDTLQNVEGLSGIE 651

Query: 281 KT-------VKCLQLANGAVYYDEEKHWKEVHDEKIKA------LEVIIEKANAAPIIVA 327
           +         K  Q+ N    Y +E   K++ +  +K       +E I ++  +  I   
Sbjct: 652 RRGFILLMLNKLKQICNHPALYLKETEPKDIVERSMKTKTVMELIENIKDQNESCLIFTQ 711

Query: 328 YHFNSDLAR--LQKAFPQ------GRTLDKD-PCTIQEWNEGKIPLLFAHPASCGHGLNL 378
           Y    ++ +  L++ F Q      G    K+    I+++  G   +      + G GLNL
Sbjct: 712 YISMGNMLKSILEETFGQRVLFLNGSVPKKERDKMIEQFQNGTYDIFILSLKAGGTGLNL 771

Query: 379 QYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLR 438
               N ++ +  WW+       +E     R  + G KR V V+ LI   T++E + + L 
Sbjct: 772 T-AANHVIHYDRWWN-----PAVENQATDRAYRIGQKRFVHVHKLITTGTLEEKIDEMLE 825

Query: 439 TKSTIQDLLLNA 450
            K ++ + ++ +
Sbjct: 826 RKQSLNNAVITS 837


>gi|257896952|ref|ZP_05676605.1| Snf2 family protein [Enterococcus faecium Com12]
 gi|257833517|gb|EEV59938.1| Snf2 family protein [Enterococcus faecium Com12]
          Length = 1067

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 95/426 (22%), Positives = 184/426 (43%), Gaps = 63/426 (14%)

Query: 26   MGSGKTVSVLT-ALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
            MG GKT+  +   LS        S L++AP  +  + W +EV++++    ++I VI G  
Sbjct: 642  MGLGKTLQTIAFLLSEKEERESFSALIVAPASLIYN-WQAEVKKFA--PSLSIQVINGNK 698

Query: 85   KQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARAL 144
            K+R ++L     + V ++ +L   + + + +     +++DE+  +K+      +KTA+AL
Sbjct: 699  KEREELLAKDTDIRVTSYASLRQDLADYQ-SQKIDYLILDEAQMVKN----SSTKTAQAL 753

Query: 145  AKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIG 204
             + A   +RF  L+GTP  N L +LW              +F + +  +F T        
Sbjct: 754  RELAV-PQRFA-LSGTPIENNLEELWS-------------LFATIMPGFFPT-------- 790

Query: 205  AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ----YHKF 260
              +   +E A +EI   +    L     D Q + K +    ++ L   + ++    Y  +
Sbjct: 791  --KTKFRELAAEEIAQMIRPFILR---RDKQTVLKDLPEKTEMNLYSALTEEQKTVYLAY 845

Query: 261  QRELYCDLQGENIEAFNSA-----SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI 315
             R++  ++   + EAF        +   +  Q+      + E+        E++K L ++
Sbjct: 846  LRQMREEISSMDSEAFKKNRIGILAGLTRLRQICCDPRLFIEDYQGGSGKLEQVKDL-LV 904

Query: 316  IEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQEWNEGKIPLL 365
              K N   +++   F   L  LQ+   +         G T  +D  + +  +N G+  + 
Sbjct: 905  AAKENKRRVLLFSQFTGMLTILQEELAELGISTFYLRGSTKPQDRLSMVDAFNAGEKDVF 964

Query: 366  FAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIA 425
                 + G GLNL  G + ++ + LWW+       IE     R  + G K  V V+ +I+
Sbjct: 965  LISLKAGGTGLNLT-GADTVILYDLWWN-----PAIEEQAAGRAHRIGQKNVVEVWRMIS 1018

Query: 426  QNTIDE 431
            + TI+E
Sbjct: 1019 EGTIEE 1024


>gi|217964204|ref|YP_002349882.1| DNA/RNA helicase protein [Listeria monocytogenes HCC23]
 gi|217333474|gb|ACK39268.1| DNA/RNA helicase protein [Listeria monocytogenes HCC23]
 gi|307571229|emb|CAR84408.1| helicase, Snf2 family [Listeria monocytogenes L99]
          Length = 1072

