BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764517|ref|YP_003084345.1| hypothetical protein CLIBASIA_05538 [Candidatus Liberibacter asiaticus str. psy62] (135 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764517|ref|YP_003084345.1| hypothetical protein CLIBASIA_05538 [Candidatus Liberibacter asiaticus str. psy62] Length = 135 Score = 280 bits (716), Expect = 7e-78, Method: Compositional matrix adjust. Identities = 135/135 (100%), Positives = 135/135 (100%) Query: 1 MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFD 60 MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFD Sbjct: 1 MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFD 60 Query: 61 VDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVET 120 VDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVET Sbjct: 61 VDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVET 120 Query: 121 IVSDLNNMKNRIQDL 135 IVSDLNNMKNRIQDL Sbjct: 121 IVSDLNNMKNRIQDL 135 >gi|255764516|ref|YP_003084344.1| hypothetical protein CLIBASIA_05532 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 96.3 bits (238), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 10/123 (8%) Query: 7 MEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNA 66 M + NFEQ+K V+Y GS FVIPW +KDPSRIHAEV Y DG ++EL+ +DF VD + Sbjct: 1 MMQYNFEQSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDES 60 Query: 67 LLTVNNRE----GDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIV 122 L ++++ + +RIFEGEKQTFK++N + + K + L +++ ++ IV Sbjct: 61 SLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQK------KVNQVNVLTQKMNTIDGIV 114 Query: 123 SDL 125 +DL Sbjct: 115 NDL 117 >gi|254780875|ref|YP_003065288.1| protoporphyrinogen oxidase (methyltransferase) protein [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 26.6 bits (57), Expect = 0.17, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Query: 44 GYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEK----QTFKEYNSD 94 G S R +S+ + DGL ++ N++ D +RIFE K FK+Y + Sbjct: 202 GLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGN 256 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 23.9 bits (50), Expect = 1.1, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Query: 28 VIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDG 63 + D+KDP Y D R +E+ S +FD+ G Sbjct: 549 IFKSDLKDPKSFAN--TYKDNRYKEIISSFNFDIHG 582 >gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Score = 23.9 bits (50), Expect = 1.1, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 38 RIHAEVGYSDGRVQELAI 55 R+H VG++ GR Q ++I Sbjct: 388 RVHVTVGWTSGRGQYISI 405 >gi|254780462|ref|YP_003064875.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 267 Score = 22.3 bits (46), Expect = 3.1, Method: Compositional matrix adjust. Identities = 8/17 (47%), Positives = 13/17 (76%) Query: 23 VGSKFVIPWDIKDPSRI 39 V S F+IP +++DPS + Sbjct: 56 VDSDFMIPCNVEDPSSM 72 >gi|254781115|ref|YP_003065528.1| poly(A) polymerase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 416 Score = 22.3 bits (46), Expect = 3.4, Method: Compositional matrix adjust. Identities = 9/31 (29%), Positives = 16/31 (51%) Query: 46 SDGRVQELAISQDFDVDGLNALLTVNNREGD 76 +DGR ++ ++D+ D L T+N D Sbjct: 100 TDGRYAKVVFTRDWKADSLRRDFTINALYAD 130 >gi|254780817|ref|YP_003065230.1| preprotein translocase subunit SecB [Candidatus Liberibacter asiaticus str. psy62] Length = 152 Score = 21.6 bits (44), Expect = 5.2, Method: Compositional matrix adjust. Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 86 QTFKEYNSDSPRAPH 100 Q K+++ +SP APH Sbjct: 14 QYIKDFSFESPNAPH 28 >gi|254780552|ref|YP_003064965.1| Holliday junction DNA helicase RuvB [Candidatus Liberibacter asiaticus str. psy62] Length = 334 Score = 20.8 bits (42), Expect = 9.4, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 117 GVETIVSDLNNMKNRIQDL 135 G+ETI + L+ ++ I+DL Sbjct: 281 GIETISAGLSEPRDAIEDL 299 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.135 0.394 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,732 Number of Sequences: 1233 Number of extensions: 3193 Number of successful extensions: 12 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 10 length of query: 135 length of database: 328,796 effective HSP length: 65 effective length of query: 70 effective length of database: 248,651 effective search space: 17405570 effective search space used: 17405570 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 34 (17.7 bits)