Query         537021.9.peg.1079_1
Match_columns 251
No_of_seqs    131 out of 760
Neff          9.0 
Searched_HMMs 33803
Date          Wed May 25 08:48:32 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_1079.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2wbn_A G2P, terminase large s  99.9 4.1E-24 1.2E-28  149.2   6.8  148   90-250     3-154 (212)
  2 >3cpe_A Terminase, DNA packagi  98.1 2.4E-06 7.2E-11   53.2   4.2  141  105-250     4-156 (209)
  3 >3c6a_A Terminase large subuni  97.6 0.00013 3.7E-09   43.9   5.9  119  127-250    53-179 (232)
  4 >3cpe_A Terminase, DNA packagi  96.7   0.029 8.5E-07   31.2  10.1  104    4-108   117-237 (238)
  5 >2o0j_A Terminase, DNA packagi  81.8     3.2 9.4E-05   20.2  10.2  104    5-109    99-219 (221)
  6 >2oca_A DAR protein, ATP-depen  78.2     4.1 0.00012   19.5   4.7   28  161-190   141-168 (202)
  7 >1rif_A DAR protein, DNA helic  72.4     6.1 0.00018   18.6   4.8   29  160-190   140-168 (195)
  8 >1wp9_A ATP-dependent RNA heli  48.5      17 0.00051   16.2   5.1   58  159-220   126-186 (196)
  9 >1gm5_A RECG; helicase, replic  47.5      13 0.00039   16.8   2.4   33   28-60     29-62  (203)
 10 >2jlq_A Serine protease subuni  46.4      18 0.00054   16.1   2.9   43   11-53    106-154 (237)
 11 >1uaa_A REP helicase, protein   43.3      19 0.00056   16.0   2.7   20   38-57     12-31  (195)
 12 >1yks_A Genome polyprotein [co  38.5      18 0.00054   16.0   2.0   43   11-53     95-143 (230)
 13 >2z83_A Helicase/nucleoside tr  36.1      27  0.0008   15.1   2.5   43   11-53    108-156 (240)
 14 >1pjr_A PCRA; DNA repair, DNA   33.6      30 0.00089   14.9   2.6   20   39-58     22-41  (200)
 15 >3h1t_A Type I site-specific r  23.6      46  0.0014   13.9   4.9   31   27-57     15-45  (192)
 16 >3dmq_A RNA polymerase-associa  22.2      50  0.0015   13.7   3.5   14   11-24    120-133 (302)
 17 >2vbc_A Dengue 4 NS3 FULL-leng  22.2      50  0.0015   13.7   1.9   42   12-53     99-146 (229)

No 1  
>>2wbn_A G2P, terminase large subunit; large terminase, nuclease, viral protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB: 2wc9_A (A:)
Probab=99.90  E-value=4.1e-24  Score=149.21  Aligned_cols=148  Identities=14%  Similarity=0.132  Sum_probs=121.2

Q ss_pred             HHHCCCHHHHHHHHCCCCE--EECCCEEECCCC-EEECCCCCCCCCCEEEEEECCCCC-CCCEEEEEEEECCCCEEEEEE
Q ss_conf             9870897356433005100--101430000120-343156546567435752003774-871999999977399899994
Q 537021.9.peg.1   90 IIDSYPLHEREARTKGEPI--LGSGRIFPIVEE-DIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVK  165 (251)
Q Consensus        90 ~~~~~~~~~~~~~~~G~~~--~~~g~v~~~~~~-~~~~~~~~~~~~~~~~~g~D~G~~-~p~a~~~~~~~~~~~~~~i~d  165 (251)
                      .++.++++.|+++++|+|.  .++|.||..|++ .|++.++++++.+++++|+|||++ +|+|++++++++.++.+|+++
T Consensus         3 a~k~~dp~~y~~~~~G~~~~~~~~g~vy~~~~~~~~~i~~~~~~~~~~~~~g~D~G~~~~p~a~~~~~~~~~~~~~~i~~   82 (212)
T 2wbn_A            3 SSHHHHHHSSGLVPRGSHXALGSGVVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAID   82 (212)
T ss_dssp             ------------------------CCSCTTEEECTTCSCHHHHHHCCCEEEEEECCBTTBCEEEEEEEEETTTTEEEEEE
T ss_pred             CCCCCCCCCCCCCCCCCEEEECCCEEECCCCEEECCCCCHHHHHCCCCEEEEEECCCCCCCCEEEEEEEECCCCEEEEEE
T ss_conf             65444333456012687477515425058756852678867852356369977048998885899999978899899998


