BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.1079_1
         (251 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|167041080|gb|ABZ05841.1| hypothetical protein ALOHA_HF400048F7ctg1g8 [uncultured marine
           microorganism HF4000_48F7]
          Length = 504

 Score =  226 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 99/251 (39%), Positives = 155/251 (61%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K+Y+ G   W    V YVW DEEPP+++Y + L     + G V+LT TP  G + ++  
Sbjct: 173 FKSYDAGPASWMGVAVDYVWLDEEPPQEIYSQALRATLKSGGPVSLTFTPEAGVTGVVAM 232

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L+     + +++ T ++ PH + + R+ I+ + P HER  R+KG P LGSG++FP+ E+
Sbjct: 233 FLNERKGGQALVQATWDDAPHLSLEVREEILAALPPHERLMRSKGIPTLGSGQVFPVPED 292

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I++++  IP+H+ +I G+DFG+ HP A   +  +RD+DV+Y+   YR +    + H  A
Sbjct: 293 QIMVSAFAIPDHFSRIAGIDFGFDHPTACVWMAHDRDTDVVYLYDAYREKGSGMLQHAEA 352

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +K  G ++P AWPHDG  HDK SGE L+ QYRR G+  L    T  +G   VE G+  +L
Sbjct: 353 IKHRGGFIPVAWPHDGSIHDKGSGEALATQYRRSGVNFLGSHFTNPEGGIAVEPGLMALL 412

Query: 241 DRMRSGRWKVF 251
            RM++GR+KVF
Sbjct: 413 TRMQTGRFKVF 423


>gi|307315429|ref|ZP_07594994.1| protein of unknown function DUF264 [Sinorhizobium meliloti BL225C]
 gi|306898808|gb|EFN29464.1| protein of unknown function DUF264 [Sinorhizobium meliloti BL225C]
          Length = 477

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 174/251 (69%), Positives = 201/251 (80%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            KAYEQGR KWQ+NTV YVWFDEEPPEDVYFEG+TR NAT+G + +T TPL+G S ++  
Sbjct: 169 FKAYEQGRAKWQANTVDYVWFDEEPPEDVYFEGITRTNATRGAIAVTFTPLRGLSAVVAR 228

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           YL   S DR VI MTI +  HY  QER+R+IDSYP HEREART+G P LGSGRIFP+ EE
Sbjct: 229 YLMEKSPDRAVITMTIEDAEHYTPQERQRVIDSYPAHEREARTRGVPALGSGRIFPVTEE 288

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I I+  +IP+HWVQIGG+DFGW HPFAA    W+RD+DV +V K YR RE TPI H AA
Sbjct: 289 SIRIDPFEIPKHWVQIGGLDFGWDHPFAAVGCAWDRDADVFHVTKIYREREATPIIHAAA 348

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LK WG  +PWAWPHDGLQHDK SGEQL+AQYR QG+ +LPE ATFDDG+NGVEAG+SDML
Sbjct: 349 LKPWGAAMPWAWPHDGLQHDKGSGEQLAAQYRAQGLALLPERATFDDGTNGVEAGLSDML 408

Query: 241 DRMRSGRWKVF 251
            RM+SGRWKVF
Sbjct: 409 QRMQSGRWKVF 419


>gi|15965769|ref|NP_386122.1| DNA packaging protein GP2 [Sinorhizobium meliloti 1021]
 gi|15075038|emb|CAC46595.1| DNA packaging protein GP2 [Sinorhizobium meliloti 1021]
          Length = 477

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 174/251 (69%), Positives = 201/251 (80%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            KAYEQGR KWQ+NTV YVWFDEEPPEDVYFEG+TR NAT+G + +T TPL+G S ++  
Sbjct: 169 FKAYEQGRAKWQANTVDYVWFDEEPPEDVYFEGITRTNATRGAIAVTFTPLRGLSAVVAR 228

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           YL   S DR VI MTI +  HY  QER+R+IDSYP HEREART+G P LGSGRIFP+ EE
Sbjct: 229 YLMEKSPDRAVITMTIEDAEHYTPQERQRVIDSYPAHEREARTRGVPALGSGRIFPVTEE 288

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I I+  +IP+HWVQIGG+DFGW HPFAA    W+RD+DV +V K YR RE TPI H AA
Sbjct: 289 SIRIDPFEIPKHWVQIGGLDFGWDHPFAAVGCAWDRDADVFHVTKIYREREATPIIHAAA 348

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LK WG  +PWAWPHDGLQHDK SGEQL+AQYR QG+ +LPE ATFDDG+NGVEAG+SDML
Sbjct: 349 LKPWGAAMPWAWPHDGLQHDKGSGEQLAAQYRAQGLALLPERATFDDGTNGVEAGLSDML 408

Query: 241 DRMRSGRWKVF 251
            RM+SGRWKVF
Sbjct: 409 QRMQSGRWKVF 419


>gi|307318836|ref|ZP_07598268.1| protein of unknown function DUF264 [Sinorhizobium meliloti AK83]
 gi|306895557|gb|EFN26311.1| protein of unknown function DUF264 [Sinorhizobium meliloti AK83]
          Length = 477

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 174/251 (69%), Positives = 201/251 (80%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            KAYEQGR KWQ+NTV YVWFDEEPPEDVYFEG+TR NAT+G + +T TPL+G S ++  
Sbjct: 169 FKAYEQGRAKWQANTVDYVWFDEEPPEDVYFEGITRTNATRGAIAVTFTPLRGLSAVVAR 228

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           YL   S DR VI MTI +  HY  QER+R+IDSYP HEREART+G P LGSGRIFP+ EE
Sbjct: 229 YLMEKSPDRAVITMTIEDAEHYTPQERQRVIDSYPAHEREARTRGVPALGSGRIFPVTEE 288

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I I+  +IP+HWVQIGG+DFGW HPFAA    W+RD+DV +V K YR RE TPI H AA
Sbjct: 289 SIRIDPFEIPKHWVQIGGLDFGWDHPFAAVGCAWDRDADVFHVTKIYREREATPIIHAAA 348

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LK WG  +PWAWPHDGLQHDK SGEQL+AQYR QG+ +LPE ATFDDG+NGVEAG+SDML
Sbjct: 349 LKPWGAAMPWAWPHDGLQHDKGSGEQLAAQYRAQGLALLPERATFDDGTNGVEAGLSDML 408

Query: 241 DRMRSGRWKVF 251
            RM+SGRWKVF
Sbjct: 409 QRMQSGRWKVF 419


>gi|150397042|ref|YP_001327509.1| hypothetical protein Smed_1839 [Sinorhizobium medicae WSM419]
 gi|150028557|gb|ABR60674.1| protein of unknown function DUF264 [Sinorhizobium medicae WSM419]
          Length = 477

 Score =  221 bits (563), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 176/251 (70%), Positives = 201/251 (80%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            KAYEQGR KWQ+NTV YVWFDEEPPEDVYFEG+TR NAT+G + +T TPLKG S ++  
Sbjct: 169 FKAYEQGRAKWQANTVDYVWFDEEPPEDVYFEGITRTNATRGSIAVTFTPLKGLSAVVAR 228

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           YL   S+DR+V  MTI +  HY  +ER+RIIDSYP HEREARTKG P LGSGRIFP+ EE
Sbjct: 229 YLMEKSADREVTTMTIEDAEHYTPEERRRIIDSYPAHEREARTKGVPALGSGRIFPVTEE 288

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I  +  DIP+HWVQIGG+DFGW HPFAA    W+RD+DV YV K YR RE TPI H AA
Sbjct: 289 SIRADPFDIPKHWVQIGGLDFGWDHPFAAVGCAWDRDADVFYVTKLYRERESTPIIHAAA 348

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LK WG  LPWAWPHDGLQHDK SGEQL+AQYR QG+ +LPE ATFDDG+NGVEAG+SDML
Sbjct: 349 LKPWGGTLPWAWPHDGLQHDKGSGEQLAAQYRAQGLALLPERATFDDGTNGVEAGLSDML 408

Query: 241 DRMRSGRWKVF 251
            RM++GRWKVF
Sbjct: 409 QRMQTGRWKVF 419


>gi|227821702|ref|YP_002825672.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234]
 gi|227340701|gb|ACP24919.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234]
          Length = 416

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 174/251 (69%), Positives = 201/251 (80%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            KAYEQGR KWQ+NTV YVWFDEEPPEDVYFEG+TR NAT+G + +T TPLKG S ++  
Sbjct: 108 FKAYEQGRGKWQANTVDYVWFDEEPPEDVYFEGITRTNATRGSIAVTFTPLKGMSTVVAR 167

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           Y+   S DR+VI MTI++  HY  +ER+RIIDSYP HEREARTKG P LGSGRIFP+ EE
Sbjct: 168 YILEKSPDREVITMTIDDAEHYTPEERQRIIDSYPAHEREARTKGVPSLGSGRIFPVAEE 227

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I I   +IP+HWVQIGG+DFGW HPF A    W+RD+DV YV K YR RE TPI H AA
Sbjct: 228 SITIAPFEIPKHWVQIGGLDFGWDHPFGAAGCAWDRDADVFYVTKVYREREATPIIHAAA 287

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LK WG WLPW+WPHDGLQHDK SGEQL+ QYR QG+ MLPE ATF+DG+NGVEAG+SDML
Sbjct: 288 LKPWGAWLPWSWPHDGLQHDKGSGEQLATQYRAQGLNMLPERATFEDGTNGVEAGLSDML 347

Query: 241 DRMRSGRWKVF 251
            RM++GRWKVF
Sbjct: 348 QRMQTGRWKVF 358


>gi|71274675|ref|ZP_00650963.1| Protein of unknown function DUF264 [Xylella fastidiosa Dixon]
 gi|71901596|ref|ZP_00683677.1| Protein of unknown function DUF264 [Xylella fastidiosa Ann-1]
 gi|170730087|ref|YP_001775520.1| putative DNA packaging protein GP2 [Xylella fastidiosa M12]
 gi|71164407|gb|EAO14121.1| Protein of unknown function DUF264 [Xylella fastidiosa Dixon]
 gi|71728644|gb|EAO30794.1| Protein of unknown function DUF264 [Xylella fastidiosa Ann-1]
 gi|167964880|gb|ACA11890.1| putative DNA packaging protein GP2 [Xylella fastidiosa M12]
          Length = 472

 Score =  220 bits (560), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 153/251 (60%), Positives = 197/251 (78%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           LK+++QGR+KWQ++TVH+VWFDEEPPEDVYFEG+TR N T G V +T TPLKG S ++  
Sbjct: 164 LKSFDQGREKWQADTVHWVWFDEEPPEDVYFEGITRTNRTFGPVFMTFTPLKGMSNVVRR 223

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L+  ++DR  ++M+I +  HY+ +E  RI  SYP HER+ART+G P LGSGR+FPI +E
Sbjct: 224 FLTEDAADRGYVQMSIEDAEHYSAEECARITASYPPHERDARTQGVPALGSGRVFPIAQE 283

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I +    IP  W  IGGMDFG+ HPFAA  L W+RD+D++YVV  YR RE TPI H AA
Sbjct: 284 EISVAPFAIPAQWALIGGMDFGYDHPFAAVKLAWDRDADILYVVCAYRKRESTPIIHAAA 343

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LK WG  LPWAWPHDGLQHDK SG+QL+ QYR+QG+ MLP+ ATF+DG+NG+EAG+++ML
Sbjct: 344 LKPWGVTLPWAWPHDGLQHDKGSGDQLAEQYRQQGLAMLPQRATFEDGTNGLEAGVTEML 403

Query: 241 DRMRSGRWKVF 251
           DRM +GR KVF
Sbjct: 404 DRMHTGRLKVF 414


>gi|227822449|ref|YP_002826421.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234]
 gi|227341450|gb|ACP25668.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234]
          Length = 454

 Score =  220 bits (560), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 174/251 (69%), Positives = 201/251 (80%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            KAYEQGR KWQ+NTV YVWFDEEPPEDVYFEG+TR NAT+G + +T TPLKG S ++  
Sbjct: 146 FKAYEQGRGKWQANTVDYVWFDEEPPEDVYFEGITRTNATRGAIAVTFTPLKGLSNVVAR 205

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           YL   S DR+VI MTI +  HY  +ER+RII+SYP HEREARTKG P LGSGRIFP+ EE
Sbjct: 206 YLMEKSPDREVITMTIEDAEHYTPEERQRIIESYPAHEREARTKGVPALGSGRIFPVTEE 265