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 103/465 (22%), Positives = 187/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRMAEMEEMKRGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNAGEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK   +G+ L     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEEGQPLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|254852266|ref|ZP_05241614.1| helicase [Listeria monocytogenes FSL R2-503]
 gi|300766136|ref|ZP_07076102.1| Snf2 family helicase [Listeria monocytogenes FSL N1-017]
 gi|258605574|gb|EEW18182.1| helicase [Listeria monocytogenes FSL R2-503]
 gi|300513159|gb|EFK40240.1| Snf2 family helicase [Listeria monocytogenes FSL N1-017]
          Length = 1072

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 103/465 (22%), Positives = 187/465 (40%), Gaps = 103/465 (22%)

Query: 25   SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
             MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 642  DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 697

Query: 82   GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
            GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 698  GTKQSRMAEMEEMKRGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 755

Query: 140  TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
              RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 756  AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 797

Query: 200  GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
               I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 798  FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 825

Query: 257  Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
               K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 826  LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNAGEERIKLLAGLTRLRQICCDP 885

Query: 298  EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
                +    E  K L++       + N   I++   F   L  + QK   +G+ L     
Sbjct: 886  SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEEGQPLFYMDG 945

Query: 349  KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
            K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 946  KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 999

Query: 404  IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
                R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 1000 QATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 1044


>gi|313608461|gb|EFR84385.1| SNF2 family helicase [Listeria monocytogenes FSL F2-208]
          Length = 966

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 103/465 (22%), Positives = 187/465 (40%), Gaps = 103/465 (22%)

Query: 25  SMGSGKTVSVLTALSYIHLWGE---KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVIT 81
            MG GKTV  ++ L+   L      K VL+I P  +  + W SE+++++    + ++V+ 
Sbjct: 536 DMGLGKTVQTISFLAS-ELEDNPNLKPVLIITPASLLYN-WQSELEKFA--PAIPVTVLH 591

Query: 82  GTVKQRTKVLKT--PAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSK 139
           GT + R   ++      +Y+I++ +L   +        F+++++DES  +K++  +  S+
Sbjct: 592 GTKQSRMAEMEEMKRGHVYLISYPSLRQDIVHFADV-AFSSVIIDESQAIKNYHTK-ASQ 649

Query: 140 TARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQI 199
             RAL +          L+GTP  N + +LW              +FQ+ +  +F + + 
Sbjct: 650 AVRALKR-----NHVFALSGTPLENSIDELWA-------------IFQTLMPGFFPSLRK 691

Query: 200 GSHIGAVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDK---PILITKKVPLPQPVMKQ 256
              I                              Y NI K   P L+ +   L Q V+K+
Sbjct: 692 FKEIP-----------------------------YDNIAKMIRPFLLRR---LKQDVVKE 719

Query: 257 Y-HKFQRELYCDLQGE--------------NIEAFNSASKTVKCLQLAN----GAVYYDE 297
              K +  LY +L  E              ++EA N  +   +   LA       +  D 
Sbjct: 720 LPDKIETNLYSELTDEQKTIYLAYLEKIQADLEASNGNAGEERIKLLAGLTRLRQICCDP 779

Query: 298 EKHWKEVHDEKIKALEVI----IEKANAAPIIVAYHFNSDLARL-QKAFPQGRTL----D 348
               +    E  K L++       + N   I++   F   L  + QK   +G+ L     
Sbjct: 780 SLFVENYQGESGKLLQLFDTIQTARENGKRILLFSQFTGMLGIIRQKLEEEGQPLFYMDG 839

Query: 349 KDPC-----TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIER 403
           K P       +  +NEG+  +      + G GLNL  G + ++ + LWW+       +E 
Sbjct: 840 KTPSKTRLDMVNAFNEGENDIFLISLKAGGTGLNL-VGADTVILYDLWWN-----PAVEE 893

Query: 404 IGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLL 448
               R  + G KR V V+ +I + TI+E +    + K  + D L+
Sbjct: 894 QATGRAHRIGQKRVVQVFRMITKGTIEERIFDLQKKKQALVDELI 938


>gi|257888157|ref|ZP_05667810.1| Snf2 family protein [Enterococcus faecium 1,141,733]
 gi|257824211|gb|EEV51143.1| Snf2 family protein [Enterococcus faecium 1,141,733]
          Length = 1067

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 95/426 (22%), Positives = 184/426 (43%), Gaps = 63/426 (14%)

Query: 26   MGSGKTVSVLT-ALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
            MG GKT+  +   LS        S L++AP  +  + W +EV++++    ++I VI G  
Sbjct: 642  MGLGKTLQTIAFLLSEKEERESFSALIVAPASLIYN-WQAEVKKFA--PSLSIQVINGNK 698