Q ss_pred             EHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCEECCCCCCCHHHHHHHCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             31025998799999998332487089726300111788888899999789747765777776777589989999998607
Q 537021.9.peg.1  166 NYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRS  245 (251)
Q Consensus       166 e~~~~~~t~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~s~~e~~r~~G~~~~~~~~~~~kg~~sV~~GI~~l~~~~~~  245 (251)
                      |+|.+++++.++++.|+++++...      ....|++.++++.++++++|+++.++.   ++++++|.+||+.    |++
T Consensus        83 e~~~~~~~~~~~a~~l~~~~~~~~------~~~~D~A~~~~i~~l~~~~G~~~~~a~---k~~~~~i~~~~~~----l~~  149 (212)
T 2wbn_A           83 ELVDHKVSLKRTADFVRKNKYESA------RIIADSSEPRSIDALKLEHGINRIEGA---KKGPDSVEHGERW----LDE  149 (212)
T ss_dssp             EEEESSCCHHHHHHHHHHTTCTTS------CEEECTTCHHHHHHHHHTTCCTTEEEC---CSCGGGHHHHHHH----HHT
T ss_pred             EEEECCCCHHHHHHHHHHHCCCCC------CCCCCCCCCCHHHHHHHHCCCCEEECC---CCCCCHHHHHHHH----HHH
T ss_conf             602158899999999997456877------531458773258999986897653125---5587709999999----982


Q ss_pred             CCCEE
Q ss_conf             99078
Q 537021.9.peg.1  246 GRWKV  250 (251)
Q Consensus       246 grl~V  250 (251)
                      ++..+
T Consensus       150 ~~~~~  154 (212)
T 2wbn_A          150 LDAIV  154 (212)
T ss_dssp             SSEEE
T ss_pred             CCCEE
T ss_conf             78734


No 2  
>>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* (A:384-592)
Probab=98.13  E-value=2.4e-06  Score=53.19  Aligned_cols=141  Identities=8%  Similarity=-0.095  Sum_probs=88.4

Q ss_pred             CCCEEECCCEEECCCCEEE----CCCCCCCCCCEEEEEECCCC---CCCCEEEEEEEECCCCEEEEEEEHHHCCCCHHHH
Q ss_conf             5100101430000120343----15654656743575200377---4871999999977399899994310259987999
Q 537021.9.peg.1  105 GEPILGSGRIFPIVEEDIV----INSLDIPEHWVQIGGMDFGW---HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH  177 (251)
Q Consensus       105 G~~~~~~g~v~~~~~~~~~----~~~~~~~~~~~~~~g~D~G~---~~p~a~~~~~~~~~~~~~~i~de~~~~~~t~~~~  177 (251)
                      ++|...++.+++..+....    .....+++...++.|+|+..   +|.++++++..  .++.+|++..+...+.+....
T Consensus         4 ~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~A~g~~~D~ta~~v~~~--~~~~~~~~~~~~~~~~~~~~~   81 (209)
T 3cpe_A            4 TLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALHIIDV--TDDVWEQVGVLHSNTISHLIL   81 (209)
T ss_dssp             BSSCHHHHTTCCCCCCCCCSSSEEESSCCCTTCCEEEEEECCSSBTTBCEEEEEEEC--SSSSEEEEEEEEESSSCTTTH
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCEEEEEECCCCCCCCCEEEEEECC--CCCCEEEEEEEECCCCCHHHH
T ss_conf             056678887400222103478814556257888058885225557787426999325--787608999985588886889