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I +   DIP+HWVQIGG+DFGW HPFAA    W+RD+DV YV + YR RE TPI H AA
Sbjct: 266 AIRVEPFDIPKHWVQIGGLDFGWDHPFAAVGCAWDRDADVFYVTRIYREREATPIIHAAA 325

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LK WG WLP+AWPHDGLQHDK SGEQL+AQYR QG+ +L E ATFDDG+NGVEAG+SDML
Sbjct: 326 LKPWGAWLPFAWPHDGLQHDKGSGEQLAAQYRAQGLPLLAERATFDDGTNGVEAGLSDML 385

Query: 241 DRMRSGRWKVF 251
            RM++GRWKVF
Sbjct: 386 QRMQTGRWKVF 396


>gi|71897556|ref|ZP_00679801.1| Protein of unknown function DUF264 [Xylella fastidiosa Ann-1]
 gi|71732459|gb|EAO34512.1| Protein of unknown function DUF264 [Xylella fastidiosa Ann-1]
          Length = 471

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 155/251 (61%), Positives = 196/251 (78%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           LK+++QGR+KWQ++TV +VWFDEEPPEDVYFEG+TR N T G V +T TPLKG S ++  
Sbjct: 163 LKSFDQGREKWQADTVDWVWFDEEPPEDVYFEGITRTNRTFGPVFMTFTPLKGMSSVVRR 222

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   + DR +++MTI++  HY+ ++R RII SYP HEREARTKG P LGSGR+FPI E+
Sbjct: 223 FLLEQAPDRGLVQMTIDDAEHYSPEDRARIIASYPAHEREARTKGTPSLGSGRVFPIAED 282

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I I    IPE W  IGGMDFG+ HPFAA  + W+R++DVIYV+  YR RE TP+ H AA
Sbjct: 283 SIAIAPFSIPEEWALIGGMDFGYDHPFAAVKMAWDREADVIYVMCAYRQREATPVIHTAA 342

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           L+ WG  LPWAWPHDGLQHDK SGEQL+ QYR+QG+ ML + ATF DG+NG+EAG+++ML
Sbjct: 343 LRPWGAHLPWAWPHDGLQHDKGSGEQLAEQYRQQGLSMLGQRATFTDGTNGLEAGVTEML 402

Query: 241 DRMRSGRWKVF 251
           DRM +GR KVF
Sbjct: 403 DRMHTGRLKVF 413


>gi|273810450|ref|YP_003344921.1| TerL [Xylella phage Xfas53]
 gi|257097825|gb|ACV41131.1| TerL [Xylella phage Xfas53]
          Length = 470

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 155/251 (61%), Positives = 196/251 (78%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           LK+++QGR+KWQ++TV +VWFDEEPPEDVYFEG+TR N T G V +T TPLKG S ++  
Sbjct: 162 LKSFDQGREKWQADTVDWVWFDEEPPEDVYFEGITRTNRTFGPVFMTFTPLKGMSSVVRR 221

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   + DR +++MTI++  HY+ ++R RII SYP HEREARTKG P LGSGR+FPI E+
Sbjct: 222 FLLEQAPDRGLVQMTIDDAEHYSPEDRARIIASYPAHEREARTKGTPSLGSGRVFPIAED 281

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I I    IPE W  IGGMDFG+ HPFAA  + W+R++DVIYV+  YR RE TP+ H AA
Sbjct: 282 SIAIAPFSIPEEWALIGGMDFGYDHPFAAVKMAWDREADVIYVMCAYRQREATPVIHTAA 341

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           L+ WG  LPWAWPHDGLQHDK SGEQL+ QYR+QG+ ML + ATF DG+NG+EAG+++ML
Sbjct: 342 LRPWGAHLPWAWPHDGLQHDKGSGEQLAEQYRQQGLSMLGQRATFTDGTNGLEAGVTEML 401

Query: 241 DRMRSGRWKVF 251
           DRM +GR KVF
Sbjct: 402 DRMHTGRLKVF 412


>gi|315122536|ref|YP_004063025.1| DNA packaging protein Gp2 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495938|gb|ADR52537.1| DNA packaging protein Gp2 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 455

 Score =  214 bits (545), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 219/251 (87%), Positives = 233/251 (92%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           LKAYEQGR+KWQSNTV YVWFDEEPPEDVYFEGLTRINATQGLV LTLTPLKGRS I+EH
Sbjct: 147 LKAYEQGREKWQSNTVDYVWFDEEPPEDVYFEGLTRINATQGLVALTLTPLKGRSNIVEH 206

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           YLS+SS DRQVIRMT+ ETPHY  +ER RII+SYPLHEREARTKGEP+LGSGRIFPI+E+
Sbjct: 207 YLSSSSPDRQVIRMTLEETPHYTAKERIRIINSYPLHEREARTKGEPVLGSGRIFPILEQ 266

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           DIVI S DIPEHW QIGGMDFGWHHPFAA  L WNRDSDVIYVVKNYRCREQTP+FH A 
Sbjct: 267 DIVITSFDIPEHWSQIGGMDFGWHHPFAAVQLAWNRDSDVIYVVKNYRCREQTPLFHAAV 326

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           LKSWGKWLPWAWPHDGLQHDK SGEQL+ QYR+QGMKMLPECATFDDGSNGVEAG+SD+L
Sbjct: 327 LKSWGKWLPWAWPHDGLQHDKGSGEQLAVQYRQQGMKMLPECATFDDGSNGVEAGVSDIL 386

Query: 241 DRMRSGRWKVF 251
           DRMRSGRWKVF
Sbjct: 387 DRMRSGRWKVF 397


>gi|167600439|ref|YP_001671939.1| terminase large subunit [Pseudomonas phage LUZ24]
 gi|161168302|emb|CAP45467.1| terminase large subunit [Pseudomonas phage LUZ24]
          Length = 482

 Score =  210 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 80/260 (30%), Positives = 133/260 (51%), Gaps = 9/260 (3%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K+YE  +DK+    +  +W DEE P+D+Y + +TR   T G+V LT TP  G + I++ 
Sbjct: 154 FKSYEMSQDKFMGTAIDVIWLDEECPKDIYTQCVTRTATTGGIVYLTFTPEHGLTEIVKD 213

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L      + ++  +  + PH + + +++++  Y   ER  R +G P+LGSG +FPI+EE
Sbjct: 214 FLQDLKPGQFLVHASWEDAPHLSPEVKEQLLSVYSPAERRMRAEGVPMLGSGVVFPILEE 273

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
             V     IP+H+ +I G+D G+ HP A   + W+ + D  Y+        +T   H  A
Sbjct: 274 KFVCEPFQIPDHFHRIIGIDLGFDHPNAIACVAWDPEKDKYYLYDERSESGETLGMHADA 333

Query: 181 L-KSWGKWLPWAWPHDGLQHDKRS-GEQLSAQYRRQG-MKMLPECATFDDGS------NG 231
           +    G  +P   PHD  +HD  + G +     +    + ++ E  +   G       N 
Sbjct: 334 IYLKGGHQIPVVVPHDAFKHDGATSGRRFVDLLKDDHNLNVVYEPFSNPPGPDGKHGGNS 393

Query: 232 VEAGISDMLDRMRSGRWKVF 251
           VE G++ ML RM +G  KVF
Sbjct: 394 VEFGVNWMLTRMENGDLKVF 413


>gi|27476053|ref|NP_775255.1| terminase [Pseudomonas phage PaP3]
 gi|27414483|gb|AAL85569.1| terminase [Pseudomonas phage PaP3]
          Length = 482

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 82/260 (31%), Positives = 134/260 (51%), Gaps = 9/260 (3%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K+YE  +DK+    +  +W DEE P+D+Y + +TR   T G+V LT TP  G + I++ 
Sbjct: 154 FKSYEMSQDKFMGTAIDVIWLDEECPKDIYTQCVTRTATTGGIVYLTFTPEHGLTEIVKD 213

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L      + +I  +  + PH + + +++++  Y   ER  R +G P+LGSG +FPI+EE
Sbjct: 214 FLQDLKPGQFLIHASWEDAPHLSPEVKEQLLSVYSPAERRMRAEGIPMLGSGVVFPILEE 273

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
             V    DIP+H+ +I G+D G+ HP A   + W+ + D  Y+        +T   H  A
Sbjct: 274 KFVCEPFDIPDHFHRIIGIDLGFDHPNAIACVAWDAEKDKYYLYDERSESGETLGMHADA 333

Query: 181 L-KSWGKWLPWAWPHDGLQHDKRS-GEQLSAQYRRQG-MKMLPECATFDDGS------NG 231
           +    G  +P   PHD  +HD  + G +     +    + ++ E  +   G       N 
Sbjct: 334 IYLKGGHQIPVVVPHDAFKHDGATSGRRFVDLLKDDHNLNVVYEPFSNPPGPDGKHGGNS 393

Query: 232 VEAGISDMLDRMRSGRWKVF 251
           VE G++ ML RM +G  KVF
Sbjct: 394 VEFGVNWMLTRMENGDLKVF 413


>gi|318065950|ref|YP_004123808.1| Gp2 [Salmonella phage ST160]
 gi|289066936|gb|ADC81147.1| Gp2 [Salmonella phage ST160]
          Length = 517

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 122/251 (48%), Positives = 161/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 200 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 259

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 260 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 319

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 320 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 379

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLP+ ATF DG N VE+GIS++ 
Sbjct: 380 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPDHATFPDGGNSVESGISELR 439

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 440 DLMLEGRFKVF 450


>gi|197363441|ref|YP_002143078.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197094918|emb|CAR60455.1| putative terminase large subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|320086843|emb|CBY96615.1| DNA packaging protein gp2 Terminase large subunit [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 499

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 123/251 (49%), Positives = 161/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLPE ATF DG N VE+GIS++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPEHATFPDGGNSVESGISELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DLMLEGRFKVF 432


>gi|238912312|ref|ZP_04656149.1| putative terminase large subunit [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|261245593|emb|CBG23388.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
          Length = 499

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 123/251 (49%), Positives = 161/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLPE ATF DG N VE+GIS++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPEHATFPDGGNSVESGISELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DLMLEGRFKVF 432


>gi|221328620|ref|YP_002533461.1| Terminase, large subunit [Salmonella phage epsilon34]
 gi|255252684|ref|YP_003090219.1| Terminase, large subunit [Salmonella phage c341]
 gi|193244688|gb|ACF16628.1| Terminase, large subunit [Salmonella phage epsilon34]
 gi|223697657|gb|ACN18281.1| Terminase, large subunit [Salmonella phage g341c]
          Length = 499

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 123/251 (49%), Positives = 161/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLPE ATF DG N VE+GIS++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPEHATFPDGGNSVESGISELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DLMLEGRFKVF 432


>gi|24371583|ref|NP_720326.1| gp2 [Enterobacteria phage ST64T]
 gi|24250810|gb|AAL15523.1| gp2 [Salmonella phage ST64T]
          Length = 517

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 122/251 (48%), Positives = 160/251 (63%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 200 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 259

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 260 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 319

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 320 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 379

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLPE ATF DG N VE+GI ++ 
Sbjct: 380 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPEHATFPDGGNSVESGIGELR 439

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 440 DLMLEGRFKVF 450


>gi|161504537|ref|YP_001571649.1| hypothetical protein SARI_02650 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865884|gb|ABX22507.1| hypothetical protein SARI_02650 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 499

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 122/251 (48%), Positives = 161/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLP+ ATF DG N VE+GIS++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPDHATFPDGGNSVESGISELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DLMLEGRFKVF 432


>gi|51236724|ref|YP_063734.1| terminase large subunit [Enterobacteria phage P22]
 gi|137879|sp|P26745|TERL_BPP22 RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein gp2; AltName: Full=Terminase large subunit
 gi|21914414|gb|AAM81379.1|AF527608_1 terminase large subunit [Salmonella phage P22-pbi]
 gi|553005|gb|AAA72959.1| DNA pacaging [Enterobacteria phage P22]
 gi|8439622|gb|AAF75044.1| terminase large subunit [Enterobacteria phage P22]
 gi|28394263|tpg|DAA00977.1| TPA_inf: terminase large subunit [Enterobacteria phage P22]
          Length = 499

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 122/251 (48%), Positives = 161/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLP+ ATF DG N VE+GIS++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPDHATFPDGGNSVESGISELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DLMLEGRFKVF 432


>gi|168240109|ref|ZP_02665041.1| DNA packaging protein gp2 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194451817|ref|YP_002044341.1| DNA packaging protein gp2 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194410121|gb|ACF70340.1| DNA packaging protein gp2 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205340165|gb|EDZ26929.1| DNA packaging protein gp2 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 499

