Query         537021.9.peg.1073_1
Match_columns 162
No_of_seqs    114 out of 241
Neff          7.0 
Searched_HMMs 13730
Date          Wed May 25 05:47:32 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_1073.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2ft1a1 d.183.1.1 (A:104-383)   73.6     2.7  0.0002   19.5  12.7  124   10-152   147-276 (280)
  2 d2pk8a1 d.274.1.1 (A:2-95) Hyp  10.3      45  0.0033   12.2   5.5   35   16-50     11-45  (94)
  3 d1wb8a2 d.44.1.1 (A:93-208) Fe   8.7      52  0.0038   11.8   1.2   77   39-119    11-89  (116)
  4 d2v33a1 b.1.18.4 (A:293-382) F   8.2      50  0.0036   11.9   0.6   15   73-87     12-26  (90)
  5 d1dt0a2 d.44.1.1 (A:84-197) Fe   8.2      55   0.004   11.7   1.0   82   28-119     1-84  (114)
  6 d3ehwa1 b.85.4.1 (A:24-159) De   7.0      62  0.0045   11.3   1.7   17   72-88     73-90  (136)
  7 d1te7a_ b.122.1.7 (A:) Hypothe   6.9      63  0.0046   11.3   1.3   13  102-114    48-60  (103)
  8 d1vyqa1 b.85.4.1 (A:1-159) Deo   6.4      47  0.0034   12.0  -0.2   14   74-87    105-119 (159)
  9 d1vlba3 d.41.1.1 (A:194-310) A   6.0      70  0.0051   11.0   2.3   11   82-92     42-52  (117)
 10 d1ayia_ a.28.2.1 (A:) ImmE7 pr   5.7      73  0.0053   10.9   1.9   23   11-33      8-30  (86)

No 1  
>d2ft1a1 d.183.1.1 (A:104-383) Major capsid protein gp5 {Bacteriophage HK97 [TaxId: 37554]}
Probab=73.65  E-value=2.7  Score=19.48  Aligned_cols=124  Identities=12%  Similarity=0.068  Sum_probs=77.7

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCEEEECHHHHHHHHHHHCCCCEEEEEECCCCCCCCCEEEEEEEEEECCCEEEEEEEC
Q ss_conf             65317899999999999769983489994999999998612431134542146776554155567899718426799825
Q 537021.9.peg.1   10 QRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPN   89 (162)
Q Consensus        10 ~~~lTE~~l~~~lq~i~~~GG~~~~i~v~p~~K~~is~f~~~~~~~~~~~~~~~~~~~~~i~~svd~y~sdfG~v~ivpn   89 (162)
                      ....+.+.+.+++-++..++.++..++++|.....+..+-....++-.  .........          +=+| ++|+.+
T Consensus       147 ~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~l~~lkd~~G~~l~--~~~~~~~~~----------~l~G-~Pv~~s  213 (280)
T d2ft1a1         147 TGDTRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIF--GGPQAFTSN----------IMWG-LPVVPT  213 (280)
T ss_dssp             SSCCHHHHHHHHHHHHHTTSCCCCEEEECHHHHHHHHTCBCTTSCBSS--STTTCCCCS----------EETT-EEEEEC
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCCEEEECHHHHHHHHHCCCCCCCEEC--CCCCCCCCC----------CCCC-EEEEEE
T ss_conf             654321458999987765135575279727688777611167886502--564457775----------0477-479972