Q ss_pred             HHHHHHCCCCCEEEECCCCCEECCCCCCCHHHHHHHCCCEE--E---ECCCCCCCCCCCHHHHHHHHHHHHCCCCCEE
Q ss_conf             99998332487089726300111788888899999789747--7---6577777677758998999999860799078
Q 537021.9.peg.1  178 VAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKM--L---PECATFDDGSNGVEAGISDMLDRMRSGRWKV  250 (251)
Q Consensus       178 ~~~i~~~~~~~~~~~~~~~~~~~~~~~~s~~e~~r~~G~~~--~---~~~~~~~kg~~sV~~GI~~l~~~~~~grl~V  250 (251)
                      ++.|.+.....+   +....+.+++.|..+++.+++.+...  .   .........+++.+..|..|..++++|++++
T Consensus        82 ~~~i~~~~~~~~---~~~i~iE~~~~G~~~~~~l~~~~~~~~~~~~~~~~i~~~~~~~~K~~ri~~l~~~~e~g~i~~  156 (209)
T 3cpe_A           82 PDIVMRYLVEYN---ECPVYIELNSTGVSVAKSLYMDLEYEGVICDSYTDLGMKQTKRTKAVGCSTLKDLIEKDKLII  156 (209)
T ss_dssp             HHHHHHHHHHTT---SCCEEEEESHHHHHHHHHHHTTSCCSCEECSSSSCSSEECCHHHHHHHHHHHHHHHHTTSEEC
T ss_pred             HHHHHHHHHHCC---CCEEEEEECCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             999999999728---838999989859999999988745576046666777873785629999999999997498798


No 3  
>>3c6a_A Terminase large subunit; terminase nuclease, viral protein; 1.16A {Enterobacteria phage RB49} PDB: 3c6h_A (A:)
Probab=97.62  E-value=0.00013  Score=43.94  Aligned_cols=119  Identities=8%  Similarity=-0.071  Sum_probs=76.3

Q ss_pred             CCCCCCCEEEEEECCCC---CCCCEEEEEEEECCCCEEEEEEEHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCEECCCC
Q ss_conf             54656743575200377---487199999997739989999431025998799999998332487089726300111788
Q 537021.9.peg.1  127 LDIPEHWVQIGGMDFGW---HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRS  203 (251)
Q Consensus       127 ~~~~~~~~~~~g~D~G~---~~p~a~~~~~~~~~~~~~~i~de~~~~~~t~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~  203 (251)
                      ...++...+++|+|+..   +|.+|++++..+  ++.+|+++-+...+.+....++.+.+......   +....+.+++.
T Consensus        53 ~~~~~~~~~~~~~D~A~g~~~D~ta~~v~~~~--~~~~~~v~~~~~~~~~~~~~~~~i~~l~~~~~---~~~i~vE~~~~  127 (232)
T 3c6a_A           53 EKPKEGRKYVATLDCSEGRGQDYHALQIIDIT--EFPYKQVAVYHSNTTSHFILPDIVFKYLMMYN---ECPVYIELNST  127 (232)
T ss_dssp             SCCCTTCCEEEEEECCCSSSSCCEEEEEEECS--SSSEEEEEEEEESCCCTTTHHHHHHHHHHHTT---SCCEEEBCSHH
T ss_pred             ECCCCCCEEEEEEECCCCCCCCCCEEEEEEEC--CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC---CCEEEEEECCC
T ss_conf             25899984999997478768887889999924--88704899981457688899999999998715---66299996785


Q ss_pred             CCCHHHHHHHCCCEEE-----ECCCCCCCCCCCHHHHHHHHHHHHCCCCCEE
Q ss_conf             8888999997897477-----6577777677758998999999860799078
Q 537021.9.peg.1  204 GEQLSAQYRRQGMKML-----PECATFDDGSNGVEAGISDMLDRMRSGRWKV  250 (251)
Q Consensus       204 ~~s~~e~~r~~G~~~~-----~~~~~~~kg~~sV~~GI~~l~~~~~~grl~V  250 (251)
                      |..+++.+++......     .........+++.+..|..+..++++|++.+
T Consensus       128 g~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~K~~ri~~l~~~~e~g~i~i  179 (232)
T 3c6a_A          128 GVSIAKSLAMDLEYDNIICDSFIDLGMKQSKRSKAMGCSALKDLIEKDKLII  179 (232)
T ss_dssp             HHHHHHHHHHTSCCCCBCCSBTTBSSBCCCHHHHHHHHHHHHHHHHTTCEEC
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHHCCEEE
T ss_conf             8999999989753773256555566743342009999999999997185498