Query: 85   KQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARAL 144
            K+R ++L     + V ++ +L   + + + +     +++DE+  +K+      +KTA+AL
Sbjct: 699  KEREELLAKDTDIRVTSYASLRQDLADYQ-SQKIDYLILDEAQMVKN----SSTKTAQAL 753

Query: 145  AKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIG 204
             + A   +RF  L+GTP  N L +LW              +F + +  +F T        
Sbjct: 754  RELAV-PQRFA-LSGTPIENNLEELWS-------------LFATIMPGFFPT-------- 790

Query: 205  AVRYTAKETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQ----YHKF 260
              +   +E A +EI   +    L     D Q + K +    ++ L   + ++    Y  +
Sbjct: 791  --KTKFRELAAEEIAQMIRPFILR---RDKQTVLKDLPEKTEMNLYSALTEEQKTVYLAY 845

Query: 261  QRELYCDLQGENIEAFNSA-----SKTVKCLQLANGAVYYDEEKHWKEVHDEKIKALEVI 315
             R++  ++   + EAF        +   +  Q+      + E+        E++K L ++
Sbjct: 846  LRQMREEISSMDSEAFKKNRIGILAGLTRLRQICCDPRLFIEDYQGGSGKLEQVKDL-LV 904

Query: 316  IEKANAAPIIVAYHFNSDLARLQKAFPQ---------GRTLDKDPCT-IQEWNEGKIPLL 365
              K N   +++   F   L  LQ+   +         G T  +D  + +  +N G+  + 
Sbjct: 905  AAKENKRRVLLFSQFTGMLTILQEELAELGISTFYLRGSTKPQDRLSMVDAFNAGEKDVF 964

Query: 366  FAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIA 425
                 + G GLNL  G + ++ + LWW+       IE     R  + G K  V V+ +I+
Sbjct: 965  LISLKAGGTGLNLT-GADTVILYDLWWN-----PAIEEQAAGRAHRIGQKNVVEVWRMIS 1018

Query: 426  QNTIDE 431
            + TI+E
Sbjct: 1019 EGTIEE 1024


>gi|254444760|ref|ZP_05058236.1| SNF2 family N-terminal domain protein [Verrucomicrobiae bacterium
           DG1235]
 gi|198259068|gb|EDY83376.1| SNF2 family N-terminal domain protein [Verrucomicrobiae bacterium
           DG1235]
          Length = 831

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 112/476 (23%), Positives = 201/476 (42%), Gaps = 67/476 (14%)

Query: 3   LAPHQTKIVDW---ILDHK-RCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVA 58
           L P+Q + V+W   +L H   C +   MG GKTV V+  L   H  G+++ LV+ P  V 
Sbjct: 374 LRPYQRQGVEWMSRLLRHDCHCLLADEMGLGKTVQVIALLLSDHKPGQRT-LVVCPASVV 432

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQR-TKVLKTPAVLYVINFENLGWLVQELKGTWP 117
             VW SE      F+     +  G   ++  +  + P VL VI++  L   ++++     
Sbjct: 433 -PVWISE------FAKFAPGMTIGRYGRKLARGAEEPDVL-VISYALLRNRIEKI-ACEE 483

Query: 118 FATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLD 177
           F   V+DE+  +K+ +    SK +R+  +   +++R I LTGTP  N  +D+W    FL 
Sbjct: 484 FEYAVIDEAQFIKNPK----SKVSRSCRR--IKAKRRIALTGTPIENKPLDIWPAFQFLM 537

Query: 178 KGKRLG--RVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKE---IEAQLSDCCLSLDIA 232
            G  LG    F++  A         ++ GA  + A+  AQ +   +  +  +  L L   
Sbjct: 538 PG-LLGSQEQFENLFA---------ANPGA--FKARLRAQIKPFMLRRKKDEVALELPEK 585

Query: 233 DYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGA 292
              +++ PI   +     +   +   +F  +L   L+      F + S   +  Q++   
Sbjct: 586 MIVDLECPITPVQAREYKRICEEGLARFGDDLGSALRTNR---FATLSLLTRLRQVSCDP 642

Query: 293 VYYDEEKHWKEVHDEKIKALEVIIEK-----ANAAPIIVAYHFNSDLAR----LQKAFPQ 343
                   W E   E    L V++EK          +++   F   L R    ++++FP+
Sbjct: 643 NLLP----WMESSIEDSGKLMVLLEKLIEVLGTGHKVVIFSQFVRFLKRARIMVEESFPE 698