Q ss_pred             CCCCCCCCCCEEEEEECHHHEEEEECCCCCEECCCCCCC------CCEEEEEEEEEEEEEECHHHCEEE
Q ss_conf             656887644205999846454531027642000136678------822679999987587080006899
Q 537021.9.peg.1   90 RVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNG------DANKGVLIGEGALKVRNEKAVGVV  152 (162)
Q Consensus        90 r~~~~~~~~~~~~~ilD~~~~~~~~Lr~~~~~e~laktG------D~~k~~i~~E~tL~~~n~~a~g~I  152 (162)
                      ..+++.     .+++.|......-+-|.-...+ +....      |-........+++.+++|+|.-+.
T Consensus       214 ~~~~~~-----~~~~gdf~~~~~~~~r~~~~v~-~~~~~~~~f~~~~v~~ra~~r~~~~v~~~~Afv~g  276 (280)
T d2ft1a1         214 KAQAAG-----TFTVGGFDMASQVWDRMDATVE-VSREDRDNFVKNMLTILCEERLALAHYRPTAIIKG  276 (280)
T ss_dssp             TTSCTT-----EEEEECHHHHEEEEESEEEEEE-EESSSTTHHHHTEEEEEEEEEECEEESCGGGEEEE
T ss_pred             CCCCCC-----EEEEEEHHHEEEEEEECCCEEE-EEECCCCHHHCCEEEEEEEEEEEEEEECCCEEEEE
T ss_conf             798752-----4899603772899991351899-84145116447909999999985588078819999


No 2  
>d2pk8a1 d.274.1.1 (A:2-95) Hypothetical protein PF0899 {Pyrococcus furiosus [TaxId: 2261]}
Probab=10.29  E-value=45  Score=12.18  Aligned_cols=35  Identities=17%  Similarity=0.112  Sum_probs=27.9

Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECHHHHHHHHHHHC
Q ss_conf             99999999999769983489994999999998612
Q 537021.9.peg.1   16 QILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMS   50 (162)
Q Consensus        16 ~~l~~~lq~i~~~GG~~~~i~v~p~~K~~is~f~~   50 (162)
                      ..+...++..-..|=+|+++++||--...++....
T Consensus        11 ~~ie~~inELk~dG~ePDiiL~G~e~~ef~~~~~k   45 (94)
T d2pk8a1          11 GEIEEKMNELKMDGFNPDIILFGREAYNFLSNLLK   45 (94)
T ss_dssp             HHHHHHHHHHHHTTCCCCEEEECHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCEEEECHHHHHHHHHHHH
T ss_conf             99999999998658998769974899999999998


No 3  
>d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
Probab=8.74  E-value=52  Score=11.82  Aligned_cols=77  Identities=8%  Similarity=-0.001  Sum_probs=36.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCCCCCEEEEEEEEEECCCEEEEEEECCC--CCCCCCCCEEEEEECHHHEEEEECC
Q ss_conf             99999999861243113454214677655415556789971842679982565--6887644205999846454531027
Q 537021.9.peg.1   39 PYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRV--MASNAETARNAFLIDPNMLEFLWLR  116 (162)
Q Consensus        39 p~~K~~is~f~~~~~~~~~~~~~~~~~~~~~i~~svd~y~sdfG~v~ivpnr~--~~~~~~~~~~~~ilD~~~~~~~~Lr  116 (162)
                      +..+..|..-+++-............+..+ -+=..=+|..+-|.+.|+....  .|...   ...-||-.|.|+.+|..
T Consensus        11 g~l~~~I~~~FGS~d~fk~~f~~~a~~~~G-sGW~wLv~~~~~~~l~i~~~~n~~~~~~~---~~~piL~lDvWEHAYyl   86 (116)
T d1wb8a2          11 GALADLINKQYGSFDRFKQVFTETANSLPG-TGWAVLYYDTESGNLQIMTFENHFQNHIA---EIPIILILDEFEHAYYL   86 (116)
T ss_dssp             HHHHHHHHHHHSSHHHHHHHHHHHHHTCCS-SEEEEEEECTTTCCEEEEEEETTTBSCCS---SCCEEEEEECSGGGTHH
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHCCCC-CCEEEEEEECCCCCCCCCCCCCCCCCCCC---CCCEEEEECCHHHHHHH
T ss_conf             899999998828999999999998851755-64489987076785110024357898658---98425563310556488


