RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62] (458 letters) >gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily. Length = 201 Score = 67.9 bits (166), Expect = 5e-12 Identities = 38/176 (21%), Positives = 67/176 (38%), Gaps = 13/176 (7%) Query: 3 LAPHQTKIVDWILDHKR-CAIWASMGSGKT-VSVLTALSYIHLWGEKSVLVIAPLRVAQS 60 L P+Q + ++ +L R + A GSGKT ++L AL + K VLV+ P R Sbjct: 9 LRPYQKEAIEALLSGLRDVILAAPTGSGKTLAALLPALEALKRGKGKRVLVLVPTRELAE 68 Query: 61 VWTSEVQRWSNFSHMNISVITG---TVKQRTKVLKTPAVLYVINFENL-GWLVQELKGTW 116 W E+++ + + + G +Q K+ + V L L +L Sbjct: 69 QWAEELKKLGPSLGLKVVGLYGGDSKREQLRKLESGKTDILVTTPGRLLDLLENDLLELS 128 Query: 117 PFATIVVDES--TKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLW 170 +++DE+ F L K ++ + + L+ TP L Sbjct: 129 NVDLVILDEAHRLLDGGFG-----DQLEKLLKLLPKNVQLLLLSATPPEEIENLLE 179 >gnl|CDD|128766 smart00490, HELICc, helicase superfamily c-terminal domain. Length = 82 Score = 36.0 bits (84), Expect = 0.022 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Query: 353 TIQEWNEGKIPLLFAHPASCGHGLNLQYGGNILVFFSLWWDLEEHQQMIERIG 405 ++++N GKI +L A GL+L G ++++ + L W + Q I R G Sbjct: 29 ILEKFNNGKIKVLVA-TDVAERGLDLP-GVDLVIIYDLPWSPASYIQRIGRAG 79 >gnl|CDD|161952 TIGR00603, rad25, DNA repair helicase rad25. All proteins in this family for which functions are known are DNA-DNA helicases used for the initiation of nucleotide excision repair and transacription as part of the TFIIH complex.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 732 Score = 34.4 bits (79), Expect = 0.059 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Query: 27 GSGKTVSVLTALSYIHLWGEKSVLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGTVKQ 86 G+GK++ +TA + +KS LV+ V+ W + + WS I T K+ Sbjct: 283 GAGKSLVGVTAACTV----KKSCLVLCTSAVSVEQWKQQFKMWSTIDDSQICRFTSDAKE 338 Query: 87 R 87 R Sbjct: 339 R 339 >gnl|CDD|134340 PRK00650, PRK00650, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional. Length = 288 Score = 30.2 bits (68), Expect = 1.1 Identities = 21/95 (22%), Positives = 36/95 (37%), Gaps = 5/95 (5%) Query: 366 FAHPASCGHGLNLQYGGNIL--VFFSLWWDLEEHQQMIERIGVTRQRQAGFKRA---VFV 420 + P+ C NL+Y N L F L DL+E + +E + G + +FV Sbjct: 179 YVQPSDCSSRKNLEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVHVGLTGSGATLFV 238 Query: 421 YYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKET 455 Y Q R + LL + ++++ Sbjct: 239 RYPEILEKDPSYAAQIQRAITLSGGLLTSPIRRDP 273 >gnl|CDD|152224 pfam11788, MRP-L46, 39S mitochondrial ribosomal protein L46. This is the L46 subunit of the mammalian mitochondrial ribosome, conserved from plants and fungi. Length = 113 Score = 30.3 bits (68), Expect = 1.2 Identities = 14/78 (17%), Positives = 28/78 (35%), Gaps = 17/78 (21%) Query: 240 PILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNSASKTVKCLQLANGAVYYDEEK 299 P++ P P P K ++K+Q EL L + F T+ E Sbjct: 13 PVVT----PDPSPFEKAFYKYQAELLERLMWPFPKYFYFKKGTL-------------AEL 55 Query: 300 HWKEVHDEKIKALEVIIE 317 ++E+ + ++ + Sbjct: 