No 4  
>>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* (A:146-383)
Probab=96.69  E-value=0.029  Score=31.20  Aligned_cols=104  Identities=11%  Similarity=0.064  Sum_probs=67.4

Q ss_pred             CCCCHHHHCCCCCCEEEEECCCC---HHHHHHHHHH--HCCCCCEEEEEECCCCCCCHHHHHH--CCCCCCCEEEEEEEH
Q ss_conf             33696550333135899818989---7499886311--2475873999924899987565564--036799759999771
Q 537021.9.peg.1    4 YEQGRDKWQSNTVHYVWFDEEPP---EDVYFEGLTR--INATQGLVTLTLTPLKGRSPIIEHY--LSASSSDRQVIRMTI   76 (251)
Q Consensus         4 ~~q~~~~~~G~~~~~i~~DE~~~---~~~~~~~~~r--~~~~~g~i~~~~nP~~~~~~~~~~~--~~~~~~~~~~~~~t~   76 (251)
                      ..+.+..++|..++.+++||+..   ...+...+..  ...+...+.+++||... ..++..+  ..............+
T Consensus       117 ~~~~~~~~~~~~~~~vIiDE~h~~~~~~~~~~~~~~~~~~~~~~~~~l~sTp~~~-~~~~~~~~~~~~~~~~~~~~~~~~  195 (238)
T 3cpe_A          117 YASSPDAVRGNSFAMIYIEDCAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGL-NHFYDIWTAAVEGKSGFEPYTAIW  195 (238)
T ss_dssp             EECCHHHHHHSCCSEEEEETGGGCTTHHHHHHHHHHHHSSSSCCEEEEEECCCTT-SHHHHHHHHHHTTCSSCEEEEECG
T ss_pred             CCCCCCCCCCCCCCEEEEEEHHCCCHHHHHHHHCCCCCCCCCCCEEEEECCCCCC-CCHHHHHHHHHHCCCCCCCEECCC
T ss_conf             1688877667655405864122064056555310344436887269997899776-520688988742876567422442


Q ss_pred             HHCCCC----------CHHHHHHHHHCCCHHHHHHHHCCCCE
Q ss_conf             334668----------89999999870897356433005100
Q 537021.9.peg.1   77 NETPHY----------NEQERKRIIDSYPLHEREARTKGEPI  108 (251)
Q Consensus        77 ~DNp~l----------~~~~~~~~~~~~~~~~~~~~~~G~~~  108 (251)
                      .+.+..          ....++.....++++.++++++|.|.
T Consensus       196 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  237 (238)
T 3cpe_A          196 NSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAFE  237 (238)
T ss_dssp             GGSGGGGBCTTSBBCTTHHHHHHHHTTSCHHHHHHHHSCCCT
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHCCCCCCEEC
T ss_conf             336763455432100457899999845774442235441121


No 5  
>>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* (A:165-385)
Probab=81.84  E-value=3.2  Score=20.16  Aligned_cols=104  Identities=10%  Similarity=0.035  Sum_probs=63.9