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 122/251 (48%), Positives = 161/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLP+ ATF DG N VE+GIS++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPDHATFPDGGNSVESGISELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DLMLEGRFKVF 432


>gi|60476789|gb|AAX21426.1| gp2 [Enterobacteria phage L]
          Length = 499

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 122/251 (48%), Positives = 160/251 (63%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLPE ATF DG N VE+GI ++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPEHATFPDGGNSVESGIGELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DLMLEGRFKVF 432


>gi|219681243|ref|YP_002455888.1| Gp2 [Salmonella enterica bacteriophage SE1]
 gi|66473858|gb|AAY46504.1| Gp2 [Salmonella phage SE1]
          Length = 499

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 122/251 (48%), Positives = 160/251 (63%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR  WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRAAWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLP+ ATF DG N VE+GIS++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPDHATFPDGGNSVESGISELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DLMLEGRFKVF 432


>gi|198245578|ref|YP_002214540.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197940094|gb|ACH77427.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
          Length = 499

 Score =  204 bits (519), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 123/251 (49%), Positives = 161/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 AIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLPE ATF DG N VE+GIS++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPEHATFSDGGNSVESGISELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DLMLEGRFKVF 432


>gi|157734711|dbj|BAF80717.1| terminase large subunit [Enterobacteria phage P22]
 gi|169658843|dbj|BAG12600.1| terminase large subunit [Enterobacteria phage P22]
          Length = 499

 Score =  204 bits (519), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 123/251 (49%), Positives = 161/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 AIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLPE ATF DG N VE+GIS++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPEHATFSDGGNSVESGISELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DLMLEGRFKVF 432


>gi|326622293|gb|EGE28638.1| terminase large subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 482

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 123/251 (49%), Positives = 161/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 165 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 224

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 225 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 284

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 285 AIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 344

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLPE ATF DG N VE+GIS++ 
Sbjct: 345 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPEHATFSDGGNSVESGISELR 404

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 405 DLMLEGRFKVF 415


>gi|62178924|ref|YP_215341.1| gp2-like protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62126557|gb|AAX64260.1| gp2-like protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322713379|gb|EFZ04950.1| gp2-like protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 499

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 124/251 (49%), Positives = 163/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  IGGMDFGW HP A   L W++D+D IYV + ++ +E+T +    A
Sbjct: 302 TIKCQPFECPDHFYVIGGMDFGWDHPQAQVQLWWDKDADTIYVSRVWKAKEKTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ 
Sbjct: 362 VKSWAHKVPTAWPHDGNQHEKGGGEQLKGQYAEAGFMMLQEHATWPDGGNAVEPGITELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DMMLDGRFKVF 432


>gi|218549377|ref|YP_002383168.1| DNA packaging protein gp2 (Terminase large subunit) [Escherichia
           fergusonii ATCC 35469]
 gi|307311077|ref|ZP_07590721.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|331669066|ref|ZP_08369914.1| DNA packaging protein gp2 (Terminase large subunit) [Escherichia
           coli TA271]
 gi|218356918|emb|CAQ89550.1| DNA packaging protein gp2 (Terminase large subunit) [Escherichia
           fergusonii ATCC 35469]
 gi|306908583|gb|EFN39080.1| protein of unknown function DUF264 [Escherichia coli W]
 gi|312945545|gb|ADR26372.1| DNA packaging protein gp2 (Terminase large subunit) [Escherichia
           coli O83:H1 str. NRG 857C]
 gi|315061655|gb|ADT75982.1| DNA packaging protein gp2 (terminase large subunit) [Escherichia
           coli W]
 gi|323377763|gb|ADX50031.1| DNA packaging protein gp2 (terminase large subunit) [Escherichia
           coli KO11]
 gi|324117758|gb|EGC11657.1| terminase [Escherichia coli E1167]
 gi|331064260|gb|EGI36171.1| DNA packaging protein gp2 (Terminase large subunit) [Escherichia
           coli TA271]
          Length = 499

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 124/251 (49%), Positives = 163/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  IGGMDFGW HP A   L W++D+D IYV + ++ +E+T +    A
Sbjct: 302 TIKCQPFECPDHFYVIGGMDFGWDHPQAQVQLWWDKDADTIYVSRVWKAKEKTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ 
Sbjct: 362 VKSWAHKVPTAWPHDGNQHEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DMMLDGRFKVF 432


>gi|323967108|gb|EGB62533.1| terminase [Escherichia coli M863]
          Length = 499

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 124/251 (49%), Positives = 163/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  IGGMDFGW HP A   L W++D+D IYV + ++ +E+T +    A
Sbjct: 302 TIKCQPFECPDHFYVIGGMDFGWDHPQAHVQLWWDKDADTIYVSRVWKAKEKTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ 
Sbjct: 362 VKSWAHKVPTAWPHDGNQHEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DMMLDGRFKVF 432


>gi|281599695|gb|ADA72679.1| Gp2-like protein [Shigella flexneri 2002017]
          Length = 441

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 124/251 (49%), Positives = 163/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 124 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 183

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 184 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 243

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  IGGMDFGW HP A   L W++D+D IYV + ++ +E+T +    A
Sbjct: 244 TIKCQPFECPDHFYVIGGMDFGWDHPQAQVQLWWDKDADTIYVSRVWKAKEKTAVQAWGA 303

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ 
Sbjct: 304 VKSWAHKVPTAWPHDGNQHEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELR 363

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 364 DMMLDGRFKVF 374


>gi|110804280|ref|YP_687800.1| putative terminase large subunit [Shigella flexneri 5 str. 8401]
 gi|110613828|gb|ABF02495.1| putative terminase large subunit [Shigella flexneri 5 str. 8401]
          Length = 354

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 123/251 (49%), Positives = 163/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 37  FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 96

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 97  FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 156

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  IGGMDFGW HP A   L W++++D IYV + ++ +E+T +    A
Sbjct: 157 TIKCQPFECPDHFYVIGGMDFGWDHPQAQVQLWWDKEADTIYVSRVWKAKEKTAVQAWGA 216

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ 
Sbjct: 217 VKSWAHKVPTAWPHDGNQHEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELR 276

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 277 DMMLDGRFKVF 287


>gi|46358697|ref|YP_006405.1| Gp2 [Enterobacteria phage ST104]
 gi|46357933|dbj|BAD15212.1| Gp2 [Enterobacteria phage ST104]
 gi|312911340|dbj|BAJ35314.1| putative terminase large subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
          Length = 499

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 121/251 (48%), Positives = 160/251 (63%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E T +    A
Sbjct: 302 TIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  MLP+ ATF DG N VE+GIS++ 
Sbjct: 362 VKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPDHATFPDGGNSVESGISELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+K F
Sbjct: 422 DLMLEGRFKAF 432


>gi|281599578|gb|ADA72562.1| putative terminase large subunit [Shigella flexneri 2002017]
          Length = 351

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 123/251 (49%), Positives = 163/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 34  FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 93

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 94  FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 153

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  IGGMDFGW HP A   L W++++D IYV + ++ +E+T +    A
Sbjct: 154 TIKCQPFECPDHFYVIGGMDFGWDHPQAQVQLWWDKEADTIYVSRVWKAKEKTAVQAWGA 213

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +KSW   +P AWPHDG QH+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ 
Sbjct: 214 VKSWAHKVPTAWPHDGNQHEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELR 273

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 274 DMMLDGRFKVF 284


>gi|315299781|gb|EFU59021.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           16-3]
          Length = 499

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 121/251 (48%), Positives = 162/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VW DEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWVDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  IGGMDFGW HP A   L W++D+D+IY+ + ++ +E+T +    A
Sbjct: 302 TIKCQPFECPDHFYVIGGMDFGWDHPQAQVQLWWDKDADIIYLSRVWKAKEKTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +K W   +P AWPHDG QH+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ 
Sbjct: 362 VKPWAHKVPTAWPHDGNQHEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DMMLDGRFKVF 432


>gi|331657716|ref|ZP_08358678.1| DNA packaging protein gp2 (Terminase large subunit) [Escherichia
           coli TA206]
 gi|331055964|gb|EGI27973.1| DNA packaging protein gp2 (Terminase large subunit) [Escherichia
           coli TA206]
          Length = 499

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 122/251 (48%), Positives = 163/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  IGGMDFGW HP A   L W++D+D+IY+ + ++ +E+T +    A
Sbjct: 302 TIKCQPFECPDHFYVIGGMDFGWDHPQAQVQLWWDKDADIIYLSRVWKAKEKTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +K W   +P AWPHDG QH+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ 
Sbjct: 362 VKPWAHKVPTAWPHDGNQHEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DMMLDGRFKVF 432


>gi|327251967|gb|EGE63639.1| DNA packaging protein gp2 [Escherichia coli STEC_7v]
 gi|327254495|gb|EGE66117.1| DNA packaging protein gp2 [Escherichia coli STEC_7v]
          Length = 499

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 122/251 (48%), Positives = 163/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  IGGMDFGW HP A   L W++D+D+IY+ + ++ +E+T +    A
Sbjct: 302 TIKCQPFECPDHFYVIGGMDFGWDHPQAQVQLWWDKDADIIYLSRVWKAKEKTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +K W   +P AWPHDG QH+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ 
Sbjct: 362 VKPWAHKVPTAWPHDGNQHEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DMMLDGRFKVF 432


>gi|293410725|ref|ZP_06654301.1| DNA-packaging protein gp2 [Escherichia coli B354]
 gi|291471193|gb|EFF13677.1| DNA-packaging protein gp2 [Escherichia coli B354]
          Length = 499

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 122/251 (48%), Positives = 163/251 (64%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  IGGMDFGW HP A   L W++D+D+IY+ + ++ +E+T +    A
Sbjct: 302 TIKCQPFECPDHFYVIGGMDFGWDHPQAQVQLWWDKDADIIYLSRVWKAKEKTAVQAWGA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +K W   +P AWPHDG QH+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ 
Sbjct: 362 VKPWAHKVPTAWPHDGNQHEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DMMLDGRFKVF 432


>gi|300920006|ref|ZP_07136465.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           115-1]
 gi|300412953|gb|EFJ96263.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           115-1]
          Length = 498

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 119/251 (47%), Positives = 160/251 (63%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y QGR +WQ +T+H VWFDEEPP  +Y EGLTR N       LT TPL G S ++  
Sbjct: 182 FKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTK 241

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GSGRIF I EE
Sbjct: 242 FLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEE 301

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            I     + P+H+  I  MDFGW HP A   L W++D DVIY+ + ++ +++      +A
Sbjct: 302 TIKCQPFECPDHFYVINAMDFGWDHPQAHIQLWWDKDEDVIYLSRVWKAKQKKATEAWSA 361

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +K+W K  P AWPHDG QH+K  G QL  QY   G  MLP+ AT+ DG N VE GI+++ 
Sbjct: 362 VKAWSKNTPTAWPHDGHQHEKGGGAQLKEQYADAGFDMLPDHATWPDGGNAVEPGIAEIR 421

Query: 241 DRMRSGRWKVF 251
           D M  GR+KVF
Sbjct: 422 DMMLDGRFKVF 432


>gi|167583562|ref|YP_001671752.1| terminase large subunit [Enterobacteria phage phiEco32]
 gi|164375400|gb|ABY52808.1| terminase large subunit [Enterobacteria phage phiEco32]
          Length = 513

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 81/268 (30%), Positives = 139/268 (51%), Gaps = 17/268 (6%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPED---VYFEGLTRINATQGLVTLTLTPLKGRSPI 57
            ++ +QG       TV Y+W DEE P +   ++ + +TR   T+GLVT+T TP  G + +
Sbjct: 177 FRSTQQGEHTLMGATVDYIWLDEEDPYESMAIFAQCVTRTLTTKGLVTITATPENGLTEL 236

Query: 58  IEHYLSASSSDR----QVIRMTINETP-----HYNEQERKRIIDSYPLHEREARTKGEPI 108
           ++ ++     +          +  +       H  +Q+ K + +  P  + E R+KG P+
Sbjct: 237 VDKFMKGEGDESTGSLYFQNASWWDAHVDLGGHITDQDIKDMTEGIPAWQLEMRSKGMPL 296

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR 168
           LGSG I+ + ++ I     +IP+ W ++  +D G  HP AA    ++ ++D IYV  +Y+
Sbjct: 297 LGSGLIYDVSDDTIKCEPFEIPDTWKRVCAIDIGIDHPTAAVWTAYDANTDTIYVYDSYK 356

