HHsearch alignment for GI: peg_1079 and conserved domain: TIGR01547

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family; InterPro: IPR006437 This group of sequences represent a highly divergent family of the large subunit of phage terminase. All members are encoded by phage genomes or within prophage regions of bacterial genomes. This is a distinct family from the phage terminase family represented by IPR005021 from INTERPRO.; GO: 0006323 DNA packaging.
Probab=99.67  E-value=3.4e-16  Score=106.78  Aligned_cols=229  Identities=15%  Similarity=0.148  Sum_probs=149.1

Q ss_pred             CCEEEEECC--CCHHHHHHHHHHHCCCCCE---EEEEECCCCCCCHHHHHHCCC---CCCCEE---------------EE
Q ss_conf             358998189--8974998863112475873---999924899987565564036---799759---------------99
Q 537021.9.peg.1   16 VHYVWFDEE--PPEDVYFEGLTRINATQGL---VTLTLTPLKGRSPIIEHYLSA---SSSDRQ---------------VI   72 (251)
Q Consensus        16 ~~~i~~DE~--~~~~~~~~~~~r~~~~~g~---i~~~~nP~~~~~~~~~~~~~~---~~~~~~---------------~~   72 (251)
T Consensus       120 ~~~~~~ee~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~nP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  199 (462)
T TIGR01547       120 LADLWFEEASELTKEDIKELIPRLREPGGKNKFIIFSSNPESPLHWVYKDFIENLGEDEFRICDKPPYEYGVVDKKLYIL  199 (462)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCHHHHHHHHCCCCCCHHHHCCCCHHHHHEEECEEEE
T ss_conf             56565554443014468888876405777506999840889855305666543047760122101101322000000256


Q ss_pred             EEEHHHCCCCC----HHHHHHHHHCC--CHHHHHHHHCCCCEE-------------ECCCEEECCCCEEECCCCCCCCCC
Q ss_conf             97713346688----99999998708--973564330051001-------------014300001203431565465674
Q 537021.9.peg.1   73 RMTINETPHYN----EQERKRIIDSY--PLHEREARTKGEPIL-------------GSGRIFPIVEEDIVINSLDIPEHW  133 (251)
Q Consensus        73 ~~t~~DNp~l~----~~~~~~~~~~~--~~~~~~~~~~G~~~~-------------~~g~v~~~~~~~~~~~~~~~~~~~  133 (251)
T Consensus       200 ~~~~~dn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  279 (462)
T TIGR01547       200 HSTYRDNPFLSGGDVEEYIQELEKLKDRDPALYRRILLGEWVSAADVWSLGLPVLTSEGILFKKLDVKAAYIKELPNDPS  279 (462)
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             74203465676115899999999863156134334442351012233220444434441112111002212343123210


Q ss_pred             EEEEEECCCCC--C-CCEEEEEEEECCCCE---E-EEEEEHHHCCCC-----HHHHHHHHHHCCCCCEEEECCCCCEECC
Q ss_conf             35752003774--8-719999999773998---9-999431025998-----7999999983324870897263001117
Q 537021.9.peg.1  134 VQIGGMDFGWH--H-PFAAGHLVWNRDSDV---I-YVVKNYRCREQT-----PIFHVAALKSWGKWLPWAWPHDGLQHDK  201 (251)
Q Consensus       134 ~~~~g~D~G~~--~-p~a~~~~~~~~~~~~---~-~i~de~~~~~~t-----~~~~~~~i~~~~~~~~~~~~~~~~~~~~  201 (251)
T Consensus       280 ~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~  353 (462)
T TIGR01547       280 DFVGGIDAGGVDGNSPSAYVLLGIEHGKKYYDGLEYLAEYYYSNALEQVKDAVLEYANELKQFVGVKEGI------YADN  353 (462)
T ss_pred             HHEEEECCCCCCCCCCEEEEEEEEECCCHHHHHHHHHHHEEECCCHHHHHHHHHHHHHHHHHHHHHHHHH------CCCC
T ss_conf             0013201476666530367887200000122211221010004630234554556555566566544321------0255


Q ss_pred             CCCCCHHHHHH------HCCC-EEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCEE
Q ss_conf             88888899999------7897-4776577777677758998999999860799078
Q 537021.9.peg.1  202 RSGEQLSAQYR------RQGM-KMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV  250 (251)
Q Consensus       202 ~~~~s~~e~~r------~~G~-~~~~~~~~~~kg~~sV~~GI~~l~~~~~~grl~V  250 (251)
T Consensus       354 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  409 (462)
T TIGR01547       354 GDLKTFSDFLRLWLPGLEHGYNYFDVGAKKAPGAKLAVLDGIEVFSDLLAEGKLKF  409 (462)
T ss_pred             CHHHHHHHHHHHHCCCHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             21455544443201111210463102210000111234556777787751010222