Q ss_pred             CCCHHHHCCCCCCEEEEECCCC---HHHHHHH-HHH-HCCCCCEEEEEECCCCCCCHHHHHHC--CCCCCCEEEEEEEHH
Q ss_conf             3696550333135899818989---7499886-311-24758739999248999875655640--367997599997713
Q 537021.9.peg.1    5 EQGRDKWQSNTVHYVWFDEEPP---EDVYFEG-LTR-INATQGLVTLTLTPLKGRSPIIEHYL--SASSSDRQVIRMTIN   77 (251)
Q Consensus         5 ~q~~~~~~G~~~~~i~~DE~~~---~~~~~~~-~~r-~~~~~g~i~~~~nP~~~~~~~~~~~~--~~~~~~~~~~~~t~~   77 (251)
                      ...++.+.+..++.+++||+..   ...+... ... ...+..++.++++|... ..+++.+.  .....+...+...+.
T Consensus        99 ~~~~~~~~~~~~~~~~ide~~~~~~~~~~~~~~~~~~~~~~~~~~~l~sat~~~-~~~~~~~~~~~~~~~~~~~~~~~~~  177 (221)
T 2o0j_A           99 ASSPDAVRGNSFAMIYIEDCAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGL-NHFYDIWTAAVEGKSGFEPYTAIWN  177 (221)
T ss_dssp             ECSHHHHHTSCCSEEEEESGGGSTTHHHHHHHHHHHHHSTTCCEEEEEECCCSS-SHHHHHHHHHHTTCSSCEEEEECGG
T ss_pred             CCCCCCCCCCCCCCEEEEEEECCCCHHHHHHHCCCCCCCCCCCEEEEEECCCCC-CHHHHHHHHHHHCCCCCEEEEECCE
T ss_conf             232233333455623887411122123454421233124777149999799987-1399999999728887637862505


Q ss_pred             HCCC--------CC--HHHHHHHHHCCCHHHHHHHHCCCCEE
Q ss_conf             3466--------88--99999998708973564330051001
Q 537021.9.peg.1   78 ETPH--------YN--EQERKRIIDSYPLHEREARTKGEPIL  109 (251)
Q Consensus        78 DNp~--------l~--~~~~~~~~~~~~~~~~~~~~~G~~~~  109 (251)
                      .++.        +.  ...+++.....+...++++++++|..
T Consensus       178 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  219 (221)
T 2o0j_A          178 SVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAFEG  219 (221)
T ss_dssp             GSGGGGBCTTSBBCTTHHHHHHHHHTSCHHHHHHHHSCCCSS
T ss_pred             ECCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHCCEECC
T ss_conf             244512567888828899999987459999999986987078


No 6  
>>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} (A:88-289)
Probab=78.23  E-value=4.1  Score=19.54  Aligned_cols=28  Identities=4%  Similarity=-0.097  Sum_probs=13.1

Q ss_pred             EEEEEEHHHCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             999943102599879999999833248708
Q 537021.9.peg.1  161 IYVVKNYRCREQTPIFHVAALKSWGKWLPW  190 (251)
Q Consensus       161 ~~i~de~~~~~~t~~~~~~~i~~~~~~~~~  190 (251)
                      +.++||..  ......+.+.++........
T Consensus       141 ~iv~DEah--~~~~~~~~~~~~~~~~~~~~  168 (202)
T 2oca_A          141 MMMNDECH--LATGKSISSIISGLNNCMFK  168 (202)
T ss_dssp             EEEEETGG--GCCHHHHHHHGGGCTTCCEE
T ss_pred             CCEEECCC--CCCCCCHHHHHHHCCCCCCC
T ss_conf             20000001--12321010011210432100


No 7  
>>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} (A:88-282)
Probab=72.42  E-value=6.1  Score=18.63  Aligned_cols=29  Identities=3%  Similarity=-0.117  Sum_probs=13.3

Q ss_pred             EEEEEEEHHHCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             8999943102599879999999833248708
Q 537021.9.peg.1  160 VIYVVKNYRCREQTPIFHVAALKSWGKWLPW  190 (251)
Q Consensus       160 ~~~i~de~~~~~~t~~~~~~~i~~~~~~~~~  190 (251)
                      .+.|+||...  .....+...++........
T Consensus       140 ~~iIiDEah~--~~~~~~~~~~~~l~~~~~~  168 (195)
T 1rif_A          140 GMMMNDECHL--ATGKSISSIISGLNNCMFK  168 (195)
T ss_dssp             EEEEEETGGG--CCHHHHHHHTTTCTTCCEE
T ss_pred             CEEEEECCCC--CCCHHHHHHHHHCCCCCEE
T ss_conf             8999949856--7744099999854077869


