RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.1078_1 (62 letters) >gnl|CDD|129586 TIGR00495, crvDNA_42K, 42K curved DNA binding protein. Proteins identified by this model have been identified in a number of species as a nuclear (but not nucleolar) protein with a cell cycle dependence. Various names given to members of this family have included cell cycle protein p38-2G4, DNA-binding protein GBP16, and proliferation-associated protein 1. This protein is closely related to methionine aminopeptidase, a cobolt-binding protein. Length = 389 Score = 25.6 bits (56), Expect = 3.1 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Query: 21 EGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYT 57 E V K D+I A+ A + + KPG ++ + T Sbjct: 133 EEPVTGRKADVIAAAHLAAEAALRLV-KPGNTNTQVT 168 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.324 0.138 0.447 Gapped Lambda K H 0.267 0.0637 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,031,462 Number of extensions: 45270 Number of successful extensions: 105 Number of sequences better than 10.0: 1 Number of HSP's gapped: 105 Number of HSP's successfully gapped: 7 Length of query: 62 Length of database: 5,994,473 Length adjustment: 34 Effective length of query: 28 Effective length of database: 5,259,801 Effective search space: 147274428 Effective search space used: 147274428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.2 bits)