RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= 537021.9.peg.1073_1 (162 letters) >2czl_A Hypothetical protein TTHA1568; conserved hypothetical protein, extremely thermophilic bacteria, structural genomics, NPPSFA; HET: CME TLA XPE; 1.55A {Thermus thermophilus HB8} (A:81-171) Length = 91 Score = 29.7 bits (67), Expect = 0.21 Identities = 10/60 (16%), Positives = 17/60 (28%), Gaps = 6/60 (10%) Query: 98 TARNAFLIDPNMLEFLWLRTI--HEDKNIAKNGDANKGVLIGEGALKVRNEKAVGVVADL 155 TA + + + + G+ G++I E V V DL Sbjct: 27 TAYFLLSL---YAQGFVPVEVRYDRILPMVAQGEVEAGLIIHESRFTYPRYGLV-QVVDL 82 >2nxo_A Hypothetical protein SCO4506; PFAM, DUF178, NYSGXRC, 10093F, PSI-2, structural genomics, protein structure initiative; 2.04A {Streptomyces coelicolor} (A:85-182) Length = 98 Score = 25.8 bits (57), Expect = 3.3 Identities = 10/31 (32%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Query: 128 GDANKGVLIGEGALKVRNEKAVG---VVADL 155 +A+ VLIG+ AL+ V DL Sbjct: 59 QEADAAVLIGDAALRANMIDGPRYGLDVHDL 89 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.132 0.374 Gapped Lambda K H 0.267 0.0628 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,151,125 Number of extensions: 47172 Number of successful extensions: 119 Number of sequences better than 10.0: 1 Number of HSP's gapped: 119 Number of HSP's successfully gapped: 16 Length of query: 162 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 80 Effective length of database: 2,184,039 Effective search space: 174723120 Effective search space used: 174723120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.6 bits)