Query: 344 -------GRTLDKDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEE 396
                  G T D++    +  N  +   +     +   G+ L +  + +     WW+   
Sbjct: 699 LPIFELTGSTHDREAPVREFQNTDQTAAMLVSLKAASVGITL-HTADYVFLLDPWWNPAV 757

Query: 397 HQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
             Q I+R+      + G    VFVY L+AQ TI+E +    + K  + D ++N  K
Sbjct: 758 ESQAIDRV-----HRIGQTNNVFVYRLLAQGTIEEKIHHLQKEKRDLFDSIVNDSK 808


>gi|167757932|ref|ZP_02430059.1| hypothetical protein CLOSCI_00267 [Clostridium scindens ATCC 35704]
 gi|167664364|gb|EDS08494.1| hypothetical protein CLOSCI_00267 [Clostridium scindens ATCC 35704]
          Length = 470

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 113/481 (23%), Positives = 198/481 (41%), Gaps = 82/481 (17%)

Query: 3   LAPHQTKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEK----SVLVIAPLRVA 58
           L PHQ + V+ ++  K  A++   G+GKT+   TAL    +  EK    +V+ + P    
Sbjct: 7   LLPHQKEAVEKLIGIKVGALFMEQGTGKTI---TALEIARIRYEKKKIDAVIWLCPCSAK 63

Query: 59  QSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPF 118
           +++   E+ +      + I  I G     T +    A+ Y+I+       V E K  +  
Sbjct: 64  ENI-KREIVKQCPDEMLGIFTICGIETLSTSI---RAISYLIS-------VSERKRCF-- 110

Query: 119 ATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDK 178
             +V+DES  +K+ R  +     R   K  +   R I L GTP      DL+ Q + LD 
Sbjct: 111 --LVIDESLLVKNSRAYRTENIRRIAEKCPY---RMI-LNGTPISRNEADLYAQFYLLD- 163

Query: 179 GKRLG-RVFQSFVARW------------FNTTQIGSHIGAVRYTAKETAQKEIEAQLSDC 225
            + LG R + SF A               NT  +   IG   YT + T ++         
Sbjct: 164 WRILGYRSYWSFAANHLEYDEYGKLRNVLNTDYLAEKIGP--YTFQITKEQ--------- 212

Query: 226 CLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDL---QGENIEAFNSASKT 282
           C+ L    Y+        T    L +  +++Y +    L  ++   + E I    S  + 
Sbjct: 213 CMKLPKKHYE--------TSYFSLTEEQLQEYAEAAGRLMLEVDEWKPETIYRLFSGLQA 264

Query: 283 V---KCLQLANGAVYYDEEKHWKEVHDE-KIKALEVIIEKANAAPIIVAYHFNSDLARLQ 338
           +   K L       ++D  + + +  D  +IK L  I+ +      I+   + S++ ++ 
Sbjct: 265 IISGKRLIFNKSGSHFDAVEMFHDPMDNPRIKMLMNILAEEKT---IIFCRYESEIEQIC 321

Query: 339 KAFPQGRTLD------KDPCTIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWW 392
           +  P     D      K    ++ +  G    L A+    G  LNLQ+  NI ++ S  W
Sbjct: 322 RIIPGAVRFDGKVPQRKRDIALRRF-AGDSDYLIANRNCAGFSLNLQFCHNI-IYMSNDW 379

Query: 393 DLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALK 452
           DL +  Q  +R+      + G    V++  + A+NTIDE +L+ L  K  I + + + + 
Sbjct: 380 DLGKRMQSEDRV-----HRLGQGHDVYITDICAENTIDEQILKCLSRKENILECIKSDIG 434

Query: 453 K 453
           K
Sbjct: 435 K 435


>gi|156037672|ref|XP_001586563.1| hypothetical protein SS1G_12550 [Sclerotinia sclerotiorum 1980]
 gi|154697958|gb|EDN97696.1| hypothetical protein SS1G_12550 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 938

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 100/437 (22%), Positives = 182/437 (41%), Gaps = 52/437 (11%)

Query: 47  KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVL---KTPAVLYVINFE 103
           K  L++ P+ +  + W +E  +W     + + V  G+   R       K+ +V+ +I +E
Sbjct: 366 KKALIVCPVTLIAN-WKAEFNKWLGNERIGVFVADGSKNIRLTDFTHGKSYSVM-IIGYE 423