Query: 169 CREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
               TP++H  A+   G+W+P   PHD    +K SG  ++  Y+  G+ +  E      G
Sbjct: 357 EGGFTPVYHAPAINGRGQWIPVILPHDADNTEKGSGSSVAQFYKNAGVNVQSETFYNKIG 416

Query: 229 SNG-----VEAGISDMLDRMRSGRWKVF 251
            +G     VE GI+D+ +RM SGR+KVF
Sbjct: 417 MDGKKNFFVEPGITDIRERMMSGRFKVF 444


>gi|49146380|ref|YP_025488.1| putative phage DNA packaging protein Gp2 [Caedibacter
           taeniospiralis]
 gi|40458348|gb|AAR87096.1| putative phage DNA packaging protein Gp2 [Caedibacter
           taeniospiralis]
          Length = 474

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 93/285 (32%), Positives = 141/285 (49%), Gaps = 40/285 (14%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRI----NATQGLVTLTLTPLKGRSP 56
            K+YEQGR K+Q+  +  V  DEEPP D+Y E L R        +G+V LT+TPL G + 
Sbjct: 133 FKSYEQGRKKFQAAKLDLVHLDEEPPRDIYVESLMRTMSTEVDNEGIVLLTMTPLLGLTD 192

Query: 57  IIEHYLSASSS-----------------------------DRQVIRMTINETPHYNEQER 87
           +I  +   +                               +R  I+ + ++ PH  +  +
Sbjct: 193 LILEFQETTIEREVINGSGVSEMSEMTEEVIKVDEGSIVNNRFYIQASWDDNPHLLDSAK 252

Query: 88  KRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPF 147
           + +  S   HE+EAR  G P LGSG ++P+ E  +V+N   IP+HW ++ G+DFGW +P 
Sbjct: 253 ETLSKSLKPHEKEARKHGIPSLGSGLVYPVSEVAVVVNPFVIPKHWGRVFGLDFGWINPT 312

Query: 148 AAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG-KWLPWAWPHDGLQHDKRSGEQ 206
           AA   V +RD+DV+Y+   Y   E+TP  HV  LK  G   +   +   G Q  +R G  
Sbjct: 313 AALFAVIDRDNDVMYLTGEYYVSERTPQQHVYELKKLGADKINGVYDPAGEQSSQRDGGD 372

Query: 207 LSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
           L+  YR  G++ L          N  E GI  +L R ++G+ K+F
Sbjct: 373 LAQLYRDSGLRYLY------KADNAKEEGIMKVLQRFQNGKLKIF 411


>gi|24111660|ref|NP_706170.1| putative terminase large subunit [Shigella flexneri 2a str. 301]
 gi|24050435|gb|AAN41877.1| putative terminase large subunit [Shigella flexneri 2a str. 301]
 gi|313646707|gb|EFS11166.1| DNA packaging gp2 domain protein [Shigella flexneri 2a str. 2457T]
          Length = 300

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 113/233 (48%), Positives = 151/233 (64%)

Query: 19  VWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINE 78
           +WFDEEPP  +Y EGLTR N       LT TPL G S ++  +L   S  ++V+ MTI +
Sbjct: 1   MWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTKFLKNPSKSQKVVNMTIYD 60

Query: 79  TPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGG 138
             HY ++++++II SYP HEREAR +G P +GSGRIF I EE I     + P+H+  IGG
Sbjct: 61  AEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIGG 120

Query: 139 MDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQ 198
           MDFGW HP A   L W++++D IYV + ++ +E+T +    A+KSW   +P AWPHDG Q
Sbjct: 121 MDFGWDHPQAQVQLWWDKEADTIYVSRVWKAKEKTAVQAWGAVKSWAHKVPTAWPHDGNQ 180

Query: 199 HDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
           H+K  GEQL  QY   G  ML E AT+ DG N VE GI+++ D M  GR+KVF
Sbjct: 181 HEKGGGEQLKGQYADAGFMMLQEHATWPDGGNAVEPGITELRDMMLDGRFKVF 233


>gi|137993|sp|P16938|VG2_BPLP7 RecName: Full=Protein GP2
 gi|75884|pir||Z2BPL7 gene 2 protein - phage LP-7 (fragment)
 gi|553003|gb|AAA88220.1| packaging glycoprotein [Enterobacteria phage LP7]
          Length = 475

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 106/226 (46%), Positives = 141/226 (62%)

Query: 26  PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQ 85
           P  +Y EGLTR N       LT TPL G S  +  +L   S  ++V+ MTI +  HY ++
Sbjct: 203 PYSIYAEGLTRTNKYGQFSILTFTPLMGMSDGVTKFLKNPSKSQKVVNMTIYDAEHYTDE 262

Query: 86  ERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHH 145
           ++++II SYP HEREAR +G P +GSGRIF I EE I     + P+H+  I   DFGW+H
Sbjct: 263 QKEQIIASYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNH 322

Query: 146 PFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGE 205
           P A   L W++D+DV Y+ + ++  E T +    A+KSW   +P AWPHDG QH+K  GE
Sbjct: 323 PQAHIQLWWDKDADVFYLARVWKKSENTAVQAWGAVKSWANKIPVAWPHDGHQHEKGGGE 382

Query: 206 QLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
           QL  QY   G  MLP+ ATF DG N VE+GIS++ D M  GR+KVF
Sbjct: 383 QLKTQYADAGFSMLPDHATFPDGGNSVESGISELRDLMLEGRFKVF 428


>gi|94317806|gb|ABF15069.1| terminase large subunit Gp2 [Salmonella enterica subsp. enterica
           serovar Typhimurium]
          Length = 278

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 99/215 (46%), Positives = 134/215 (62%)

Query: 37  INATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPL 96
            N       LT TPL G S ++  +L   S  ++V+ MTI +  HY ++++++II SYP 
Sbjct: 1   TNKYGQFSILTFTPLMGMSDVVTKFLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPE 60

Query: 97  HEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNR 156
           HEREAR +G P +GSGRIF I EE I     + P+H+  I   DFGW+HP A   L W++
Sbjct: 61  HEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDK 120

Query: 157 DSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGM 216
           D+DV Y+ + ++  E T +    A+KSW   +P AWPHDG QH+K  GEQL  QY   G 
Sbjct: 121 DADVFYLARVWKKSENTAVQAWGAVKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGF 180

Query: 217 KMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
            MLP+ ATF DG N VE+GIS++ D M  GR+KVF
Sbjct: 181 SMLPDHATFPDGGNSVESGISELRDLMLEGRFKVF 215


>gi|89885991|ref|YP_516188.1| phage terminase large subunit [Sodalis phage phiSG1]
 gi|89191726|dbj|BAE80473.1| phage terminase large subunit [Sodalis phage phiSG1]
 gi|125470018|gb|ABN42210.1| gp02 [Sodalis phage phiSG1]
          Length = 475

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 90/256 (35%), Positives = 140/256 (54%), Gaps = 10/256 (3%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEP-PEDVYFEGLTRI----NATQGLVTLTLTPLKGRS 55
             +Y QG+     + V +   DEEP    +Y + LTR         G   LT TP  GR+
Sbjct: 160 FWSYSQGQHALMGDCVDWFHIDEEPRDPTIYPQVLTRTATGDRGKGGRGILTFTPENGRT 219

Query: 56  PIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIF 115
            ++  ++   S  +  I +  ++ PH +++ +  ++ S+P H+R+ RTKG P+LG GRI+
Sbjct: 220 DLVIGFMDNPSPAQTCINVGWDDAPHLSQKVKNDLLASFPAHQRDMRTKGIPMLGHGRIY 279

Query: 116 PIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPI 175
            + E+ I  +   +P HW+ I GMDFGW HP A   LVW+ ++++ YV + Y+ R+ +P 
Sbjct: 280 DLGEDFITCDPFPVPAHWLVIDGMDFGWDHPQAHIQLVWDNENEMFYVTRAYKARQVSPA 339

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
              +A+  W + +P AWP DGL  +K SG Q    Y   G  ML + A + DGS  VE  
Sbjct: 340 EAYSAVSIWAENVPTAWPSDGLMTEKGSGIQQKTYYDDAGFCMLRDPAQWPDGSRSVE-- 397

Query: 236 ISDMLDRMRSGRWKVF 251
              + D MR G++KVF
Sbjct: 398 ---LHDLMRRGKFKVF 410


>gi|158422463|ref|YP_001523755.1| putative DNA packaging protein GP2 [Azorhizobium caulinodans ORS
           571]
 gi|158329352|dbj|BAF86837.1| putative DNA packaging protein GP2 [Azorhizobium caulinodans ORS
           571]
          Length = 251

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 100/183 (54%), Positives = 136/183 (74%)

Query: 69  RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLD 128
           R  I+ T ++ PH  +Q++  +  + P H R+ARTKG P+LGSGR+FPI EE I+ +++ 
Sbjct: 3   RFCIQATWDDVPHLTQQQKDELWAAIPAHMRDARTKGIPVLGSGRVFPIAEELILCDAMP 62

Query: 129 IPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWL 188
           IP+HW +I G+DFGW HPF A  + W+RD+DVIYVV  YR RE++ + H AA++ WGK +
Sbjct: 63  IPKHWARINGLDFGWDHPFGAVSIAWDRDADVIYVVNTYRAREESSVIHAAAIRPWGKKI 122

Query: 189 PWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRW 248
           P AWPHDG QHDK SG+QL+ QYR  G++ML E AT + G NGVEAGI +ML+RM++GR 
Sbjct: 123 PCAWPHDGFQHDKGSGQQLAEQYRDHGLEMLDEHATHEQGGNGVEAGIMEMLERMQTGRL 182

Query: 249 KVF 251
           KVF
Sbjct: 183 KVF 185


>gi|321225021|gb|EFX50082.1| Phage terminase, large subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
          Length = 267

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 93/200 (46%), Positives = 128/200 (64%)

Query: 52  KGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGS 111
            G S ++  +L   S  ++V+ MTI +  HY ++++++II SYP HEREAR +G P +GS
Sbjct: 1   MGMSDVVTKFLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHEREARARGIPTMGS 60

Query: 112 GRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
           GRIF I EE I     + P+H+  I   DFGW+HP A   L W++D+DV Y+ + ++  E
Sbjct: 61  GRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDADVFYLARVWKKSE 120

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
            T +    A+KSW   +P AWPHDG QH+K  GEQL  QY   G  MLP+ ATF DG N 
Sbjct: 121 NTAVQAWGAVKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSMLPDHATFPDGGNS 180

Query: 232 VEAGISDMLDRMRSGRWKVF 251
           VE+GIS++ D M  GR+KVF
Sbjct: 181 VESGISELRDLMLEGRFKVF 200


>gi|41179257|ref|NP_958579.1| putative terminase large subunit [Lactobacillus prophage Lj965]
 gi|42518398|ref|NP_964328.1| Lj965 prophage terminase large subunit [Lactobacillus johnsonii NCC
           533]
 gi|39652610|gb|AAK27894.2| putative terminase large subunit [Lactobacillus prophage Lj965]
 gi|41582683|gb|AAS08294.1| Lj965 prophage terminase large subunit [Lactobacillus prophage
           Lj965]
          Length = 424

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 46/254 (18%), Positives = 82/254 (32%), Gaps = 24/254 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+   +FDE    P+    +   R + T   +     P         +++
Sbjct: 121 EASQDLVQGITLAGFFFDEVALMPQSFVNQATARCSVTGSKMWFNCNPSGPFHWFKLNWI 180

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                 R + I  T+++ P  +     R    Y     +   +G  ++  G I+   ++D
Sbjct: 181 DQMKDKRALRIHFTMHDNPSLDSVTINRYERMYSGVFYQRYIQGLWVMSEGVIYDNFDKD 240

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP------I 175
            ++ +             D+G  +P A       R+  V Y+VK Y    +T        
Sbjct: 241 TMVVNELPNHFEKYYVSCDYGTLNPTAFLLWG--RNHGVWYLVKEYYYSGRTTSRQKTDE 298

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +   LK +   +              S    S   R+ G K+           N V  G
Sbjct: 299 EYCHDLKEFLGDIR------AEMIIDPSAASFSTTLRQNGFKVR-------KAKNDVLDG 345

Query: 236 ISDMLDRMRSGRWK 249
           I      M  G+ K
Sbjct: 346 IRVTQTAMNEGKIK 359


>gi|148557334|ref|YP_001264916.1| hypothetical protein Swit_4440 [Sphingomonas wittichii RW1]
 gi|148502524|gb|ABQ70778.1| hypothetical protein Swit_4440 [Sphingomonas wittichii RW1]
          Length = 276

