RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= 537021.9.peg.1074_1 (169 letters) >3h2z_A Mannitol-1-phosphate 5-dehydrogenase; PSI-2, protein structure initiative, structural genomics; 1.90A {Shigella flexneri 2a str} (A:1-204) Length = 204 Score = 29.4 bits (66), Expect = 0.25 Identities = 12/49 (24%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Query: 21 SDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEGDEY 69 V RI P + + T + EW+VD G + G E Sbjct: 154 DSAVDRIVPPSASATNDPLEVTVETFS-EWIVDKTQFKGALPNIPGXEL 201 >2c2n_A Malonyl COA-acyl carrier protein transacylase; mitochondrial, malonyltrasferase, fatty acid synthase alternative splicing, lipid synthesis; HET: AE4; 1.55A {Homo sapiens} (A:153-234) Length = 82 Score = 26.4 bits (58), Expect = 2.3 Identities = 8/78 (10%), Positives = 20/78 (25%), Gaps = 13/78 (16%) Query: 49 EWVVDDLASPGPNAQLEGDEYSFKTINTPERMGNYTQIMRKSWILSGTQEAVDDVGYILK 108 + + + +E P ++SG QEA+ + Sbjct: 17 NFACLEAREHCKSLGIENPVCEVSNYLFP-----------DCRVISGHQEALRFLQKNS- 64 Query: 109 YKEQKLKKALEIRKDVEF 126 + ++ + F Sbjct: 65 -SKFHFRRTRMLPVSGAF 81 >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} (A:79-134,A:247-288,A:346-417) Length = 170 Score = 25.8 bits (56), Expect = 3.0 Identities = 8/45 (17%), Positives = 17/45 (37%), Gaps = 10/45 (22%) Query: 63 QLEGDEYS-----FKTINTPERMGNYTQIMRKSWILSGTQEAVDD 102 ++G + F ++ TP ++M + W + AV Sbjct: 8 GMDGSAHIHRKMLFLSLMTPPHQKRLAELMTEEW-----KAAVTR 47 >2wmm_A Chromosome partition protein MUKB; cell division, DNA condensation, nucleotide-binding, cell cycle, coiled coil, ATP-binding, DNA-binding, SMC; 2.30A {Escherichia coli} (A:28-134) Length = 107 Score = 25.9 bits (57), Expect = 3.2 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Query: 20 LSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEG 66 LS++ ++ ED P +S + + H+I VV DL+ LEG Sbjct: 17 LSEIYDDVSLEDAPYFSALYGPSRHAI----VVPDLS--QVTEHLEG 57 >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, cohesin, chromosome segregation, hinge; 3.10A {Escherichia coli k-12} (A:107-215) Length = 109 Score = 25.9 bits (57), Expect = 3.3 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Query: 20 LSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVDDLASPGPNAQLEG 66 LS++ ++ ED P +S + + H+I VV DL+ LEG Sbjct: 19 LSEIYDDVSLEDAPYFSALYGPSRHAI----VVPDLS--QVTEHLEG 59 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:234-256,A:435-732) Length = 321 Score = 25.7 bits (55), Expect = 3.5 Identities = 7/41 (17%), Positives = 9/41 (21%) Query: 42 TTHSIHPEWVVDDLASPGPNAQLEGDEYSFKTINTPERMGN 82 T W N EG E + + M Sbjct: 253 TVCGAIIGWTRGTGLMSANNIIAEGIEKMGVRTFSQKEMAF 293 >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} (C:145-264) Length = 120 Score = 25.4 bits (55), Expect = 3.8 Identities = 6/46 (13%), Positives = 10/46 (21%) Query: 8 FITSSSTTNKESLSDVVSRITPEDTPIYSMIKKGTTHSIHPEWVVD 53 I + ++ S + PEWV Sbjct: 57 IIIPYTDPILRKDCMNEVHEKIKEQIKASDTIPKIARVVAPEWVDH 102 >3ezo_A Malonyl COA-acyl carrier protein transacylase; ssgcid, acyl-carrier-protein S-malonyltransferase, acyltransferase, transferase; 2.05A {Burkholderia pseudomallei 1710B} (A:133-206) Length = 74 Score = 25.1 bits (55), Expect = 4.7 Identities = 9/37 (24%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Query: 90 SWILSGTQEAVDDVGYILKYKEQKLKKALEIRKDVEF 126 +++GT+ ++ I KE+ K+AL + F Sbjct: 40 QVVIAGTKAGIEKACEIA--KEKGAKRALPLPVSAPF 74 >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.30A {Pseudomonas syringae PV} (A:) Length = 228 Score = 25.4 bits (56), Expect = 4.9 Identities = 7/11 (63%), Positives = 8/11 (72%) Query: 18 ESLSDVVSRIT 28 ESL+D V IT Sbjct: 130 ESLNDQVRGIT 140 >2h1y_A Malonyl coenzyme A-acyl carrier protein transacylase; FABD, MCAT, transferase; 2.50A {Helicobacter pylori SS1} (A:140-210,A:261-272) Length = 83 Score = 25.2 bits (55), Expect = 5.0 Identities = 7/37 (18%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Query: 90 SWILSGTQEAVDDVGYILKYKEQKLKKALEIRKDVEF 126 +L+G ++ + + L KE K+ + + V Sbjct: 36 QVVLAGVKDDLKALEPTL--KEMGAKRVVFLEMSVAS 70 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.310 0.126 0.351 Gapped Lambda K H 0.267 0.0638 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,208,743 Number of extensions: 50402 Number of successful extensions: 148 Number of sequences better than 10.0: 1 Number of HSP's gapped: 148 Number of HSP's successfully gapped: 14 Length of query: 169 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 87 Effective length of database: 2,184,039 Effective search space: 190011393 Effective search space used: 190011393 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 51 (23.6 bits)