RPSBLAST alignment for GI: 255764515 and conserved domain: cd00046

>gnl|CDD|28927 cd00046, DEXDc, DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.. Length = 144
 Score = 54.7 bits (131), Expect = 5e-08
 Identities = 25/148 (16%), Positives = 54/148 (36%), Gaps = 8/148 (5%)

Query: 18  KRCAIWASMGSGKT-VSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMN 76
           +   + A  GSGKT  ++L  L  +       VLV+AP R   +   +E  +      + 
Sbjct: 1   RDVLLAAPTGSGKTLAALLPILELLDSLKGGQVLVLAPTREL-ANQVAERLKELFGEGIK 59

Query: 77  ISVITGTV---KQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLKSFR 133
           +  + G     +Q   +     ++       L  L +          +++DE+ +L +  
Sbjct: 60  VGYLIGGTSIKQQEKLLSGKTDIVVGTPGRLLDELERLKLSLKKLDLLILDEAHRLLN-- 117

Query: 134 LRQGSKTARALAKPAWESERFIELTGTP 161
            +        +     +  + + L+ TP
Sbjct: 118 -QGFGLLGLKILLKLPKDRQVLLLSATP 144