RPSBLAST alignment for GI: 255764515 and conserved domain: smart00487

>gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily. Length = 201
 Score = 67.9 bits (166), Expect = 5e-12
 Identities = 38/176 (21%), Positives = 67/176 (38%), Gaps = 13/176 (7%)

Query: 3   LAPHQTKIVDWILDHKR-CAIWASMGSGKT-VSVLTALSYIHLWGEKSVLVIAPLRVAQS 60
           L P+Q + ++ +L   R   + A  GSGKT  ++L AL  +     K VLV+ P R    
Sbjct: 9   LRPYQKEAIEALLSGLRDVILAAPTGSGKTLAALLPALEALKRGKGKRVLVLVPTRELAE 68

Query: 61  VWTSEVQRWSNFSHMNISVITG---TVKQRTKVLKTPAVLYVINFENL-GWLVQELKGTW 116
            W  E+++      + +  + G     +Q  K+      + V     L   L  +L    
Sbjct: 69  QWAEELKKLGPSLGLKVVGLYGGDSKREQLRKLESGKTDILVTTPGRLLDLLENDLLELS 128

Query: 117 PFATIVVDES--TKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLW 170
               +++DE+       F           L K   ++ + + L+ TP       L 
Sbjct: 129 NVDLVILDEAHRLLDGGFG-----DQLEKLLKLLPKNVQLLLLSATPPEEIENLLE 179