Query: 104 NLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSP 163
            L  + +ELK       +V DE  +LK+      +K+A+A+      +ER + L+GTP  
Sbjct: 424 KLRTVQEELKKGGGIDIVVADEGHRLKT----AANKSAQAIRN--LNTERRVILSGTPIQ 477

Query: 164 NGLIDLWGQIWFLDKGKRLG-RVFQS-FVARWFNTTQIGSHIGAVRYTAKETAQKEIEAQ 221
           N L + +  + F++ G   G   F+  F A    + Q G+    +    K TA++E  A 
Sbjct: 478 NDLSEFFTMVDFVNPGLLNGYNTFKKCFEAPILKSRQPGATENDME---KGTAREEELAD 534

Query: 222 LSDC-CLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSAS 280
           L+    L  + +      KP   T+ V   +P   Q   +Q  L   + G  + +  ++ 
Sbjct: 535 LTKLFILRRNASILAKYLKP--KTEYVLFCKPTQAQAEVYQHVLASPVFGRVLGSSEASL 592

Query: 281 KTVKCLQ-----------------LANGAVYYDEEKHWKEVHDEKIKALEVIIEKANAAP 323
           + +  L+                  +N  V    E    E+  + I    +++    +  
Sbjct: 593 QLITMLKKVCNAPSLLVKKSDTDTPSNSNVAQLLESIPPEILKKNIVVASILVSNYTSTL 652

Query: 324 IIVAYHFNS---DLARLQKAFPQGRTLDKDPCTIQEWNEGKIPLLFA---HPASCGHGLN 377
            ++  H +S      RL  + PQ +  D     +  +N+      FA      S G G+N
Sbjct: 653 DLLMSHLSSLNLPFLRLDGSTPQAKRQD----LVNTFNKTPASKYFAFLLSAKSGGAGIN 708

Query: 378 LQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRL 437
           L  G + LV F + W+     Q + RI      + G KR+V +Y  +    +DE + QR 
Sbjct: 709 L-IGASRLVLFDVDWNPATDLQAMARI-----HRDGQKRSVKIYRFLMSGGMDEKIYQRQ 762

Query: 438 RTKSTIQDLLLNALKKE 454
            TK  + D +++  K E
Sbjct: 763 VTKIGLADSVMDGKKNE 779


>gi|330803641|ref|XP_003289812.1| hypothetical protein DICPUDRAFT_36354 [Dictyostelium purpureum]
 gi|325080071|gb|EGC33642.1| hypothetical protein DICPUDRAFT_36354 [Dictyostelium purpureum]
          Length = 731

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 115/512 (22%), Positives = 209/512 (40%), Gaps = 91/512 (17%)

Query: 3   LAPHQTKIVDWILD----------HKRCAIWASMGSGKTVSVLTALSYIHLWGE------ 46
           L PHQ + V ++ D          +    +   MG GKT+  L AL +  L         
Sbjct: 47  LRPHQRRGVKFLYDCVTGTNNEEGYTGAILADQMGLGKTLQTL-ALVWTLLKQSPTGKST 105

Query: 47  -KSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVL-----KTPAVLYVI 100
            K  +++ P  +  + W  E+Q+W     +  + +T ++ + TK        +   + +I
Sbjct: 106 IKKAIIVTPSTLVNN-WKKEIQKWFGLDRLIATTLTDSLSKETKTNLDNFNTSIKPVLII 164

Query: 101 NFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT 160
           ++E      + L+ T     +V DE+ +LK+      SKT +A+   + ++ER I LTGT
Sbjct: 165 SYEQCRIFSKILE-TMSCGLLVCDEAHRLKN----SNSKTTQAIN--SVKAERKILLTGT 217

Query: 161 PSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGSHIGAVRYTAKETAQKEIEA 220
           P  N L++ +  + F + G  LG +  SF   + N               +   +K IE 
Sbjct: 218 PIQNDLVEFYSMVDFCNPG-SLGSL-ASFKKNFINPINKSRESTGNPKDIENGTKKSIE- 274

Query: 221 QLSDCCLSLDIADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENI------- 273
            LS    S  +    NI +  L  K+V   Q V  +    Q++LY  +   N        
Sbjct: 275 -LSKLTKSFILRRKSNILEKYLPPKRV---QVVFCRLSPLQQDLYKSVLNSNSVQSLING 330