No 8  
>>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombination, hydrolase; 2.90A {Pyrococcus furiosus dsm 3638} (A:1-196)
Probab=48.54  E-value=17  Score=16.19  Aligned_cols=58  Identities=14%  Similarity=0.033  Sum_probs=26.9

Q ss_pred             CEEEEEEEHHH-CCCC-HHHHHHHHHHCCCCCEEEECCCCCEECCCC-CCCHHHHHHHCCCEEEE
Q ss_conf             98999943102-5998-799999998332487089726300111788-88889999978974776
Q 537021.9.peg.1  159 DVIYVVKNYRC-REQT-PIFHVAALKSWGKWLPWAWPHDGLQHDKRS-GEQLSAQYRRQGMKMLP  220 (251)
Q Consensus       159 ~~~~i~de~~~-~~~t-~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~-~~s~~e~~r~~G~~~~~  220 (251)
                      -.+.|+||... .+.. .....+.++......+++.    ..+.... ...+.+.+...+...+.
T Consensus       126 ~~~iIiDEaH~~~~~~~~~~~~~~~~~~~~~~~~l~----lSATp~~~~~~~~~~~~~~~~~~i~  186 (196)
T 1wp9_A          126 VSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIG----LTASPGSTPEKIMEVINNLGIEHIE  186 (196)
T ss_dssp             CSEEEEETGGGCSTTCHHHHHHHHHHHHCSSCCEEE----EESCSCSSHHHHHHHHHHTTCCEEE
T ss_pred             CCCEEEEEHHHHCCCHHHHHHHHHHHHCCCCCEEEE----EECCCCCCHHHHHHHHHHCCCCCCC
T ss_conf             775288863330342168899999986576664898----8547753347899999744876320


No 9  
>>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} (A:347-549)
Probab=47.55  E-value=13  Score=16.83  Aligned_cols=33  Identities=9%  Similarity=-0.030  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHCCCCCE-EEEEECCCCCCCHHHHH
Q ss_conf             4998863112475873-99992489998756556
Q 537021.9.peg.1   28 DVYFEGLTRINATQGL-VTLTLTPLKGRSPIIEH   60 (251)
Q Consensus        28 ~~~~~~~~r~~~~~g~-i~~~~nP~~~~~~~~~~   60 (251)
                      .++..++........+ +.+.+-+..|-...+..
T Consensus        29 ~ai~~~l~g~~~~~~~~~l~~a~TGsGKT~~~~l   62 (203)
T 1gm5_A           29 RAHQEIRNDMISEKPMNRLLQGDVGSGKTVVAQL   62 (203)
T ss_dssp             HHHHHHHHHHHSSSCCCCEEECCSSSSHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCEEEEHH
T ss_conf             9999998777458876299980689867052284


No 10 
>>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase, transferase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A (A:1-156,A:315-395)
Probab=46.41  E-value=18  Score=16.06  Aligned_cols=43  Identities=16%  Similarity=0.043  Sum_probs=24.7

Q ss_pred             HCCCCCCEEEEECCCCH--H---HHHHHHHHHCCCCC-EEEEEECCCCC
Q ss_conf             03331358998189897--4---99886311247587-39999248999
Q 537021.9.peg.1   11 WQSNTVHYVWFDEEPPE--D---VYFEGLTRINATQG-LVTLTLTPLKG   53 (251)
Q Consensus        11 ~~G~~~~~i~~DE~~~~--~---~~~~~~~r~~~~~g-~i~~~~nP~~~   53 (251)
                      ..-..++.+.+||+...  .   ....+..+...++. .+.+|+||++.
T Consensus       106 ~~~~~~~lIIiDEaH~~~~~~~~~~~~i~~~~~~~~~~vI~lTATpp~~  154 (237)
T 2jlq_A          106 TRVPNYNLIVMDEAHFTDPCSVAARGYISTRVEMGEAAAIFMTATPPGS  154 (237)
T ss_dssp             SCCCCCSEEEEETTTCCSHHHHHHHHHHHHHHHTTSCEEEEECSSCTTC
T ss_pred             CCCCCCCEEEECCEECCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             7635555797233001460145554499984016776399973688754