56 RFRELQKKPVERDPGVAF 73 >gnl|CDD|178687 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional. Length = 1033 Score = 29.4 bits (66), Expect = 1.9 Identities = 53/210 (25%), Positives = 92/210 (43%), Gaps = 45/210 (21%) Query: 26 MGSGKTVSVLTALSYIHLWGEKS--VLVIAPLRVAQSVWTSEVQRWSNFSHMNISVITGT 83 MG GKT+ ++ L Y+H + + +V+AP + W +E++R+ + G Sbjct: 197 MGLGKTLQTISLLGYLHEYRGITGPHMVVAP-KSTLGNWMNEIRRFCPV--LRAVKFHGN 253 Query: 84 VKQRTKVLKTPAV-----LYVINFENLGWLVQE----LKGTWPFATIVVDESTKLKSFRL 134 ++R + V + V +FE ++E + +W + I++DE+ ++K+ Sbjct: 254 PEERAHQREELLVAGKFDVCVTSFE---MAIKEKTALKRFSWRY--IIIDEAHRIKNENS 308 Query: 135 RQGSKTARALAKPAWESERFIELTGTPSPNGLIDLWGQIWFLDKGKRLGRVFQSF--VAR 192 SKT R + + R + +TGTP N L +LW + FL L +F S Sbjct: 309 LL-SKTMRLFST----NYRLL-ITGTPLQNNLHELWALLNFL-----LPEIFSSAETFDE 357 Query: 193 WFNTTQIGSHIGAVRYTAKETAQKEIEAQL 222 WF QI E Q+E+ QL Sbjct: 358 WF---QISG----------ENDQQEVVQQL 374 >gnl|CDD|171518 PRK12463, PRK12463, chorismate synthase; Reviewed. Length = 390 Score = 29.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Query: 312 LEVIIEKANAAPIIVAYHFNSDLARLQKAFPQGRTLDKDPCTIQ 355 L VI+E A + A H N +L R QK +GR + + T++ Sbjct: 14 LTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIETDTVE 57 >gnl|CDD|162681 TIGR02068, cya_phycin_syn, cyanophycin synthetase. Cyanophycin synthesis is analogous to polyhydroxyalkanoic acid (PHA) biosynthesis, except that PHA polymers lack nitrogen and may be made under nitrogen-limiting conditions. Length = 864 Score = 29.0 bits (65), Expect = 2.8 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Query: 215 QKEIEAQLSD--CCLSLDIADYQNIDKPILITKKVPLPQ 251 QK I+A +D ++++IA +++ K IL VP+P+ Sbjct: 192 QKRIQATETDRTSAIAVEIACDKDLTKEILSDAGVPVPE 230 >gnl|CDD|132509 TIGR03469, HonB, hopene-associated glycosyltransferase HpnB. This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. Indeed, the members of this family appear to never be found in a genome lacking squalene-hopene cyclase (SHC), although not all genomes encoding SHC have this glycosyl transferase. In the organism Zymomonas mobilis the linkage of this gene to hopanoid biosynthesis has been noted and the gene named HpnB. Hopanoids are known to feature polar glycosyl head groups in many organisms. Length = 384 Score = 28.9 bits (65), Expect = 3.2 Identities = 18/81 (22%), Positives = 31/81 (38%), Gaps = 11/81 (13%) Query: 117 PFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLW-GQIWF 175 I+VD+ + + + ARA A+ +R ++G P P G W G++W Sbjct: 70 KLHVILVDDHSTDGT------ADIARAAARAYGRGDRLTVVSGQPLPPG----WSGKLWA 119 Query: 176 LDKGKRLGRVFQSFVARWFNT 196 + +G R T Sbjct: 120 VSQGIAAARTLAPPADYLLLT 140 >gnl|CDD|179286 PRK01368, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional. Length = 454 Score = 28.7 bits (64), Expect = 3.7 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 229 LDIADYQNIDKPILITKKVPLPQPVMKQYHKF 260 L + +QN+DK I+++ +PL ++K F Sbjct: 56 LSDSRWQNLDK-IVLSPGIPLTHEIVKIAKNF 86 >gnl|CDD|177632 PHA03396, lef-9, late expression factor 9; Provisional. Length = 493 Score = 27.6 bits (62), Expect = 6.4 Identities = 13/48 (27%), Positives = 20/48 (41%), Gaps = 9/48 (18%) Query: 231 IADYQNIDKPILITKKVPLPQPVMKQYHKFQRELYCDLQGENIEAFNS 278 + D +D I ++++ KF R L DL+ I FNS Sbjct: 18 LTDPNKLDNVFFIN---------IEEFKKFLRNLISDLKKIKINYFNS 56 >gnl|CDD|162908 TIGR02538, type_IV_pilB, type IV-A pilus assembly ATPase PilB. This model describes a protein of type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly and is closely related to GspE (TIGR02533) of type II secretion, also called the main terminal branch of the general secretion pathway. Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems. Length = 564 Score = 27.3 bits (61), Expect = 7.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Query: 27 GSGKTVSVLTALS 39 GSGKTVS+ TAL+ Sbjct: 326 GSGKTVSLYTALN 338 >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 1042 Score = 27.2 bits (60), Expect = 8.1 Identities = 32/169 (18%), Positives = 52/169 (30%), Gaps = 13/169 (7%) Query: 2 NLAPHQ-TKIVDWILDHKRCAIWASMGSGKTVSVLTALSYIHLWGEKSVL--VIAPLRVA 58 N ++ T +D+ I G+GKT ++L A++Y L+G+ VI L Sbjct: 10 NFGSYKGTHTIDFTALGPIFLICGKTGAGKT-TLLDAITYA-LYGKLPRRSEVIRSLNSL 67 Query: 59 QSVWTSEVQRWSNFSHMN-----ISVITGTVKQRTKVLKTPAVLYVINFENLGWLVQELK 113 + + FS + T R L L + Sbjct: 68 YAAPSEAAFAELEFSLGTKIYRVHRTLRCTRSHRKTEQPEQLYLEQKKGRG-RILAAKKS 126 Query: 114 GT--WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGT 160 T + +D T + L QG AK + E + L Sbjct: 127 ETEEVIHDLLKLDYKTFTRVVLLPQGEFAQFLKAKSKEKKELLMNLFPL 175 >gnl|CDD|184796 PRK14701, PRK14701, reverse gyrase; Provisional. Length = 1638 Score = 27.2 bits (60), Expect = 8.5 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Query: 309 IKALEVIIEKANAAPIIVAYHFNSDLARLQK 339 ++ +E EKAN +V YH S+L + +K Sbjct: 139 VEKIESFCEKANLDVRLVYYH--SNLRKKEK 167 >gnl|CDD|131121 TIGR02066, dsrB, sulfite reductase, dissimilatory-type beta subunit. This model describes the beta subunit of sulfite reductase. Length = 341 Score = 27.1 bits (60), Expect = 9.3 Identities = 14/55 (25%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Query: 116 WPFATIVVDESTKLKSFRLRQGSKTARALAKPAWESERFIELTGTPSPNGLIDLW 170 WP V + + ++ + + + WE RF EL G P ID W Sbjct: 271 WPELVAYVKKILEAWKANAKKHERLIEWVERIGWE--RFFELVGLPFTQHHIDDW 323 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.135 0.416 Gapped Lambda K H 0.267 0.0705 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 7,486,531 Number of extensions: 482126 Number of successful extensions: 802 Number of sequences better than 10.0: 1 Number of HSP's gapped: 800 Number of HSP's successfully gapped: 17 Length of query: 458 Length of database: 5,994,473 Length adjustment: 97 Effective length of query: 361 Effective length of database: 3,898,497 Effective search space: 1407357417 Effective search space used: 1407357417 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 59 (26.6 bits)