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 118/209 (56%), Positives = 145/209 (69%)

Query: 43  LVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR 102
             T  L   +        YL  +   R V RMTI++  HY+  ER  I+ SYP HER+AR
Sbjct: 6   PWTWALNAHREGRNHKLVYLWETPMTRHVTRMTIDDAEHYSPAERAAIVASYPAHERKAR 65

Query: 103 TKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIY 162
            +G P+LGSGR+FP+ E+ I I + ++P  W QIGG+DFGW HP AA  L W+RD+D IY
Sbjct: 66  AEGIPMLGSGRVFPVDEDVIKIRAFEVPAGWTQIGGIDFGWDHPTAAVRLAWDRDADCIY 125

Query: 163 VVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPEC 222
           V  +Y  RE TPI H AALK WG WLPWAWPHDGLQHDK SG  L+ QYR QG+ +LPE 
Sbjct: 126 VTASYGVREATPILHAAALKPWGNWLPWAWPHDGLQHDKGSGAALAQQYRDQGLSLLPEK 185

Query: 223 ATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
           A+F++G NGVEAGI++MLDRM SGRWKVF
Sbjct: 186 ASFEEGGNGVEAGIAEMLDRMLSGRWKVF 214


>gi|329667176|gb|AEB93124.1| phage terminase large subunit [Lactobacillus johnsonii DPC 6026]
          Length = 424

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 82/254 (32%), Gaps = 24/254 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+   +FDE    P+    +   R + +   +     P          ++
Sbjct: 121 EASQDLVQGITLAGFFFDEVALMPQSFVNQATARCSVSGAKMWFNCNPSGPYHWFKLDWI 180

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                 R + +  T+++ P  ++    R    Y     +   +G  ++  G I+   ++D
Sbjct: 181 DRLKGKRALRLHFTMHDNPSLDKATISRYERMYSGVFYQRYIQGLWVMSEGVIYDNFDKD 240

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP------I 175
            ++ +             D+G  +P A       R+  + Y++K Y    +T        
Sbjct: 241 TMVVNELPNHFEKYYVSCDYGTLNPTAFLLWG--RNHGIWYLIKEYYYSGRTTSRQKTDE 298

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +   LK +   +              S    S   R+ G K+           N V  G
Sbjct: 299 EYCHDLKEFLGNIR------AEMIIDPSAASFSTTLRQNGFKVR-------KAKNDVIDG 345

Query: 236 ISDMLDRMRSGRWK 249
           I      M  G+ K
Sbjct: 346 IRVTQTAMNEGKIK 359


>gi|291543425|emb|CBL16534.1| phage terminase, large subunit, PBSX family [Ruminococcus sp.
           18P13]
          Length = 432

 Score =  137 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 41/255 (16%), Positives = 78/255 (30%), Gaps = 23/255 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E      Q  T+  ++ DE    P     + + R + +   +     P          ++
Sbjct: 116 ESSAALIQGITLGGIFLDEVALMPRSFVEQAIARCSISGSRLWFNCNPDHPYHWFYREWI 175

Query: 63  SASSSDRQ-VIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             ++      +  T+ +      + R R    Y     +    G+    SG ++P+  +D
Sbjct: 176 CKAAEKNALYLHFTMEDNLSLTPRIRARYRRLYAGVFYDRFILGKWTASSGLVYPMFRKD 235

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR------EQTPI 175
                 + P     +   D+G  +P +    +W     V Y +  Y          +T  
Sbjct: 236 -THLFTEPPACSRFVVSCDYGTVNPTSM--GLWGESGGVWYRLGEYYYASRQTGISRTDE 292

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            H  AL+                    S        RR G              N V +G
Sbjct: 293 EHYTALEQLCSGRTID-----CVVIDPSAASFMECIRRHG------RFRVIPAKNDVLSG 341

Query: 236 ISDMLDRMRSGRWKV 250
           I  + D ++SGR ++
Sbjct: 342 IRRVSDALKSGRIRI 356


>gi|237795749|ref|YP_002863301.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           Ba4 str. 657]
 gi|229261123|gb|ACQ52156.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           Ba4 str. 657]
          Length = 502

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 77/256 (30%), Gaps = 24/256 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  V FDE    P+    +   R +     +     P          YL
Sbjct: 129 EGSQDLIQGITLAGVLFDEVALMPQSFANQATARCSVEGAKMWFNCNPDGPYHWFKIEYL 188

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                   V    T+++    +E+ ++R    Y     +    G   L  G I+ +  ED
Sbjct: 189 DKLKEKNAVHLHFTMDDNLSLSEKVKERYKRMYSGIFYKRYILGLWCLAEGIIYDMFNED 248

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE------QTPI 175
                    ++      +D+G  +            +   Y+VK Y          ++ +
Sbjct: 249 FHKVKTISRKYDKYYVSIDYGTQNATVFLLWGL--CNGKWYIVKEYYYSGRDTSLQKSDV 306

Query: 176 FHVAALKSWGKWL-PWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
            +   LK +   + P     D       S      Q R  G K            N V  
Sbjct: 307 QYSKELKKFLGDIVPVKIIVD------PSAASFIKQLRDDGFK------NILKAKNDVLD 354

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +   +  G + V
Sbjct: 355 GIRTVASALSIGLFYV 370


>gi|251777775|ref|ZP_04820695.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
 gi|243082090|gb|EES47980.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
          Length = 452

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/250 (17%), Positives = 73/250 (29%), Gaps = 12/250 (4%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  V FDE    P+    +  +R +     +     P          +L
Sbjct: 129 EGSQDLIQGITLAGVLFDEVALMPQSFVNQATSRCSVDGAKMWFNCNPDGPYHWFKTEFL 188

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                   V    T+++    +E+ ++R    Y     +    G   L  G I+ +  ED
Sbjct: 189 DKLKEKNAVHLHFTMDDNLSLSERVKERYKRMYSGIFYKRYILGLWCLAEGVIYDMFNED 248

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ-TPIFHVAA 180
                     +      +D+G  +          +D    Y+VK Y    + T I     
Sbjct: 249 NHKVETIKRRYEKYYVSIDYGTQNATVFLLWGLYQD--KWYIVKEYYYSGRNTGIQKADI 306

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
             S                   S      Q R  G K           +N V  GI  + 
Sbjct: 307 QYSKDLKKFLGDIIPVKIIVDPSAASFIKQLRDDGFK------NILPANNDVLDGIRTVA 360

Query: 241 DRMRSGRWKV 250
             +  G + V
Sbjct: 361 SALSIGLFYV 370


>gi|307693548|ref|ZP_07635785.1| Lj965 prophage terminase large subunit [Ruminococcaceae bacterium
           D16]
          Length = 418

 Score =  135 bits (339), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 38/255 (14%), Positives = 82/255 (32%), Gaps = 24/255 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E+     Q  T+     DE    P     +   R +     +  +  P        + ++
Sbjct: 117 ERSAALVQGITLAGALLDEVALMPRSFVEQVCARCSVEGSRLWFSCNPESPAHWFYQEWI 176

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +   + + +   + + P  +    +R    +          GE +   G ++    +D
Sbjct: 177 QKAEEKKVLRLSFAMTDNPSLSPAMLERYRTMFQGAFYRRFVLGEWVNAEGLVYDFFSQD 236

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPI 175
           +V     +          D+G  +P +    +W R + V Y ++ Y        R++T  
Sbjct: 237 LVREP-PLDVSGPFYVSCDYGTVNPTSM--GLWGRKNGVWYRLEEYYYNSRQARRQKTDQ 293

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +   L +  K  P      G      S        RR+G+ +          +N V +G
Sbjct: 294 EYADDLGALVKGRPL-----GAVVVDPSAASFIEVLRRRGVPVR-------KANNDVLSG 341

Query: 236 ISDMLDRMRSGRWKV 250
           I      ++ G+  +
Sbjct: 342 IRLTARLLKEGKLVI 356


>gi|28210787|ref|NP_781731.1| phage terminase large subunit [Clostridium tetani E88]
 gi|28203225|gb|AAO35668.1| phage terminase large subunit [Clostridium tetani E88]
          Length = 447

 Score =  134 bits (338), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 44/255 (17%), Positives = 76/255 (29%), Gaps = 22/255 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  V FDE    P+    +   R +     +     P          YL
Sbjct: 124 EASQDLIQGITLAGVLFDEVALMPQSFVNQATARCSVDGAKMWFNCNPEGPYHWFKVEYL 183

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                   +    T+N+    +E+ ++R    Y     +    G   L  G I+ +  ED
Sbjct: 184 DNLEYKNGIHLHFTMNDNLSLSEKVKERYKRMYSGIFYKRYILGLWCLAEGVIYDMFNED 243

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE------QTPI 175
                    ++      +D+G  +                Y+VK Y          +T I
Sbjct: 244 FHKVKTVHRKYEKYYVSIDYGTQNATVFLLWGL--CEGKWYIVKEYYYSGRDKSLQKTDI 301

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +   LK +   +              S     AQ R  G + +          N V  G
Sbjct: 302 QYSKDLKGFLGDIVPV-----KIIIDPSAASFIAQLRSDGFEQIR------KAKNDVLDG 350

Query: 236 ISDMLDRMRSGRWKV 250
           I  +   +    ++V
Sbjct: 351 IRTVASALSLDMFRV 365


>gi|290891580|ref|ZP_06554636.1| hypothetical protein AWRIB429_2026 [Oenococcus oeni AWRIB429]
 gi|290478767|gb|EFD87435.1| hypothetical protein AWRIB429_2026 [Oenococcus oeni AWRIB429]
          Length = 431

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/254 (16%), Positives = 75/254 (29%), Gaps = 25/254 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+   +FDE    P+    +   R +     +     P          +L
Sbjct: 125 ESSQDLVQGITLSGFFFDEVALMPQSFVNQATARCSVENSKLWFNCNPAGPYHWFKVEWL 184

Query: 63  SASSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                 +   I  T+ + P  ++  R+R    Y     +    G  ++  G I+   +E+
Sbjct: 185 DQLDKHNTIRIHFTMADNPSLSQAIRERFERMYSGVFYQRYILGLWVMSEGIIYDNFDEN 244

Query: 122 IVINSLDIPEHWV-QIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE------QTP 174
            ++       H+       D+G  +P               Y +  Y          +T 
Sbjct: 245 SMVIDPPNDRHYEKYYVSCDYGTLNPTVFLLWGLF--DGTWYCLDEYYYSGRDTQRQKTD 302

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
             +   L  +   +      D       S     A  R++G        T     N V  
Sbjct: 303 EQYADDLDKFLDDVKATIIVD------PSAASFIAVLRKRG-------RTVIKAKNDVLD 349

Query: 235 GISDMLDRMRSGRW 248
           GI      M +G+ 
Sbjct: 350 GIRATQTAMNTGKI 363


>gi|322806568|emb|CBZ04137.1| phage terminase large subunit [Clostridium botulinum H04402 065]
          Length = 450

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/252 (16%), Positives = 75/252 (29%), Gaps = 16/252 (6%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  V FDE    P+    +   R +  +  +     P          YL
Sbjct: 127 EGSQDLIQGITLAGVLFDEVALMPQSFVNQATARCSVERAKMWFNCNPDGPYHWFKIEYL 186

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                   V    T+++    +E+ ++R    Y     +    G   L  G I+ +  ED
Sbjct: 187 DKLKEKNAVHLHFTMDDNLSLSEKVKERYKRMYSGIFYKRYILGLWCLAEGVIYDMFNED 246

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
                    ++      +D+G  +            +   Y++K Y    +      + +
Sbjct: 247 FHKVKTIPKKYEKYYVSIDYGTQNATVFLLWGL--YNGKWYIIKEYYYSGRDTSLQKSDV 304

Query: 182 ---KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
              K    +L    P   +     S      Q R  G K            N V  GI  
Sbjct: 305 QYSKELKNFLGDIVPVKIIV--DPSAASFIKQLRDDGFK------NILKAKNDVIDGIRT 356

Query: 239 MLDRMRSGRWKV 250
           +   +    + V
Sbjct: 357 VASALNLSLFYV 368


>gi|51512091|gb|AAU05290.1| terminase large subunit [Enterobacteria phage T5]
          Length = 438

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/257 (16%), Positives = 90/257 (35%), Gaps = 25/257 (9%)

Query: 8   RDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGRSPIIEHY-- 61
            D     +  ++ FDE    DV    +   L           L ++  +G +   E Y  
Sbjct: 140 ADSAVGRSYDFIIFDEAAISDVGGDAFRVQLRPTLDKPNSKALFISTPRGGNWFKEFYAY 199