Q ss_pred             CCC
Q ss_conf             642
Q 537021.9.peg.1  117 TIH  119 (162)
Q Consensus       117 ~~~  119 (162)
                      .++
T Consensus        87 dY~   89 (116)
T d1wb8a2          87 QYK   89 (116)
T ss_dssp             HHT
T ss_pred             HHH
T ss_conf             774


No 4  
>d2v33a1 b.1.18.4 (A:293-382) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
Probab=8.17  E-value=50  Score=11.90  Aligned_cols=15  Identities=20%  Similarity=0.259  Sum_probs=11.1

Q ss_pred             EEEEEECCCEEEEEE
Q ss_conf             678997184267998
Q 537021.9.peg.1   73 TADIYDRPFGKVMVH   87 (162)
Q Consensus        73 svd~y~sdfG~v~iv   87 (162)
                      +-=.|-+|||.+..+
T Consensus        12 ~~CtySsDfGGvatl   26 (90)
T d2v33a1          12 ATCTHSSDFGGVLTL   26 (90)
T ss_dssp             EEEBCEEEEEEEEEE
T ss_pred             EEEEECCCCCCEEEE
T ss_conf             787812376876999


No 5  
>d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]}
Probab=8.16  E-value=55  Score=11.67  Aligned_cols=82  Identities=6%  Similarity=0.002  Sum_probs=38.3

Q ss_pred             CCCCCCEEEECHHHHHHHHHHHCCCCEEEEEECCCCCCCCCEEEEEEEEEECCCEEEEEE--ECCCCCCCCCCCEEEEEE
Q ss_conf             699834899949999999986124311345421467765541555678997184267998--256568876442059998
Q 537021.9.peg.1   28 NGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVH--PNRVMASNAETARNAFLI  105 (162)
Q Consensus        28 ~GG~~~~i~v~p~~K~~is~f~~~~~~~~~~~~~~~~~~~~~i~~svd~y~sdfG~v~iv--pnr~~~~~~~~~~~~~il  105 (162)
                      +||+|.     +..++.|..-+++-............+..+.  +=+=.+..+-+.+.++  +|...|.   .....-||
T Consensus         1 aGg~P~-----g~L~~~I~~~FGS~e~fk~~f~~~a~~~~Gs--GW~wL~~~~~~~~~~~~~~n~~~p~---~~~~~PlL   70 (114)
T d1dt0a2           1 AGGQPT-----GALADAINAAFGSFDKFKEEFTKTSVGTFGS--GWGWLVKKADGSLALASTIGAGCPL---TIGDTPLL   70 (114)
T ss_dssp             CCSCCC-----HHHHHHHHHHHSSHHHHHHHHHHHHHTCCSS--EEEEEEECTTSCEEEEEEETTCCGG---GGTCEEEE
T ss_pred             CCCCCC-----HHHHHHHHHHHCCHHHHHHHHHHHHHCCCCC--EEEEEEECCCCCEEEEECCCCCCCC---CCCCEEEE
T ss_conf             979987-----8999999988289999999999864254342--5999997168867987403668865---33887788


Q ss_pred             CHHHEEEEECCCCC
Q ss_conf             46454531027642
Q 537021.9.peg.1  106 DPNMLEFLWLRTIH  119 (162)
Q Consensus       106 D~~~~~~~~Lr~~~  119 (162)
                      -.|.|+.+|...++
T Consensus        71 ~lDvWEHAYylDY~   84 (114)
T d1dt0a2          71 TCDVWEHAYYIDYR   84 (114)
T ss_dssp             EEECSGGGTHHHHT
T ss_pred             EEECCEECCHHHHH
T ss_conf             75224001376550


No 6  
>d3ehwa1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
Probab=7.02  E-value=62  Score=11.35  Aligned_cols=17  Identities=29%  Similarity=0.389  Sum_probs=7.9

