BLAST/PSIBLAST alignment of GI: peg_1079 and GI: 150397042 at iteration 1
>gi|150397042|ref|YP_001327509.1| hypothetical protein Smed_1839 [Sinorhizobium medicae WSM419] Length = 477
>gi|150028557|gb|ABR60674.1| protein of unknown function DUF264 [Sinorhizobium medicae WSM419] Length = 477
 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/251 (70%), Positives = 201/251 (80%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            KAYEQGR KWQ+NTV YVWFDEEPPEDVYFEG+TR NAT+G + +T TPLKG S ++  
Sbjct: 169 FKAYEQGRAKWQANTVDYVWFDEEPPEDVYFEGITRTNATRGSIAVTFTPLKGLSAVVAR 228

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           YL   S+DR+V  MTI +  HY  +ER+RIIDSYP HEREARTKG P LGSGRIFP+ EE
Sbjct: 229 YLMEKSADREVTTMTIEDAEHYTPEERRRIIDSYPAHEREARTKGVPALGSGRIFPVTEE 288

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I  +  DIP+HWVQIGG+DFGW HPFAA    W+RD+DV YV K YR RE TPI H AA
Sbjct: 289 SIRADPFDIPKHWVQIGGLDFGWDHPFAAVGCAWDRDADVFYVTKLYRERESTPIIHAAA 348

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LK WG  LPWAWPHDGLQHDK SGEQL+AQYR QG+ +LPE ATFDDG+NGVEAG+SDML
Sbjct: 349 LKPWGGTLPWAWPHDGLQHDKGSGEQLAAQYRAQGLALLPERATFDDGTNGVEAGLSDML 408

Query: 241 DRMRSGRWKVF 251
            RM++GRWKVF
Sbjct: 409 QRMQTGRWKVF 419