RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= 537021.9.peg.1078_1
         (62 letters)



>gnl|CDD|129586 TIGR00495, crvDNA_42K, 42K curved DNA binding protein.  Proteins
           identified by this model have been identified in a
           number of species as a nuclear (but not nucleolar)
           protein with a cell cycle dependence. Various names
           given to members of this family have included cell cycle
           protein p38-2G4, DNA-binding protein GBP16, and
           proliferation-associated protein 1. This protein is
           closely related to methionine aminopeptidase, a
           cobolt-binding protein.
          Length = 389

 Score = 25.6 bits (56), Expect = 3.1
 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 21  EGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYT 57
           E  V   K D+I A+  A    +  + KPG ++ + T
Sbjct: 133 EEPVTGRKADVIAAAHLAAEAALRLV-KPGNTNTQVT 168


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.324    0.138    0.447 

Gapped
Lambda     K      H
   0.267   0.0637    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 1,031,462
Number of extensions: 45270
Number of successful extensions: 105
Number of sequences better than 10.0: 1
Number of HSP's gapped: 105
Number of HSP's successfully gapped: 7
Length of query: 62
Length of database: 5,994,473
Length adjustment: 34
Effective length of query: 28
Effective length of database: 5,259,801
Effective search space: 147274428
Effective search space used: 147274428
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.2 bits)