BLAST/PSIBLAST alignment of GI: peg_1079 and GI: 71897556 at iteration 1
>gi|71897556|ref|ZP_00679801.1| Protein of unknown function DUF264 [Xylella fastidiosa Ann-1] Length = 471
>gi|71732459|gb|EAO34512.1| Protein of unknown function DUF264 [Xylella fastidiosa Ann-1] Length = 471
 Score =  341 bits (874), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 155/251 (61%), Positives = 196/251 (78%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           LK+++QGR+KWQ++TV +VWFDEEPPEDVYFEG+TR N T G V +T TPLKG S ++  
Sbjct: 163 LKSFDQGREKWQADTVDWVWFDEEPPEDVYFEGITRTNRTFGPVFMTFTPLKGMSSVVRR 222

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   + DR +++MTI++  HY+ ++R RII SYP HEREARTKG P LGSGR+FPI E+
Sbjct: 223 FLLEQAPDRGLVQMTIDDAEHYSPEDRARIIASYPAHEREARTKGTPSLGSGRVFPIAED 282

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I I    IPE W  IGGMDFG+ HPFAA  + W+R++DVIYV+  YR RE TP+ H AA
Sbjct: 283 SIAIAPFSIPEEWALIGGMDFGYDHPFAAVKMAWDREADVIYV