Query: 274 -EAFNSASKTVKCL-QLANG-------------AVYYDEEKHWKEVHDEK---------I 309
            E+  S+  T+  L +L N              +++     + + + +E          I
Sbjct: 331 KESPASSLSTITLLKKLCNSPSLLQDTSDQELQSIFKQYSYNMESMENEAGKLLFVESLI 390

Query: 310 KALEVIIEK----ANAAPIIVAYH-----FNSDLARLQKAFPQGRTLDKDPCTIQEWNE- 359
           K L+ + EK    +N    +  +       ++D  RL  +     + D     + ++N+ 
Sbjct: 391 KQLKSVGEKLVLVSNYTQTLDVFERLCKKLSTDFLRLDGSV----SSDTRQSLVDKFNDQ 446

Query: 360 --GKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
              K  +      + G G+NL  GGN LV +   W+     Q +ER+      + G  + 
Sbjct: 447 SNKKYQIFLLSAKAGGVGINL-IGGNHLVLYDPDWNPAIDIQAMERVW-----REGQNKP 500

Query: 418 VFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN 449
           VF+Y L +  TI+E + QR   K +I + +++
Sbjct: 501 VFIYRLFSTGTIEEKIYQRQLMKESISNSIVD 532


>gi|260888136|ref|ZP_05899399.1| helicase, Snf2 family [Selenomonas sputigena ATCC 35185]
 gi|260862165|gb|EEX76665.1| helicase, Snf2 family [Selenomonas sputigena ATCC 35185]
          Length = 1098

 Score = 63.5 bits (153), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 105/460 (22%), Positives = 191/460 (41%), Gaps = 78/460 (16%)

Query: 25   SMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTV 84
             MG GKT+ V+T L      G    LV+AP  +  + W  E+++++    +  S++ GT 
Sbjct: 663  DMGLGKTLQVITFLLAHREEGRPPALVVAPTSLMYN-WLEEIEKFA--PELKASIVAGTK 719

Query: 85   KQRTKVLKTPAV----LYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKT 140
             +R   L +PA+    + +  +  L   + +L     F+ I +DE+ ++K+      ++ 
Sbjct: 720  AEREAAL-SPALKDADVIITTYHMLRRDI-DLYEKEHFSHIFLDEAQQIKN----PATQA 773

Query: 141  ARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRV-FQS-FVARWFNTTQ 198
            A+A+ K   +++    LTGTP  N L +LW    FL  G    R  FQS F         
Sbjct: 774  AKAVKK--LQADAAFALTGTPIENSLTELWSIFDFLMPGYLKSRKHFQSQFETPIVRAKD 831

Query: 199  IGSHIGAVRYTAK---ETAQKEIEAQLSDCC---LSLDIADYQNIDKPILITKKVPLPQP 252
              +    +RY +       +K++  +L D     ++ ++ D Q                 
Sbjct: 832  PHASADLLRYISPFILRRLKKDVLEELPDKVERKMTNEMTDEQR---------------- 875

Query: 253  VMKQYH--------KFQRELYCDLQGEN---IEAFNSASKTVKCLQLANGAVYYDEEKHW 301
              K YH        +F  EL     GE+   I A  +  + + C    + A++ ++    
Sbjct: 876  --KVYHAWFVQAKKEFAAELKAHGFGESRIKILAILTRLRQIAC----DPALFLEDYTGG 929

Query: 302  KEVHDEKIKALEVIIEKANAAP--IIVAYHFNS---------DLARLQKAFPQGRTLDKD 350
                  K+  LE ++  A AA   I++   F +         D+  L  A+  G T   +
Sbjct: 930  S----GKLDMLEEVVADAVAAGHRILIFSQFTTMLSHIAARLDVMNLSYAYLDGSTPALE 985

Query: 351  PC-TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQ 409
                ++++N G  PL      + G GLNL  G ++++ +  WW+       +E     R 
Sbjct: 986  RMRRVRDFNAGAEPLFLISLKAGGTGLNLT-GADMVIHYDPWWN-----PAVEDQATDRA 1039

Query: 410  RQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLN 449
             + G K  V V   I ++TI+E + +    K  + D ++ 
Sbjct: 1040 YRIGQKNNVQVLKFITKDTIEEKIYELQEKKKALIDQMIQ 1079


>gi|149245518|ref|XP_001527236.1| SNF2-family ATP dependent chromatin remodeling factor snf21
           [Lodderomyces elongisporus NRRL YB-4239]
 gi|146449630|gb|EDK43886.1| SNF2-family ATP dependent chromatin remodeling factor snf21
           [Lodderomyces elongisporus NRRL YB-4239]
          Length = 1400

