HHsearch results for GI: peg_1079 and protein with PDBid: 3cpe_A

>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A*
Probab=99.63  E-value=1.4e-14  Score=96.94  Aligned_cols=240  Identities=11%  Similarity=0.059  Sum_probs=151.0

Q ss_pred             CCCHHHHCCCCCCEEEEECCC---C-HHHHHHHHHHHCC-CCCEEEEEECCCCCCCHHHHHHCCC--CCCCEEEEEEEHH
Q ss_conf             369655033313589981898---9-7499886311247-5873999924899987565564036--7997599997713
Q 537021.9.peg.1    5 EQGRDKWQSNTVHYVWFDEEP---P-EDVYFEGLTRINA-TQGLVTLTLTPLKGRSPIIEHYLSA--SSSDRQVIRMTIN   77 (251)
Q Consensus         5 ~q~~~~~~G~~~~~i~~DE~~---~-~~~~~~~~~r~~~-~~g~i~~~~nP~~~~~~~~~~~~~~--~~~~~~~~~~t~~   77 (251)
                      ..++++.||.+++.+++||+.   . .+.|..+.+.++. +.+++++++||.+ .++++..|...  ...+...+...|.
T Consensus       263 a~~~da~RG~s~~~l~lDE~Afi~~~~e~~~~~~~~l~~g~~~kiii~STpnG-~n~fy~~~~~a~~g~~~~~~~~~~w~  341 (592)
T 3cpe_A          263 ASSPDAVRGNSFAMIYIEDCAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNG-LNHFYDIWTAAVEGKSGFEPYTAIWN  341 (592)
T ss_dssp             ECCHHHHHHSCCSEEEEETGGGCTTHHHHHHHHHHHHSSSSCCEEEEEECCCT-TSHHHHHHHHHHTTCSSCEEEEECGG
T ss_pred             CCCCCCCCCCCCCCEEEEHHHHCCHHHHHHHHHCCCCCCCCCCEEEEECCCCC-CCCCHHHHHHHHHCCCCCCCEECCCC
T ss_conf             47886666776663275313204068888753023343688736999779988-76327899887407776674123434


Q ss_pred             HCCC--------CCH--HHHHHHHHCCCHHHHHHHHCCCCEEECCCEEECCCCEEEC-----------CC-CCCCCCCEE
Q ss_conf             3466--------889--9999998708973564330051001014300001203431-----------56-546567435
Q 537021.9.peg.1   78 ETPH--------YNE--QERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI-----------NS-LDIPEHWVQ  135 (251)
Q Consensus        78 DNp~--------l~~--~~~~~~~~~~~~~~~~~~~~G~~~~~~g~v~~~~~~~~~~-----------~~-~~~~~~~~~  135 (251)
                      +.|-        .++  .+.++.+...+...++++++++|...++.++....-....           .. ..+.+...+
T Consensus       342 ~~per~~~d~~~~~~~~~w~~e~i~~~s~~~F~QEy~~eF~~s~~~vf~~~~l~~~~~~~~~~~~~~~~iye~p~~~~~Y  421 (592)
T 3cpe_A          342 SVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKY  421 (592)
T ss_dssp             GSGGGGBCTTSBBCTTHHHHHHHHTTSCHHHHHHHHSCCCTTSCSBSSCHHHHTTCCCCCCCCCSSSEEESSCCCTTCCE
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCE
T ss_conf             57763355421000437999998745775553014343323454305677898762022220347781332446766602


Q ss_pred             EEEECCCC--C-CCCEEEEEEEECCCCEEEEEEEHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCEECCCCCCCHHHHHH
Q ss_conf             75200377--4-87199999997739989999431025998799999998332487089726300111788888899999
Q 537021.9.peg.1  136 IGGMDFGW--H-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYR  212 (251)
Q Consensus       136 ~~g~D~G~--~-~p~a~~~~~~~~~~~~~~i~de~~~~~~t~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~s~~e~~r  212 (251)
                      ++|+|.+.  . |.+++.++  +.......++.+++..+.+...+++.|.+.+......   -..+..++.|..+++.|+
T Consensus       422 vigvDvA~G~~~DySai~Vi--dv~~~~~eqVa~~~~n~i~~~~~a~~I~~l~~~YN~a---~V~VE~N~~G~~Vi~~L~  496 (592)
T 3cpe_A          422 IATLDCSEGRGQDYHALHII--DVTDDVWEQVGVLHSNTISHLILPDIVMRYLVEYNEC---PVYIELNSTGVSVAKSLY  496 (592)
T ss_dssp             EEEEECCSSBTTBCEEEEEE--ECSSSSEEEEEEEEESSSCTTTHHHHHHHHHHHTTSC---CEEEEESHHHHHHHHHHH
T ss_pred             EEEEECCCCCCCCCEEEEEE--CCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHCCCC---EEEEEECCCHHHHHHHHH
T ss_conf             68851244577773279994--1478761899998358889899999999999972884---899997984999999998


Q ss_pred             -HCCCEEEECCCCCC----CCCCCHHHHHHHHHHHHCCCCCEE
Q ss_conf             -78974776577777----677758998999999860799078
Q 537021.9.peg.1  213 -RQGMKMLPECATFD----DGSNGVEAGISDMLDRMRSGRWKV  250 (251)
Q Consensus       213 -~~G~~~~~~~~~~~----kg~~sV~~GI~~l~~~~~~grl~V  250 (251)
                       +.+..-........    ..+.+...+|..|+.+|++|++.|
T Consensus       497 ~dl~y~nl~~~~~~~~Gf~tT~ksK~~~is~Lk~liE~~~i~i  539 (592)
T 3cpe_A          497 MDLEYEGVICDSYTDLGMKQTKRTKAVGCSTLKDLIEKDKLII  539 (592)
T ss_dssp             TTSCCSCEECSSSSCSSEECCHHHHHHHHHHHHHHHHTTSEEC
T ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             8745575146776777875784559999999999997498698