Query: 62  -LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
               +  +   I  T  + P  +  + +    +   +      + +  +  G+IF     
Sbjct: 200 GFDDTLPNWVSIHGTYRDNPRADLNDIEEARRTVSKNYFRQEYEADFSVFEGQIFDTFNA 259

Query: 121 DIVINSLDIPEHWVQI-------GGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
              +  L    H+ +         G+D G+  P A   + ++ D+D  YV++ Y+  E+T
Sbjct: 260 TDHVKDLKGMRHFFKDDEAFETLLGIDVGYRDPTAVLTIKYHYDTDTYYVLEEYQQAEKT 319

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
              H A ++                 D+   +  +AQ+R+  +    E A+       V 
Sbjct: 320 TAQHAAYIQHCIDRYKV---------DRIFVDSAAAQFRQ-DLAYEHEIASAP-AKKSVL 368

Query: 234 AGISDMLDRMRSGRWKV 250
            G++ +    + G+  V
Sbjct: 369 DGLACLQALFQQGKIIV 385


>gi|182682964|ref|YP_001837088.1| terminase, large subunit [Enterobacteria phage EPS7]
 gi|182630676|gb|ACB97608.1| terminase, large subunit [Enterobacteria phage EPS7]
          Length = 438

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/257 (17%), Positives = 92/257 (35%), Gaps = 25/257 (9%)

Query: 8   RDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGRSPIIEHY-- 61
            D     +  ++ FDE    DV    +   L           L ++  +G +   E Y  
Sbjct: 140 ADSAVGRSYDFIIFDEAAISDVGGAAFDIQLRPTLDKPNSKALFISTPRGGNWFKEFYEK 199

Query: 62  -LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
             + +  +   I  T  + P  +  + +    +   +      + +  +  G+IF     
Sbjct: 200 GFNETLPNWVSIHGTYRDNPRADLNDIEEARRTVSKNYFRQEYEADFSVFEGQIFDTFNA 259

Query: 121 DIVINSLDIPEHWVQI-------GGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
              +  L    H+ +         G+D G+  P A   + ++ D+DV YV++ Y+  E+T
Sbjct: 260 IEHVKDLKGMRHFFKDDEAFETLLGIDVGYRDPTAVLTIKYHYDTDVYYVLEEYQQAEKT 319

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
              H   ++            D    D+   +  +AQ+R+  +    E A+       V 
Sbjct: 320 TAQHATYIQH---------CIDRYNVDRIFVDSAAAQFRQ-DLAYEHEIASAP-AKKSVL 368

Query: 234 AGISDMLDRMRSGRWKV 250
            G++ +    + G+  V
Sbjct: 369 DGLACLQALFQQGKIIV 385


>gi|225017299|ref|ZP_03706491.1| hypothetical protein CLOSTMETH_01225 [Clostridium methylpentosum
           DSM 5476]
 gi|224949916|gb|EEG31125.1| hypothetical protein CLOSTMETH_01225 [Clostridium methylpentosum
           DSM 5476]
          Length = 424

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/253 (15%), Positives = 71/253 (28%), Gaps = 23/253 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E      Q  T+  V  DE    P     + + R +     +     P          ++
Sbjct: 118 EGSAALIQGVTLAGVLCDEVALMPRSFVEQAIARCSVAGSKLWFNCNPEHPFHWFYLEWI 177

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +     +     + + P  +   R+R    Y     E    G     SG+++P+ +  
Sbjct: 178 QKAEEKNALHLHFRMEDNPSLSPALRRRYETLYSGAFYERFVLGHWTAQSGQVYPMFDPA 237

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPI 175
             +               D+G  +P + G       +   Y +  Y          +T  
Sbjct: 238 RHVVRELPDRFDSYYISCDYGITNPASFGLWGC---NQKWYRIDEYYFDSRREQARRTDE 294

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            + A L+                    S        RR G             +N V+ G
Sbjct: 295 EYYAELERLAGGREI-----RAVIADPSASSWIECIRRHG------KFRVIPANNDVQRG 343

Query: 236 ISDMLDRMRSGRW 248
           IS + D +R G+ 
Sbjct: 344 ISLVSDALREGKL 356


>gi|326633035|ref|YP_004306624.1| terminase large subunit [Enterobacteria phage SPC35]
 gi|321272229|gb|ADW80121.1| terminase large subunit [Enterobacteria phage SPC35]
          Length = 438

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/257 (16%), Positives = 90/257 (35%), Gaps = 25/257 (9%)

Query: 8   RDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGRSPIIEHY-- 61
            D     +  ++ FDE    DV    +   L           L ++  +G +   E Y  
Sbjct: 140 ADSAVGRSYDFIIFDEAAISDVGGDAFRVQLRPTLDKPNSKALFISTPRGGNWFKEFYAY 199

Query: 62  -LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
               +  +   I  T  + P  +  + +    +   +      + +  +  G+IF     
Sbjct: 200 GFDDTLPNWVSIHGTYRDNPRADLNDIEEARRTVSKNYFRQEYEADFSVFEGQIFDTFNA 259

Query: 121 DIVINSLDIPEHWVQI-------GGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
              +  L    H+ +         G+D G+  P A   + ++ D+D  YV++ Y+  E+T
Sbjct: 260 IDHVKDLKGMRHFFKDDEAFETLLGIDVGYRDPTAVLTIKYHYDTDTYYVLEEYQQAEKT 319

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
              H A ++                 D+   +  +AQ+R+  +    E A+       V 
Sbjct: 320 TAQHAAYIQHCIDRYKV---------DRVFVDSAAAQFRQ-DLAYEHEIASAP-AKKSVL 368

Query: 234 AGISDMLDRMRSGRWKV 250
            G++ +    + G+  V
Sbjct: 369 DGLACLQALFQQGKIIV 385


>gi|312134857|ref|YP_004002195.1| phage terminase, large subunit, pbsx family [Caldicellulosiruptor
           owensensis OL]
 gi|311774908|gb|ADQ04395.1| phage terminase, large subunit, PBSX family [Caldicellulosiruptor
           owensensis OL]
          Length = 404

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/253 (16%), Positives = 84/253 (33%), Gaps = 20/253 (7%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPE--DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E+   + +  T+     DE       V+ + L R +     V  T  P      +   Y+
Sbjct: 101 EKAETRIRGLTLAGALCDEVTTYPRSVFEQLLARCSVEGAKVFATTNPDSPYHWLYVDYI 160

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +      + + ++ + P    +  + I  +Y     +    GE +   G I+ + +E 
Sbjct: 161 QKADEKGYFVMKFSLEDNPFLPPEYIEFIKKTYTGLFYKRFILGEWVAAEGIIYDMFDEK 220

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE----QTPIFH 177
             + +    +    I G+DFG  +P     +       + YV+K Y        +T   +
Sbjct: 221 THVINELSEKFDKHIVGVDFGMQNPTVFLLIGI--KDSIAYVIKEYYHEGREQTKTVDRY 278

Query: 178 VAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
               K W   +          +   S + L  Q +  G           + +N V  GI+
Sbjct: 279 SKDFKDWLGDI-----KPSRIYIDPSAQALMQQLKADGFS------NVREANNDVLDGIA 327

Query: 238 DMLDRMRSGRWKV 250
            +   +   +  V
Sbjct: 328 TVSKFLSQQKLFV 340


>gi|238062875|ref|ZP_04607584.1| phage terminase [Micromonospora sp. ATCC 39149]
 gi|237884686|gb|EEP73514.1| phage terminase [Micromonospora sp. ATCC 39149]
          Length = 428

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 48/252 (19%), Positives = 97/252 (38%), Gaps = 15/252 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +  T+   + DE    PE  + + L R++     +  T  P      + + YL  +  
Sbjct: 119 KVRGMTLCIAYGDELTTIPEAFFTQVLARLSVAGAQLFGTTNPDSPNHWLRKKYLLRAGE 178

Query: 68  -DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            + +    T+ + PH + Q  + +   Y     +    G  +   G +F + +ED  +  
Sbjct: 179 LNLRTWHSTLRDNPHLDPQYVRNLTTEYVGLWYKRFILGAWVQAEGAVFDMWDEDRHVIP 238

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRC------REQTPIFHVAA 180
           +    H     G+D+G  +  AA  L   +D   +++   +R       R+ T       
Sbjct: 239 VLPAIHRWISLGIDYGTRNATAALILGVGQDG-RLHLTHEWRHDPAVARRQLTDAGLSRE 297

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           L++W     +P A    GL+ +    +  +A  R   +++  +  T     N V  GI  
Sbjct: 298 LRAWLGRLQVPGATGLTGLRPEWTVVDPAAASLR---LQLHEDGMTPALADNAVLDGIRL 354

Query: 239 MLDRMRSGRWKV 250
           M   + + + +V
Sbjct: 355 MSSLLGNDQLRV 366


>gi|46401884|ref|YP_006983.1| terminase, large subunit [Enterobacteria phage T5]
 gi|45775062|gb|AAS77194.1| terminase, large subunit [Enterobacteria phage T5]
 gi|59897286|gb|AAX12081.1| ORF144 [Enterobacteria phage T5]
          Length = 438

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/257 (16%), Positives = 89/257 (34%), Gaps = 25/257 (9%)

Query: 8   RDKWQSNTVHYVWFDEEP----PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY-- 61
            D     +  ++ FDE        D +   L           L ++  +G +   E Y  
Sbjct: 140 ADSAVGRSYDFIIFDEAAISDVGGDAFRVQLRPTLDKPNSKALFISTPRGGNWFKEFYAY 199

Query: 62  -LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
               +  +   I  T  + P  +  + +    +   +      + +  +  G+IF     
Sbjct: 200 GFDDTLPNWVSIHGTYRDNPRADLNDIEEARRTVSKNYFRQEYEADFSVFEGQIFDTFNA 259

Query: 121 DIVINSLDIPEHWVQI-------GGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
              +  L    H+ +         G+D G+  P A   + ++ D+D  YV++ Y+  E+T
Sbjct: 260 IDHVKDLKGMRHFFKDDEAFETLLGIDVGYRDPTAVLTIKYHYDTDTYYVLEEYQQAEKT 319

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
              H A ++                 D+   +  +AQ+R+  +    E A+       V 
Sbjct: 320 TAQHAAYIQHCIDRYKV---------DRIFVDSAAAQFRQ-DLAYEHEIASAP-AKKSVL 368

Query: 234 AGISDMLDRMRSGRWKV 250
            G++ +    + G+  V
Sbjct: 369 DGLACLQALFQQGKIIV 385


>gi|288922855|ref|ZP_06417020.1| hypothetical protein FrEUN1fDRAFT_6718 [Frankia sp. EUN1f]
 gi|288345825|gb|EFC80189.1| hypothetical protein FrEUN1fDRAFT_6718 [Frankia sp. EUN1f]
          Length = 375

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 88/256 (34%), Gaps = 23/256 (8%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           + +  T    + DE    PE+ + + L R +     +  T  P   +  + + +L     
Sbjct: 118 RLRGLTCAGAYADELTLLPEEFFQQLLARCSVPGAKIFGTTNPDGPQHWLRKKFLLRVGD 177

Query: 68  -DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D      T+++ P  +    + +   Y     +    G+ ++  G I+ + +ED  +  
Sbjct: 178 LDLATWHFTLDDNPALDPTYVENLKKEYVGLWYKRFILGQWVMAEGAIYDMWDEDTHLVD 237

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPIFHVAA 180
                      G+D+G  +PF+   L    D   +Y+   +R       R  T   +   
Sbjct: 238 RLPSIERWLALGVDYGTVNPFSGLLLGLGND-RRLYLTHEWRWDSKLERRSLTDSQYSTR 296

Query: 181 LKSW------GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
           ++ W      G   P     +    D  S      Q    G+      A    G N V +
Sbjct: 297 VREWLTALDLGMNAPARVDPEWFIVD-PSAASFKTQLFSDGV------ANVMGGDNDVVS 349

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +   + + R +V
Sbjct: 350 GIRTVASLLGNDRLRV 365


>gi|116492550|ref|YP_804285.1| Phage terminase large subunit [Pediococcus pentosaceus ATCC 25745]
 gi|116102700|gb|ABJ67843.1| Phage terminase large subunit [Pediococcus pentosaceus ATCC 25745]
          Length = 423