No 11 
>>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} (A:1-102,A:185-277)
Probab=43.34  E-value=19  Score=15.95  Aligned_cols=20  Identities=10%  Similarity=0.149  Sum_probs=10.8

Q ss_pred             CCCCCEEEEEECCCCCCCHH
Q ss_conf             47587399992489998756
Q 537021.9.peg.1   38 NATQGLVTLTLTPLKGRSPI   57 (251)
Q Consensus        38 ~~~~g~i~~~~nP~~~~~~~   57 (251)
                      ....+.+.+..-|..|-..+
T Consensus        12 ~~~~~~~lV~g~~GsGKT~~   31 (195)
T 1uaa_A           12 EFVTGPCLVLAGAGSGKTRV   31 (195)
T ss_dssp             HCCSSEEEECCCTTSCHHHH
T ss_pred             CCCCCCEEEEEECCHHHHHH
T ss_conf             59998989998084479999


No 12 
>>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} (A:1-145,A:303-387)
Probab=38.49  E-value=18  Score=16.04  Aligned_cols=43  Identities=16%  Similarity=0.085  Sum_probs=25.2

Q ss_pred             HCCCCCCEEEEECCC--CHHHHH---HHHHHHCCCCC-EEEEEECCCCC
Q ss_conf             033313589981898--974998---86311247587-39999248999
Q 537021.9.peg.1   11 WQSNTVHYVWFDEEP--PEDVYF---EGLTRINATQG-LVTLTLTPLKG   53 (251)
Q Consensus        11 ~~G~~~~~i~~DE~~--~~~~~~---~~~~r~~~~~g-~i~~~~nP~~~   53 (251)
                      ..-..++.+.+||+.  ....+.   .+......... -+.+|+||++.
T Consensus        95 ~~~~~~~lIIiDEaH~~~~~s~~ar~~~~~~~~~~~~~vI~lTATPp~~  143 (230)
T 1yks_A           95 TRVVNWEVIIMDEAHFLDPASIAARGWAAHRARANESATILMTATPPGT  143 (230)
T ss_dssp             SCCCCCSEEEETTTTCCSHHHHHHHHHHHHHHHTTSCEEEEECSSCTTC
T ss_pred             CCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCC
T ss_conf             6514634798242002470033788999986437766199995765455


No 13 
>>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A (A:1-159,A:317-397)
Probab=36.07  E-value=27  Score=15.14  Aligned_cols=43  Identities=14%  Similarity=0.081  Sum_probs=23.1

Q ss_pred             HCCCCCCEEEEECCCCH---HHHHHHHH-HHC--CCCCEEEEEECCCCC
Q ss_conf             03331358998189897---49988631-124--758739999248999
Q 537021.9.peg.1   11 WQSNTVHYVWFDEEPPE---DVYFEGLT-RIN--ATQGLVTLTLTPLKG   53 (251)
Q Consensus        11 ~~G~~~~~i~~DE~~~~---~~~~~~~~-r~~--~~~g~i~~~~nP~~~   53 (251)
                      ..-..++.+.+||+...   +....... ...  ...-.+.+|+||++.
T Consensus       108 ~~~~~~~lIIiDEaH~~~~~s~~~r~~~~~~~~~~~~~~I~lTATP~~~  156 (240)
T 2z83_A          108 NRVPNYNLFVMDEAHFTDPASIAARGYIATKVELGEAAAIFMTATPPGT  156 (240)
T ss_dssp             C-CCCCSEEEESSTTCCSHHHHHHHHHHHHHHHTTSCEEEEECSSCTTC
T ss_pred             CCCCCEEEEEECHHHHHCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCE
T ss_conf             6635603999611344223426999999997358877199941698623


No 14 
>>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} (A:1-107,A:194-286)
Probab=33.65  E-value=30  Score=14.87  Aligned_cols=20  Identities=15%  Similarity=0.356  Sum_probs=11.0

