RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764517|ref|YP_003084345.1| hypothetical protein CLIBASIA_05538 [Candidatus Liberibacter asiaticus str. psy62] (135 letters) >gnl|CDD|177771 PLN00176, PLN00176, galactinol synthase. Length = 333 Score = 28.1 bits (63), Expect = 0.74 Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Query: 8 EKLNFEQTKSVTYWAVGSKFVIPW 31 E + ++ K V Y A GSK PW Sbjct: 246 ENVELDKVKVVHYCAAGSK---PW 266 >gnl|CDD|162722 TIGR02136, ptsS_2, phosphate binding protein. Members of this family are phosphate-binding proteins. Most are found in phosphate ABC-transporter operons, but some are found in phosphate regulatory operons. This model separates members of the current family from the phosphate ABC transporter phosphate binding protein described by TIGRFAMs model TIGR00975. Length = 287 Score = 26.2 bits (58), Expect = 2.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 80 IFEGEKQTFKEYNSDSPRAPHNLV 103 I+ GE +KE D P P +V Sbjct: 141 IYSGEITNWKEVGGDLPNKPIVVV 164 >gnl|CDD|116802 pfam08216, DUF1716, Eukaryotic domain of unknown function (DUF1716). This domain is found in eukaryotic proteins. A human nuclear protein with this domain is thought to have a role in apoptosis. Length = 108 Score = 25.0 bits (55), Expect = 6.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 100 HNLVKEADLYPLHNRLDGVETIVSDLNNMKNRI 132 L DLYP L+GV +++S LN+ I Sbjct: 71 KVLATCPDLYPSLVELNGVSSLLSLLNHENTDI 103 >gnl|CDD|117843 pfam09299, Mu-transpos_C, Mu transposase, C-terminal. Members of this family are found in various prokaryotic integrases and transposases. They adopt a beta-barrel structure with Greek-key topology. Length = 63 Score = 24.8 bits (55), Expect = 6.7 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 11/54 (20%) Query: 2 IRKVNMEKLNFEQTKSVTYWA------VGSKFVIPWDIKDPSRIHAEVGYSDGR 49 RKV+ + Y A VG K ++ +D +D SR+ V DGR Sbjct: 10 ERKVDRGGIRLF---GNRYEAPALAAYVGEKVIVRYDPRDLSRVL--VYAKDGR 58 >gnl|CDD|185395 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional. Length = 653 Score = 24.8 bits (54), Expect = 8.4 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 71 NNREGDFIRIFEGEKQTFKEYN 92 +N+ G I++FEGE+ K+ N Sbjct: 435 DNQPGVLIQVFEGERAMTKDNN 456 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.135 0.394 Gapped Lambda K H 0.267 0.0605 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,143,000 Number of extensions: 123746 Number of successful extensions: 195 Number of sequences better than 10.0: 1 Number of HSP's gapped: 195 Number of HSP's successfully gapped: 11 Length of query: 135 Length of database: 5,994,473 Length adjustment: 83 Effective length of query: 52 Effective length of database: 4,201,009 Effective search space: 218452468 Effective search space used: 218452468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.1 bits)