RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= 537021.9.peg.1073_1
         (162 letters)



>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
            acid synthase, acyl-carrier-protein, beta-ketoacyl
            reductase, beta-ketoacyl synthase, dehydratase; 4.00A
            {Saccharomyces cerevisiae}
          Length = 1688

 Score = 30.6 bits (68), Expect = 0.17
 Identities = 21/97 (21%), Positives = 40/97 (41%), Gaps = 28/97 (28%)

Query: 16   QILDEVMQEGYQNGDN-------FRHIIV-SPYVKSEFVRFMSDSNVASFRYATSGKSHN 67
            QIL+  +  G +N DN       F +++  S  +K++ VR +S   + SF +   G    
Sbjct: 1399 QILNSGIIPGNRNADNVDKILEQFEYVLYPSKTLKTDGVRAVS---ITSFGFGQKGGQ-- 1453

Query: 68   NTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFL 104
                            ++VHP+ +  +  E   N ++
Sbjct: 1454 ---------------AIVVHPDYLYGAITEDRYNEYV 1475


>1dx4_A Acetylcholinesterase; hydrolase (serine esterase), hydrolase,
           serine esterase, synapse, membrane, nerve, muscle,
           signal; HET: NAG MAN BMA 760; 2.70A {Drosophila
           melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A*
          Length = 585

 Score = 30.0 bits (66), Expect = 0.26
 Identities = 24/94 (25%), Positives = 31/94 (32%), Gaps = 7/94 (7%)

Query: 48  FMSDSNVASFRYATSGKSHNNTIVATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDP 107
           FM+ S       A    +  N IVA+       FG + + P        E   N  L D 
Sbjct: 152 FMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWD- 210

Query: 108 NMLEFLWLRTIHEDKNIAK-NGDANKGVLIGEGA 140
             L   WL+      N     G+     L GE A
Sbjct: 211 QALAIRWLK-----DNAHAFGGNPEWMTLFGESA 239


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
            acyl-carrier-protein, beta-ketoacyl reductase,
            beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces
            cerevisiae}
          Length = 2006

 Score = 26.4 bits (58), Expect = 3.1
 Identities = 9/36 (25%), Positives = 18/36 (50%), Gaps = 10/36 (27%)

Query: 81   FGKVMVHPNRVMASNAETA----------RNAFLID 106
            +G + ++P RV AS ++ A          R  +L++
Sbjct: 1807 YGMIAINPGRVAASFSQEALQYVVERVGKRTGWLVE 1842



 Score = 26.1 bits (57), Expect = 3.9
 Identities = 9/36 (25%), Positives = 14/36 (38%), Gaps = 17/36 (47%)

Query: 1   MTKKAKDGT-QRTFSKQIL---------DEVMQEGY 26
           +T + KDGT  R     I+         D+    G+
Sbjct: 515 LTHRNKDGTGVRV----IVAGTLDINPDDDY---GF 543


>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer,
           seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora
           crassa} SCOP: b.69.10.1
          Length = 365

 Score = 26.3 bits (57), Expect = 3.8
 Identities = 10/101 (9%), Positives = 22/101 (21%), Gaps = 21/101 (20%)

Query: 29  GDNFRHIIVSPYVKSEFVRFMSDSNVASFRYATSGKSHNNTI------------------ 70
           GD+ R + + P     +    + + +  +    +      T                   
Sbjct: 192 GDHPRWVAMHPTGNYLYALMEAGNRICEYVIDPATHMPVYTHHSFPLIPPGIPDRDPETG 251

Query: 71  ---VATADIYDRPFGKVMVHPNRVMASNAETARNAFLIDPN 108
                         GK M   +R      +     F +   
Sbjct: 252 KGLYRADVCALTFSGKYMFASSRANKFELQGYIAGFKLRDC 292


>3kt7_A PKHD-type hydroxylase TPA1; double-stranded beta helix fold,
          dioxygenase, iron, mRNP complex, prolyl hydroxylase;
          HET: AKG; 1.77A {Saccharomyces cerevisiae} PDB: 3kt1_A
          3kt4_A
          Length = 633

 Score = 25.5 bits (55), Expect = 5.5
 Identities = 6/46 (13%), Positives = 20/46 (43%), Gaps = 4/46 (8%)

Query: 6  KDGTQRTFSKQILDEV----MQEGYQNGDNFRHIIVSPYVKSEFVR 47
          +D  +  F+ +I D+     +++  ++   +    +   V  + +R
Sbjct: 4  EDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLR 49


>3nzt_A Glutamate--cysteine ligase; structural genomics, center for
           structural genomics of infec diseases, csgid, alpha and
           beta proteins; HET: AMP; 2.00A {Francisella tularensis
           subsp}
          Length = 525

 Score = 25.4 bits (55), Expect = 7.1
 Identities = 11/61 (18%), Positives = 21/61 (34%), Gaps = 10/61 (16%)

Query: 1   MTKKAKDGTQRTFSKQILDEVMQEGY---------QNGDNFRHIIVSPYVKSEFVRFMSD 51
             +K  D   +T S +I++   Q GY         +    FR   +   + ++       
Sbjct: 436 QKRKVLD-ISQTPSAKIIELARQHGYKKFILDISRRVSQQFRSYELPAAIVAKLKDQAGQ 494

Query: 52  S 52
           S
Sbjct: 495 S 495


>1vko_A Inositol-3-phosphate synthase; CE21227, structural genomics, JCSG,
           protein structure initiative, PSI; HET: NAD; 2.30A
           {Caenorhabditis elegans} SCOP: c.2.1.3 d.81.1.3
          Length = 537

 Score = 24.8 bits (54), Expect = 9.9
 Identities = 14/80 (17%), Positives = 29/80 (36%), Gaps = 7/80 (8%)

Query: 2   TKKAKDGTQRTFSKQILDEVMQEGYQNGDNFRHIIVSPYVKSEFVRFMSDSNVASFRYAT 61
             ++K+ ++ +    ++    Q  + +  N  + +V  Y     V +++DS  A   Y  
Sbjct: 369 QFRSKEISKSSVVDDMVKSN-QILFPDAKNPDYCVVIKY-----VPYVADSKRAMDEYIC 422

Query: 62  SGKSH-NNTIVATADIYDRP 80
           S       T V      D  
Sbjct: 423 SIFMGGKQTFVVHNTCEDSL 442


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.317    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0541    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 1,312,656
Number of extensions: 55671
Number of successful extensions: 180
Number of sequences better than 10.0: 1
Number of HSP's gapped: 180
Number of HSP's successfully gapped: 15
Length of query: 162
Length of database: 5,693,230
Length adjustment: 85
Effective length of query: 77
Effective length of database: 3,632,490
Effective search space: 279701730
Effective search space used: 279701730
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (24.6 bits)