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 43/254 (16%), Positives = 84/254 (33%), Gaps = 24/254 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T    +FDE    P+    +   R++ + G     + P         +++
Sbjct: 123 EASQDLVQGLTAAGFFFDEVALMPQSFVNQATARVSVSGGKYWFNMNPEGPYHWFKLNWI 182

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                 R + I   + + P  +E    R   +Y     +    G  ++  G I+     +
Sbjct: 183 DDLKGKRALRIHFRMEDNPSLSEDVIGRYKRNYSGVFYQRYILGLWVMSEGVIYDNFNRE 242

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPI 175
            ++ S            +D+G  +P     L+W   + V Y +K Y        R++T  
Sbjct: 243 TMVVSEPPGRCTKYYVSVDYGTQNPT--VFLLWGFYNGVWYCLKEYYYDGRHSARQKTDD 300

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +   L  +   +      +       S     A  R +  +++          N V  G
Sbjct: 301 QYANDLDEFVGNI------NARIIIDPSAASFIAVLRNRHYRIIR-------ADNDVLNG 347

Query: 236 ISDMLDRMRSGRWK 249
           I +    M +G  K
Sbjct: 348 IRETQSAMNNGLIK 361


>gi|268608029|ref|ZP_06141759.1| phage terminase large subunit [Ruminococcus flavefaciens FD-1]
          Length = 415

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 43/254 (16%), Positives = 78/254 (30%), Gaps = 23/254 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E      Q  T+  V+ DE    P     + L R + +   +     P          ++
Sbjct: 116 EGSAALIQGMTLSGVFLDEAALMPRSFVEQALARCSVSGSKMWFNCNPDNPAHWFYTEWI 175

Query: 63  SASSSDRQ-VIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +       I  T+++ P  ++  ++R    Y     +    G+     G ++P+  E 
Sbjct: 176 KKAEEKHALYIHFTMDDNPSLSDALKQRYKRLYSGAFYDRFVLGKWTASQGVVYPMFSEK 235

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ------TPI 175
             + S D+ E    +   D+G  +P +    +W     V Y +  Y    +      T  
Sbjct: 236 KHVYSGDV-ECERFVISCDYGTVNPSS--FGLWGLSGGVWYRLSEYYYSSKREGVSRTDE 292

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            H AAL+                    S        RR G              N V  G
Sbjct: 293 EHYAALERLAGGREI-----SRVIVDPSAASFIECIRRHG------RFRVVKADNDVITG 341

Query: 236 ISDMLDRMRSGRWK 249
           I ++   +   R +
Sbjct: 342 IRNVSTALSENRLR 355


>gi|264678784|ref|YP_003278691.1| phage DNA packaging protein Gp2 [Comamonas testosteroni CNB-2]
 gi|262209297|gb|ACY33395.1| putative phage DNA packaging protein Gp2 [Comamonas testosteroni
           CNB-2]
          Length = 434

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 72/221 (32%), Positives = 119/221 (53%), Gaps = 12/221 (5%)

Query: 35  TRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD----RQVIRMTINETPHYNEQERKRI 90
            R+   +G+  LT TPL G + +++   S         R V++   ++ PH  E+ + ++
Sbjct: 1   MRLMTREGISMLTFTPLSGLTALVQQLTSPDPEGKVIGRAVVQCGWDDVPHLTEEAKAKL 60

Query: 91  IDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAG 150
           +     H+R+ARTKG P LG+G I+P+ E DIV+    +P+ W +  GMD GW +  +A 
Sbjct: 61  LSRLMPHQRDARTKGVPALGAGAIYPVPESDIVVPDFQLPDFWPRAYGMDVGW-NRTSAV 119

Query: 151 HLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQ 210
               +RDSD++Y+  N+   +  P  H  ++K+ G W+P A         ++ GEQL   
Sbjct: 120 WGAHDRDSDIVYLYSNHYRGQAEPSVHATSIKARGDWIPGAIDPASRGRSQKDGEQLLQN 179

Query: 211 YRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
           Y   G++++         +NGVEAGI  + +RM +GR KVF
Sbjct: 180 YVDLGLQLVT-------ANNGVEAGIYQVWERMSTGRLKVF 213


>gi|317055978|ref|YP_004104445.1| phage terminase large subunit, PBSX family [Ruminococcus albus 7]
 gi|315448247|gb|ADU21811.1| phage terminase, large subunit, PBSX family [Ruminococcus albus 7]
          Length = 409

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/255 (16%), Positives = 76/255 (29%), Gaps = 22/255 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E      Q  T+  +  DE    P     + + R +     +     P          ++
Sbjct: 112 EASSALIQGVTLAGILLDETALMPRSFVEQAVARCSVRGSKLWFNCNPDNPYHWFKREWI 171

Query: 63  SASSSDRQ-VIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             ++      I   + + P  +E+ ++R    Y     E    G      G I+P+ +E 
Sbjct: 172 DKAAEKNLLYIHFELKDNPSLSEEVKRRYERLYSGAFYERFVLGRWSAAEGLIYPMFDEK 231

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPI 175
             +      +        D+G  +P +    +W    D+ Y +  Y          +T  
Sbjct: 232 KYVCDKAPDDCERFAVSCDYGTVNPSS--FGLWGLKDDIWYRIGEYYYDSAKEGSRRTDE 289

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            H  AL+         +    +  D  S        RR G              N V  G
Sbjct: 290 EHYDALEELAGDRDIDY----VVCD-PSAASFIQCIRRHG------KFRVIQAKNDVVTG 338

Query: 236 ISDMLDRMRSGRWKV 250
           I    D +R GR  +
Sbjct: 339 IRRTQDMIRGGRLMI 353


>gi|294478923|gb|ADE87488.1| large subunit terminase [Deep-sea thermophilic phage D6E]
          Length = 427

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/249 (16%), Positives = 85/249 (34%), Gaps = 20/249 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  ++FDE    PE    +   R +     +     P          YL
Sbjct: 125 ESSQDLIQGITLAGMFFDEVALMPESFVNQATARCSVDGAKLWFNCNPAGPYHWFKVEYL 184

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                   +    T+++    ++Q ++R    Y     +    G  +L  G I+ + ++D
Sbjct: 185 DKLDEKNLLHLHFTMDDNLSLSKQVKERYQRMYKGVFYQRYILGLWVLAEGIIYDMFDQD 244

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNY------RCREQTPI 175
             +       +       D+G  +P      +W   + V Y VK Y        +++T  
Sbjct: 245 EHVVPTVPRPYEKYYVSCDYGTQNPTT--FGLWGLYNGVWYKVKEYHYDGRKENKQKTDQ 302

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +   L  + + +        +     S     A  R++G+K++          N V  G
Sbjct: 303 EYYEDLMKFIEDIEKHKFKGVIV--DPSAASFIALLRQKGIKVI-------KAKNDVLDG 353

Query: 236 ISDMLDRMR 244
           I ++   + 
Sbjct: 354 IRNVATALN 362


>gi|326791841|ref|YP_004309662.1| phage terminase, large subunit, PBSX family [Clostridium
           lentocellum DSM 5427]
 gi|326542605|gb|ADZ84464.1| phage terminase, large subunit, PBSX family [Clostridium
           lentocellum DSM 5427]
          Length = 434

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/260 (14%), Positives = 78/260 (30%), Gaps = 28/260 (10%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E+ +D  Q  T+   +FDE    PE    +   R +           P         +++
Sbjct: 125 ERSQDLIQGITLAGCFFDEVALMPESFVNQATGRCSVDGSKFWFNCNPDGPYHWFKVNWI 184

Query: 63  SASSSDR-QVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFP-IVEE 120
                     +  T+++     E+ ++R    Y     +   KG   +  G I+    +E
Sbjct: 185 DKQVEKNLLYLHFTMDDNLSLTEKIKQRYRSMYSGVFYDRYIKGLWAVAEGIIYDMFHKE 244

Query: 121 DIVINSLDIPEH-----WVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE---- 171
             +++  ++  +       +   +D+G  +P          D +  Y  + Y        
Sbjct: 245 KHIVDVQELIANGLTFLGEKYVSIDYGTQNPTVFLLWELASDKN-WYCTREYHYSGRSEA 303

Query: 172 --QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGS 229
             +T   +V  L          W  D            ++        +L         +
Sbjct: 304 SQKTDSEYVEDLTE--------WLGDTQVRFVIVDPSAASFIAE----LLKHKFKVKKAN 351

Query: 230 NGVEAGISDMLDRMRSGRWK 249
           N V  GI  +   +  G+  
Sbjct: 352 NSVLDGIRLVATLLTEGKIF 371


>gi|291544739|emb|CBL17848.1| phage terminase, large subunit, PBSX family [Ruminococcus sp.
           18P13]
          Length = 414

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/255 (16%), Positives = 85/255 (33%), Gaps = 21/255 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E      Q  T+   + DE    P     +   R + +   +     P        + ++
Sbjct: 115 ESSAALIQGITLAGAFLDEVALMPRSFVEQAAARCSVSGSRLWFNCNPDSAEHWFYKEWI 174

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIV-EE 120
              +    +    T+ +    +++ R+R    Y     +   KG   +  G ++P   + 
Sbjct: 175 CKKTEKNALHLHFTMQDNYALDKKIRERYERLYTGVFYDRYIKGLWCMAEGLVYPNWSDR 234

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ-----TPI 175
            ++   + + ++      +D+G  +PF+AG    +   + I V + Y   ++     T  
Sbjct: 235 YVLHGDIRLSQNVEWYIAIDYGTINPFSAGLWAVSP-RNAIRVAEYYYNSKEERTMRTDE 293

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            H AAL+      P             S        RR G        T     N V  G
Sbjct: 294 EHYAALEQLAGDRPIQ-----HVIVDPSAASFIECIRRHG------RFTVRKAHNEVLPG 342

Query: 236 ISDMLDRMRSGRWKV 250
           IS     +++GR  +
Sbjct: 343 ISRTATLIQNGRILI 357


>gi|326775607|ref|ZP_08234872.1| phage terminase, large subunit, PBSX family [Streptomyces cf.
           griseus XylebKG-1]
 gi|326655940|gb|EGE40786.1| phage terminase, large subunit, PBSX family [Streptomyces cf.
           griseus XylebKG-1]
          Length = 416

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/253 (18%), Positives = 87/253 (34%), Gaps = 18/253 (7%)

Query: 8   RDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
            ++ +  T      DE    P++ + + L R++     +  +  P      +   ++   
Sbjct: 114 EERLRGMTCAGALVDEATLVPQEFWTQLLGRMSVPGAKLFASTNPGSPAHWLKRDFIDRR 173

Query: 66  SS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
                +     +++ P   +  +  I + +          GE I   G IF + +E+  +
Sbjct: 174 DELGIRYWHYVLDDNPSLGDDYKNSIKNEFVGLWYRRFVLGEWIAAEGSIFDMWDEEKHV 233

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPIFHV 178
                        G+D+G  +PF A  L   RD   +Y    +R       R+ T I + 
Sbjct: 234 VDTLPEIAKWISVGVDYGQTNPFHATLLGLGRD-RRLYAASEWRYDGRQQRRQLTDIEYS 292

Query: 179 AALKSWGKWLPWAWPHDGLQHD-KRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
             ++ W   +    P          S    SAQ RR       +  T    +N V  GI 
Sbjct: 293 ERMRGWLSNVAGIGPVRPQFVTVDPSAASFSAQLRR-------DRLTPTPANNAVLDGIR 345

Query: 238 DMLDRMRSGRWKV 250
            M   + +G+  V
Sbjct: 346 TMASLLSAGKLVV 358


>gi|291541718|emb|CBL14828.1| phage terminase, large subunit, PBSX family [Ruminococcus bromii
           L2-63]
          Length = 419

 Score =  129 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 42/255 (16%), Positives = 73/255 (28%), Gaps = 23/255 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E      Q  T+  V FDE    P     + L R + +         P          ++
Sbjct: 117 ESSASLIQGMTLSGVLFDEVALMPRSFVEQALARCSVSGSRFWFNCNPEFPEHWFYREWI 176

Query: 63  SASSSDRQ-VIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                     +  T+ + P    +  KR    Y     E   KG  +   G ++P ++ +
Sbjct: 177 KKCGDKNALYLHFTMQDNPSLKPEVIKRYESLYSGVFYERFVKGRWVAVFGAVYPFMDNE 236

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR------EQTPI 175
            +   +            D+G  +P +    +W R + V Y V  Y         ++T  
Sbjct: 237 RMYCDIPSDIESW-AVSCDYGTVNPAS--FGLWGRKNGVWYRVDEYYFNSRTQGFQKTDE 293