 Score = 63.5 bits (153), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 131/280 (46%), Gaps = 42/280 (15%)

Query: 3   LAPHQTKIVDWIL----DHKRCAIWASMGSGKTVSVLTALSY-IHLWGEKSVLVIAPLRV 57
           L  +Q K ++W++    +H    +   MG GKT+  ++ ++Y I    E+  LVI PL  
Sbjct: 592 LKEYQLKGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLIEKKHEQKFLVIVPLST 651

Query: 58  AQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLKTPAVL--YVINFENLGWLVQE--LK 113
             + WT E ++W+    + + V  G+ +QR K L++   L  + +      ++++E  L 
Sbjct: 652 ITN-WTLEFEKWA--PAVKVIVYKGSQQQR-KSLQSEVRLGSFQVMLTTYEYVIRERPLL 707

Query: 114 GTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQI 173
             + ++ +++DE  ++K+      SK ++ L +      R I LTGTP  N L +LW  +
Sbjct: 708 SKFYYSHMIIDEGHRMKN----TNSKLSQTLRQYYRTKNRLI-LTGTPLQNNLPELWALL 762

Query: 174 WFLDKGKRLGRVFQSFVA--RWFNTTQIGSHIGAVRYTAKETAQKEIEAQLSDCCLSLDI 231
            F+     L ++F S  +   WFNT             A   AQ++IE    +  L   I
Sbjct: 763 NFV-----LPKIFNSVKSFDEWFNTP-----------FANTGAQEKIELTEEESLLV--I 804

Query: 232 ADYQNIDKPILITKKVPLPQPVMKQY-HKFQRELYCDLQG 270
                + +P L+ +   L + V K    K ++ L C+L G
Sbjct: 805 RRLHKVLRPFLLRR---LKKDVEKDLPDKVEKVLKCNLSG 841


>gi|320528040|ref|ZP_08029206.1| protein, SNF2 family [Solobacterium moorei F0204]
 gi|320131666|gb|EFW24230.1| protein, SNF2 family [Solobacterium moorei F0204]
          Length = 706

 Score = 63.5 bits (153), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 97/448 (21%), Positives = 187/448 (41%), Gaps = 84/448 (18%)

Query: 13  WILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNF 72
           +IL  KR  +   MG GKT+  + A+++++  G +   VI P  +  + W  EV++ ++ 
Sbjct: 295 YILHQKRVLLGDEMGLGKTIQAIAAMNHLYHKGHRYFFVICPASLLLN-WKREVEKLTD- 352

Query: 73  SHMNISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSF 132
             M   ++ G       V ++   + +IN+E L  ++      +    +VVDE+  +K+ 
Sbjct: 353 --MQAYILHGDSFGDYAVWESNGGIAIINYEGLDKII--FDKDFSLDMVVVDEAHFVKNK 408

Query: 133 RLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVAR 192
             ++   T R +     ++E  + +TGT   N + ++   I  L+               
Sbjct: 409 DAQRTRHTIRIIE----QAEYALYMTGTAIENNVDEMCYLIECLNPS------------- 451

Query: 193 WFNTTQIGSHIGAVRYTAK-ETAQKEIEAQLSDCCLSLDIADYQNIDKPILITKK---VP 248
                 I + I  ++Y AK E  +K+I                     P+ + +K   V 
Sbjct: 452 ------IANEIKGMKYLAKAELFRKKI--------------------APVYLRRKRADVL 485

Query: 249 LPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWKEVHDEK 308
           +  P +  Y +     +C +  + I ++  A ++   + +   +        W  ++  K
Sbjct: 486 MELPELTIYDE-----WCMMNEDEINSYRKAVESENFMAMRRVS--------WNSLNSTK 532

Query: 309 IKALEVIIEKA---NAAPIIVAY-----HFNSDLARLQKAFP--QGR-TLDKDPCTIQEW 357
            + +  +  +A       II +Y      F SDL  L KA P   G+ +L+K    + ++
Sbjct: 533 AERMTELCLQALSEGRKVIIFSYFLDTLSFVSDLL-LGKALPVISGKLSLEKRQDILHQF 591

Query: 358 NEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA 417
           +E    +L     + G GLN+Q    I++         +  Q I R+      + G    
Sbjct: 592 DEPIARVLPIQIHAGGIGLNIQ-TAEIVILCEPQLKPSDEMQAISRV-----YRMGQVNH 645