Q ss_pred             CCCCEEEEEECCCCCCCHHH
Q ss_conf             75873999924899987565
Q 537021.9.peg.1   39 ATQGLVTLTLTPLKGRSPII   58 (251)
Q Consensus        39 ~~~g~i~~~~nP~~~~~~~~   58 (251)
                      ..++.+.+..-|..|-....
T Consensus        22 ~~~~~~~V~~~tGsGKT~~~   41 (200)
T 1pjr_A           22 TTEGPLLIMAGAGSGKTRVL   41 (200)
T ss_dssp             CCSSCEEEEECTTSCHHHHH
T ss_pred             CCCCCEEEEEECCHHHHHHH
T ss_conf             99989899983842799999


No 15 
>>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} (A:170-361)
Probab=23.61  E-value=46  Score=13.86  Aligned_cols=31  Identities=6%  Similarity=0.058  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCCHH
Q ss_conf             7499886311247587399992489998756
Q 537021.9.peg.1   27 EDVYFEGLTRINATQGLVTLTLTPLKGRSPI   57 (251)
Q Consensus        27 ~~~~~~~~~r~~~~~g~i~~~~nP~~~~~~~   57 (251)
                      .++.+.++.++....+...+...+..|-...
T Consensus        15 ~~ai~~~~~~~~~~~~~~il~~~tGsGKT~~   45 (192)
T 3h1t_A           15 QIAINRAVQSVLQGKKRSLITXATGTGKTVV   45 (192)
T ss_dssp             HHHHHHHHHHHHTTCSEEEEEECTTSCHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCEEECCCCCCHHHH
T ss_conf             9999999999874056442775789841589


No 16 
>>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} (A:150-424,A:686-712)
Probab=22.21  E-value=50  Score=13.71  Aligned_cols=14  Identities=14%  Similarity=0.053  Sum_probs=6.0

Q ss_pred             HCCCCCCEEEEECC
Q ss_conf             03331358998189
Q 537021.9.peg.1   11 WQSNTVHYVWFDEE   24 (251)
Q Consensus        11 ~~G~~~~~i~~DE~   24 (251)
                      +....++.+.+||+
T Consensus       120 ~~~~~~dliIiDEa  133 (302)
T 3dmq_A          120 LCEAEWDLLVVDEA  133 (302)
T ss_dssp             HHTSCCCEEEECCS
T ss_pred             HHCCCCCEEEEECC
T ss_conf             73489999999881


No 17 
>>2vbc_A Dengue 4 NS3 FULL-length protein; transmembrane, RNA replication, NS2B-NS3 protease; 3.15A {Dengue virus type 4} (A:176-323,A:482-562)
Probab=22.20  E-value=50  Score=13.70  Aligned_cols=42  Identities=14%  Similarity=0.145  Sum_probs=21.8

Q ss_pred             CCCCCCEEEEECCCC--HHH-HHHHHHH--HCCCC-CEEEEEECCCCC
Q ss_conf             333135899818989--749-9886311--24758-739999248999
Q 537021.9.peg.1   12 QSNTVHYVWFDEEPP--EDV-YFEGLTR--INATQ-GLVTLTLTPLKG   53 (251)
Q Consensus        12 ~G~~~~~i~~DE~~~--~~~-~~~~~~r--~~~~~-g~i~~~~nP~~~   53 (251)
                      .-..++.+.+||+..  .+. +...+..  ...++ .-+.+|+||++.
T Consensus        99 ~~~~~~lIIiDEaH~~~~~~~~~~~~~~~~~~~~~~~vI~mSATPp~~  146 (229)
T 2vbc_A           99 RVPNYNLIVMDEAHFTDPCSVAARGYISTRVEMGEAAAIFMTATPPGS  146 (229)
T ss_dssp             CCCCCSEEEEESTTCCSHHHHHHHHHHHHHHHHTSCEEEEECSSCTTC
T ss_pred             CCCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCC
T ss_conf             547986899918975582246678999973505673299960689864


Done!