BLAST/PSIBLAST alignment of GI: peg_1079 and GI: 227822449 at iteration 1
>gi|227822449|ref|YP_002826421.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] Length = 454
>gi|227341450|gb|ACP25668.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] Length = 454
 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/251 (69%), Positives = 201/251 (80%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            KAYEQGR KWQ+NTV YVWFDEEPPEDVYFEG+TR NAT+G + +T TPLKG S ++  
Sbjct: 146 FKAYEQGRGKWQANTVDYVWFDEEPPEDVYFEGITRTNATRGAIAVTFTPLKGLSNVVAR 205

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           YL   S DR+VI MTI +  HY  +ER+RII+SYP HEREARTKG P LGSGRIFP+ EE
Sbjct: 206 YLMEKSPDREVITMTIEDAEHYTPEERQRIIESYPAHEREARTKGVPALGSGRIFPVTEE 265

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I +   DIP+HWVQIGG+DFGW HPFAA    W+RD+DV YV + YR RE TPI H AA
Sbjct: 266 AIRVEPFDIPKHWVQIGGLDFGWDHPFAAVGCAWDRDADVFYVTRIYREREATPIIHAAA 325

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LK WG WLP+AWPHDGLQHDK SGEQL+AQYR QG+ +L E ATFDDG+NGVEAG+SDML
Sbjct: 326 LKPWGAWLPFAWPHDGLQHDKGSGEQLAAQYRAQGLPLLAERATFDDGTNGVEAGLSDML 385

Query: 241 DRMRSGRWKVF 251
            RM++GRWKVF
Sbjct: 386 QRMQTGRWKVF 396