Query: 418 VFVYYLIAQNTIDELVLQRLRTKSTIQD 445
           VFVY L++ +TIDE +++RL  K  I D
Sbjct: 646 VFVYRLLSADTIDETLVKRLHEKQNIFD 673


>gi|313112827|ref|ZP_07798474.1| protein, SNF2 family [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310624897|gb|EFQ08205.1| protein, SNF2 family [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 1100

 Score = 63.2 bits (152), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 104/444 (23%), Positives = 185/444 (41%), Gaps = 60/444 (13%)

Query: 25   SMGSGKTVSVLTALSYIHLWGEK-SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83
             MG GKTV VL+ L  +   G++   L++ P  +  + W  E Q+++    ++   + G 
Sbjct: 668  DMGLGKTVQVLSYLLAMKERGQRLPSLIVCPASLVLN-WQEECQKFT--PQLSCVAVDGD 724

Query: 84   VKQRTKVLK--TPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFRLRQGSKTA 141
               R ++ K    A L V ++ +L    +EL     F   ++DE+  +K+        T 
Sbjct: 725  AAHRAELAKQWAEADLVVTSY-DLMRRDEELYNGQQFYACILDEAQAIKNH------TTQ 777

Query: 142  RALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSFVARWFNTTQIGS 201
            +  A     S+    LTGTP  N L +LW    FL  G      +++F AR+        
Sbjct: 778  KYKAVCGVNSKVRFALTGTPVENRLGELWSIFSFLMPGYL--PPYKTFCARFEKPIVQED 835

Query: 202  HIGAVRYTAKETA-------QKEIEAQLSDCCLSLDIADYQNIDKPILITKKVPL----- 249
               A+R   + T        + E+  +L     +L   +     + + +   V       
Sbjct: 836  DKDALRRLNQLTGPFILRRMKSEVLKELPPKTENLHRIELDEQQRKLYLAAVVDAREKLR 895

Query: 250  ---PQPVMKQYHKFQR--ELYCD--LQGENIEAFNSASKTVKCLQLANGAVYYDEEKHWK 302
               P+  M  +    R  E+ CD  L  +N +    ++K   C++L   AV   E  H  
Sbjct: 896  AAKPEDKMAVFAVLMRLREICCDPRLVADNWDG--GSAKLDACMELVTAAV---EGGHRI 950

Query: 303  EVHDEKIKALEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQEWNEGKI 362
             +  +    LE++ ++ + A +    HF      LQ + P+    +     ++ +N G+ 
Sbjct: 951  LLFSQFTSMLELLAKRLDEAGV---SHFT-----LQGSTPKPVRAE----LVRRFNSGEA 998

Query: 363  PLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIGVTRQRQAGFKRAVFVYY 422
             +      + G GLNL    +I++ +  WW++    Q  +R     QR       V VY 
Sbjct: 999  DVFLISLRAGGTGLNLT-AADIVIHYDPWWNVAAQNQATDRAYRIGQRNP-----VQVYK 1052

Query: 423  LIAQNTIDELVLQRLRTKSTIQDL 446
            LIAQ+TI+E +++  + K   QDL
Sbjct: 1053 LIAQDTIEEKIVELQQAK---QDL 1073


>gi|260907213|ref|ZP_05915535.1| DNA/RNA helicase, superfamily II, SNF2 family protein [Brevibacterium
            linens BL2]
          Length = 1132

 Score = 63.2 bits (152), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 104/476 (21%), Positives = 195/476 (40%), Gaps = 61/476 (12%)

Query: 2    NLAPHQTKIVDWILDHKRCAIWAS---------MGSGKTVSVLTALSYIH--LWGEKSVL 50
             L P+Q +   W+      A+W+S         MG GKT+  L+  ++I         +L
Sbjct: 670  TLRPYQQEGFSWL-----AALWSSGLGGILADDMGLGKTLQALSLFTHIKNTTANASPIL 724

Query: 51   VIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQRTKVLK---TPAVLYVINFENLGW 107
            V+AP  V  S W +E ++++    + ++ I+ T K+R   L      A L + ++  L  
Sbjct: 725  VVAPTSV-MSTWRAEAEKFA--PGLRVTTISATEKKRKTALALEIEDADLVITSYAILRL 781

Query: 108  LVQELKGTWPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERF-IELTGTPSPNGL 166
              Q  + +  + T V+DE+  +K+       +TA+          RF + +TGTP  N L
Sbjct: 782  DAQAFR-SIQWDTFVLDEAQFVKN---