Q ss_pred             EEEEEEECCC-EEEEEEE
Q ss_conf             5678997184-2679982
Q 537021.9.peg.1   72 ATADIYDRPF-GKVMVHP   88 (162)
Q Consensus        72 ~svd~y~sdf-G~v~ivp   88 (162)
                      ++..++.+|| |++.+..
T Consensus        73 ~~~GvID~dYrGei~v~l   90 (136)
T d3ehwa1          73 VGAGVIDEDYRGNVGVVL   90 (136)
T ss_dssp             EECCEECTTBCSCCEEEE
T ss_pred             ECCEEECCCCCCEEEEEE
T ss_conf             078797488873299999


No 7  
>d1te7a_ b.122.1.7 (A:) Hypothetical protein YqfB {Escherichia coli [TaxId: 562]}
Probab=6.87  E-value=63  Score=11.30  Aligned_cols=13  Identities=0%  Similarity=-0.066  Sum_probs=5.2

Q ss_pred             EEEECHHHEEEEE
Q ss_conf             9998464545310
Q 537021.9.peg.1  102 AFLIDPNMLEFLW  114 (162)
Q Consensus       102 ~~ilD~~~~~~~~  114 (162)
                      -+++|-+-+++.+
T Consensus        48 ~~fc~I~IlsV~p   60 (103)
T d1te7a_          48 GYFCTIEVTATST   60 (103)
T ss_dssp             EEEEEEEEEEEEE
T ss_pred             CEEEEEEEEEEEE
T ss_conf             8899999999856


No 8  
>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]}
Probab=6.40  E-value=47  Score=12.05  Aligned_cols=14  Identities=14%  Similarity=0.517  Sum_probs=4.8

Q ss_pred             EEEEECCC-EEEEEE
Q ss_conf             78997184-267998
Q 537021.9.peg.1   74 ADIYDRPF-GKVMVH   87 (162)
Q Consensus        74 vd~y~sdf-G~v~iv   87 (162)
                      +-++.+|| |++.+.
T Consensus       105 ~GIIDsgYrGei~v~  119 (159)
T d1vyqa1         105 IGLIDAGYRGEIIAA  119 (159)
T ss_dssp             SEEECTTCCSEEEEE
T ss_pred             CCCCCCCCCCEEEEE
T ss_conf             766797666369999


No 9  
>d1vlba3 d.41.1.1 (A:194-310) Aldehyde oxidoreductase, domain 3 {Desulfovibrio gigas [TaxId: 879]}
Probab=5.97  E-value=70  Score=11.01  Aligned_cols=11  Identities=18%  Similarity=0.166  Sum_probs=3.8

Q ss_pred             EEEEEEECCCC
Q ss_conf             26799825656
Q 537021.9.peg.1   82 GKVMVHPNRVM   92 (162)
Q Consensus        82 G~v~ivpnr~~   92 (162)
                      |-+.|+-...+
T Consensus        42 GV~~V~T~~Di   52 (117)
T d1vlba3          42 GVHSVITHKDV   52 (117)
T ss_dssp             TEEEEECGGGC
T ss_pred             CCEEEEEHHHC
T ss_conf             20578676456


No 10 
>d1ayia_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
Probab=5.68  E-value=73  Score=10.90  Aligned_cols=23  Identities=4%  Similarity=0.076  Sum_probs=18.4

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             53178999999999997699834
Q 537021.9.peg.1   11 RTFSKQILDEVMQEGYQNGDNFR   33 (162)
Q Consensus        11 ~~lTE~~l~~~lq~i~~~GG~~~   33 (162)
                      ...||+.|.+.+..+|.+...+.
T Consensus         8 sDYTE~EFl~fl~~i~~~~~~~~   30 (86)
T d1ayia_           8 SDYTEAEFVQLLKEIEKENVAAT   30 (86)
T ss_dssp             GGCCHHHHHHHHHHHHHHHTSSS
T ss_pred             HHCCHHHHHHHHHHHHHCCCCCC
T ss_conf             14279999999999996568850


Done!