BLAST/PSIBLAST alignment of GI: peg_1073 and GI: 227821704 at iteration 1
>gi|227821704|ref|YP_002825674.1| putative phage related protein [Sinorhizobium fredii NGR234] Length = 123
>gi|227340703|gb|ACP24921.1| putative phage related protein [Sinorhizobium fredii NGR234] Length = 123
 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 86/111 (77%)

Query: 25  GYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKV 84
           GYQNG NFRH+  SPYVKS FV FMSDSNVA FRYA S     NTIVATAD Y+ PFG V
Sbjct: 6   GYQNGANFRHVSASPYVKSVFVTFMSDSNVAPFRYAVSKGGERNTIVATADYYEGPFGTV 65

Query: 85  MVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHEDKNIAKNGDANKGVL 135
           M+HPNRV A+ A  ARNAF ID +ML FLWLR I EDK++AK GDA+KGV+
Sbjct: 66  MIHPNRVQATGATQARNAFFIDTDMLSFLWLRKIQEDKDVAKTGDADKGVI 116