RPSBLAST alignment for GI: 255764515 and conserved domain: KOG0384

>gnl|CDD|35605 KOG0384, KOG0384, KOG0384, Chromodomain-helicase DNA-binding protein [Transcription]. Length = 1373
 Score = 49.6 bits (118), Expect = 2e-06
 Identities = 51/170 (30%), Positives = 76/170 (44%), Gaps = 28/170 (16%)

Query: 26  MGSGKTVSVLTALSYIHLWGEK--SVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITG- 82
           MG GKTV  +T LSY+    +     LV+ PL    + W  E + W++   MN+ V  G 
Sbjct: 398 MGLGKTVQTITFLSYLFHSLQIHGPFLVVVPLSTITA-WEREFETWTD---MNVIVYHGN 453

Query: 83  ------------TVKQRTKVLKTPAVLYVINFENLGWLVQELKGTWPFATIVVDESTKLK 130
                            TK LK  A+L    +E +     EL    P+  ++VDE+ +LK
Sbjct: 454 LESRQLIRQYEFYHSSNTKKLKFNALL--TTYEIVLKDKAEL-SKIPWRYLLVDEAHRLK 510

Query: 131 SFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGK 180
           +      SK   +L    ++    + +TGTP  N L +LW  + FL  GK
Sbjct: 511 N----DESKLYESLN--QFKMNHRLLITGTPLQNSLKELWSLLHFLMPGK 554