BLAST/PSIBLAST alignment of GI: peg_1073 and GI: 283856246 at iteration 1
>gi|283856246|ref|YP_162122.2| putative phage major head protein [Zymomonas mobilis subsp. mobilis ZM4] Length = 304
>gi|283775241|gb|AAV89011.2| putative phage major head protein [Zymomonas mobilis subsp. mobilis ZM4] Length = 304
 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 74/154 (48%), Gaps = 11/154 (7%)

Query: 2   TKKAKDGTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYAT 61
           T  A  G  R +++ +L EV+ + + +G     +I S  +K     F     +AS R  T
Sbjct: 159 TTAATTGKARLYTEALLKEVLGDIWVSGGQPNMVITSLKLKQTAAAF---PGLASNRRDT 215

Query: 62  SGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPNMLEFLWLRTIHED 121
             +     I+A ADIY    G+V   P+R   +++     A +IDP       L  I + 
Sbjct: 216 GDQKAR--IIAGADIYVSDVGEVQFVPDRFCDNSS-----ALVIDPEYWSVATLDPIQK- 267

Query: 122 KNIAKNGDANKGVLIGEGALKVRNEKAVGVVADL 155
           +++A  G A++  L  E AL+  NE A GV+ADL
Sbjct: 268 RSLATTGLADRDALYTEIALRCHNEAASGVLADL 301