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            H   L+                    S        RR G        T     N V  G
Sbjct: 294 EHYDGLEKLIDGRKI-----ECVIVDPSAASFIEVIRRHG------KYTVVSAENNVING 342

Query: 236 ISDMLDRMRSGRWKV 250
           I      ++  + ++
Sbjct: 343 IRQTSQALKDRKIRI 357


>gi|121534831|ref|ZP_01666651.1| protein of unknown function DUF264 [Thermosinus carboxydivorans
           Nor1]
 gi|121306626|gb|EAX47548.1| protein of unknown function DUF264 [Thermosinus carboxydivorans
           Nor1]
          Length = 845

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/300 (14%), Positives = 87/300 (29%), Gaps = 63/300 (21%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED----VYFEGLTRINATQGLVTLTLTPLKGR---SPIIE 59
              ++Q +   Y+ FDE    D    +Y     R +       +      G      +  
Sbjct: 483 DELRYQGHEYQYIAFDELTHFDERQYLYLLSRCRTSDPALRCYVRAASNPGGPGHHWVKA 542

Query: 60  HYLSASSSD-----------RQVIRMTINETPHY--NEQERKRIIDSYPLHEREARTKGE 106
            ++  +              R  +   + + P     +    + ++S P  ER+A   G+
Sbjct: 543 RFIDVAPPGKTYVDPVTGLTRCFVPARVFDNPILLRADPLYLKRLESLPEAERKALLLGD 602

Query: 107 PILGSGRIFPIVEED-IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVK 165
               +G++F     D  V+    IP  W++   MD+G+  P+       +  + VIYV +
Sbjct: 603 WDAFAGQVFSEWRRDVHVVEPFAIPAGWLRFRAMDWGFSKPYCILWFAVDY-NGVIYVYR 661

Query: 166 NYRC---------REQTPIFHVAALKSWGKWL--------------------PWAWPHDG 196
                         ++T       +K+   W                             
Sbjct: 662 ELYGLKPGCVDVGTQETAREVAQKVKAAEDWKNFIADEGVKLETQLSGEKIAYGVADPAC 721

Query: 197 LQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM-----RSGRWKVF 251
                  G  ++  +  +G+   P         N    G   +  R+          KVF
Sbjct: 722 WAKTGHDGPSIAETFASEGVFWKP-------ADNDRLQGKMQVHLRLRGWGPERPGLKVF 774


>gi|167771112|ref|ZP_02443165.1| hypothetical protein ANACOL_02466 [Anaerotruncus colihominis DSM
           17241]
 gi|167666782|gb|EDS10912.1| hypothetical protein ANACOL_02466 [Anaerotruncus colihominis DSM
           17241]
          Length = 434

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 42/253 (16%), Positives = 75/253 (29%), Gaps = 23/253 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E      Q  T+  V FDE    P     + L R +  +     +  P   +      ++
Sbjct: 118 EGSAALIQGATLSGVLFDEAALMPRSFVEQALARCSDERARFWFSCNPEHPQHWFYTEWI 177

Query: 63  SASSSDRQ-VIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +       +  T+ + P  +E   +R    Y     +    G+     G ++P+ +  
Sbjct: 178 LQAHEKSALYLHFTMRDNPSLSEAVLRRYERLYAGTFYDRFVLGKWTAAQGAVYPMFDPA 237

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE------QTPI 175
           + +     P+        D+G  +P +    +W     V Y +  Y          +T  
Sbjct: 238 VHV-VEHAPQCGRFYISCDYGTVNPAS--FGLWGESGGVWYRIAEYYHDSRRTGEVKTDE 294

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +  AL +                   S     A  RR G              N V  G
Sbjct: 295 QYYEALAALAGERRVEAVIV-----DPSAASFIACIRRHG------RFRVVPARNEVAEG 343

Query: 236 ISDMLDRMRSGRW 248
           I  +  R+R  R 
Sbjct: 344 IQAVSRRLREKRL 356


>gi|268608995|ref|ZP_06142722.1| Phage terminase large subunit [Ruminococcus flavefaciens FD-1]
          Length = 421

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 38/255 (14%), Positives = 81/255 (31%), Gaps = 22/255 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQG-LVTLTLTPLKGRSPIIEHY 61
           E      Q  T+  V FDE    PE    + + R  +  G  +  +  P         ++
Sbjct: 115 EASYKLVQGITLAGVLFDEVALMPESFVNQAIARTLSVSGAKLWFSCNPDSPAHWFYTNW 174

Query: 62  LSASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +  +     + I   + + P    ++ +R   ++     +    G+ ++  G ++ + + 
Sbjct: 175 ILKAQEKNALRIHFRMEDNPVMTPEKIRRTESTFSGVFYQRYVLGDWVVAEGLVYTMFDR 234

Query: 121 -DIVINSLDIPEHW---VQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ---- 172
            + + N+ D+            +D+G  +P + G    +       + ++Y    +    
Sbjct: 235 AEHIFNAGDLTVDPVAGDMFISIDYGTKNPTSMGLWYVDISGHAWRIRESYYDGRKGGSP 294

Query: 173 -TPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
            T   H A L+              +     S        RR G              N 
Sbjct: 295 RTDEEHYAELERLAGEYTDFIGSVIV---DPSAASFIECIRRHG------TFRVRKADND 345

Query: 232 VEAGISDMLDRMRSG 246
           V  GI D    ++ G
Sbjct: 346 VIDGIRDTQTLLQLG 360


>gi|160934785|ref|ZP_02082171.1| hypothetical protein CLOLEP_03660 [Clostridium leptum DSM 753]
 gi|156866238|gb|EDO59610.1| hypothetical protein CLOLEP_03660 [Clostridium leptum DSM 753]
          Length = 420

 Score =  127 bits (320), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 45/250 (18%), Positives = 75/250 (30%), Gaps = 24/250 (9%)

Query: 11  WQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS- 67
            Q  T+  +  DE    P     + L R +           P   R    E ++      
Sbjct: 123 IQGITLAGILLDEVALMPRSFVEQALARCSVEGSKFWFNCNPEHPRHWFYEEWIQKRDEK 182

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSL 127
           +   +   + + P  +E+  +R    Y     +   +G  +   G ++P +EE       
Sbjct: 183 NAYYLHFRMEDNPSLSEKMIERYRGLYSGSFYQRFIEGRWVAAEGLVYPFMEEPDRFLPP 242

Query: 128 DIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE------QTPIFHVAAL 181
                   I   D+G  +P +    +W R   V Y +K Y          +T   H   L
Sbjct: 243 PEGPFEEFIVSCDYGTVNPAS--FGLWGRKEGVWYRLKEYYYDSKRDGGPKTDEEHYQGL 300

Query: 182 KS-WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
            S  G   P     D       S        RR G              N V  GI  + 
Sbjct: 301 VSLLGARRPRCVIVD------PSAASFQEVIRRHG------EYRVIPAKNNVLDGIRQVS 348

Query: 241 DRMRSGRWKV 250
             ++ G  ++
Sbjct: 349 TALKEGAVEI 358


>gi|310658835|ref|YP_003936556.1| terminase, large subunit [Clostridium sticklandii DSM 519]
 gi|308825613|emb|CBH21651.1| Terminase, large subunit [Clostridium sticklandii]
          Length = 429

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/249 (14%), Positives = 77/249 (30%), Gaps = 15/249 (6%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E+ +D  Q  T+   +FDE    PE    +   R +           P          ++
Sbjct: 124 ERSQDLVQGITLAGCFFDEVALMPESFVNQATGRCSVDGSKWWFNCNPNGPFHWFKTDWI 183

Query: 63  SASSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +   +   +  T+++    +E+ ++R    Y     +    G  +L  G I+ +  ED
Sbjct: 184 DKAIDKNILYLHFTMDDNLSLSEKIKERYRKMYSGVFFKRYILGLWVLAEGIIYDMFTED 243

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE--QTPIFHVA 179
             I       +       D+G  +P      ++       Y VK Y      +      +
Sbjct: 244 DHIVPSKDRTYSKFYVSCDYGTQNPTT--FGMYGEYLGKWYKVKEYYYSGRKEGKQKTDS 301

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
                 +     +  +G+  D  +   ++         +           N V  GI  +
Sbjct: 302 EFADDYEKFIEGYEVEGIIVDPSAASFIAE--------LRKRNHRVIKAKNDVLDGIRSV 353

Query: 240 LDRMRSGRW 248
              ++ G +
Sbjct: 354 GTLLKMGVF 362


>gi|191638099|ref|YP_001987265.1| Putative phage terminase large subunit B [Lactobacillus casei BL23]
 gi|190712401|emb|CAQ66407.1| Putative phage terminase large subunit B [Lactobacillus casei BL23]
 gi|327385325|gb|AEA56799.1| hypothetical protein LCBD_1302 [Lactobacillus casei BD-II]
          Length = 417

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 84/254 (33%), Gaps = 25/254 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  ++FDE    P+    +   R++ T G     + P          ++
Sbjct: 116 ESSQDLIQGITLAGMFFDEAALMPQSFVNQATARVSVTGGKYWFNMNPEGPYHWFKTDWI 175

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +   R + +   + + P  +++   R    Y     +    G+ +L  G ++    +D
Sbjct: 176 DQADEKRALRLHFVMTDNPSLSDEVIDRYEHMYSGVFYQRYILGQWVLADGIVYDNFNKD 235

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRC------REQTPI 175
            ++++            +D+G  +P     L+W +   V Y +K Y        R++T  
Sbjct: 236 EMVSNPSQQPS-RYYVSVDYGTQNPT--VFLLWGKCGSVWYCLKEYYYDGRHSSRQKTDD 292

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +      +   +      D       S      + R                 N V  G
Sbjct: 293 EYARDFSQFVGDIRCEVIVD------PSAASFITKLRE-------RRYRVIKADNDVLNG 339

Query: 236 ISDMLDRMRSGRWK 249
           I +    M SG  K
Sbjct: 340 IRETQTAMNSGEIK 353


>gi|225871048|ref|YP_002746995.1| phage terminase, large subunit [Streptococcus equi subsp. equi
           4047]
 gi|225700452|emb|CAW94859.1| putative phage terminase, large subunit [Streptococcus equi subsp.
           equi 4047]
          Length = 415

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 84/248 (33%), Gaps = 18/248 (7%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   V  V  +E      D Y +   R+   +     + L   P+   
Sbjct: 105 FKGLD-NPEKIKSIKGVSDVVMEEASEFTLDDYTQLTLRLRDRKHLKKQIFLMFNPVSKV 163

Query: 55  SPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRI 114
           + + + +   +  +  V + T  +    ++  R+ I +    +E   +        +   
Sbjct: 164 NWVYKAFFVKTPKNTVVYQTTYKDNRFLDDVTRENIEELANRNEAYYKIYALGQFATLDK 223

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
               + +  I + D   H     G+D+G+ + P A  H+  + ++  +Y+++ Y  +  T
Sbjct: 224 LIFPKYEKKILNKDKLSHLPSFFGLDYGFINDPSAFLHVKIDDNNKKLYILEEYVRKNLT 283

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                 A+K  G            +           + R  G+   P       G   V 
Sbjct: 284 NDKIANAIKDLGYAKEEIRGDSAEKKSN-------QELRNLGI---PRIIDVKKGPGSVM 333

Query: 234 AGISDMLD 241
            GI  +L 
Sbjct: 334 QGIQYLLQ 341


>gi|116495400|ref|YP_807134.1| Phage terminase large subunit [Lactobacillus casei ATCC 334]
 gi|89953853|gb|ABD83384.1| phage terminase large subunit [Lactobacillus casei ATCC 334]
 gi|116105550|gb|ABJ70692.1| Phage terminase large subunit [Lactobacillus casei ATCC 334]
          Length = 417

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/254 (16%), Positives = 87/254 (34%), Gaps = 25/254 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  ++FDE    P+    +   R++ T G     + P          ++
Sbjct: 116 ESSQDLIQGITLAGMFFDEAALMPQSFVNQATARVSVTGGKYWFNMNPEGPYHWFKTDWI 175

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +   R + +   + + P  +++   R    Y     +    G+ +L  G ++   ++D
Sbjct: 176 DQADDKRALRLHFVMTDNPSLSDEVIDRYEHMYSGVFYQRYILGQWVLADGIVYDNFDKD 235

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRC------REQTPI 175
            ++++            +D+G  +P     L+W +   V Y +K Y        R++T  
Sbjct: 236 EMVSNPSQQPS-RYYVSVDYGTQNPT--VFLLWGKCGSVWYCLKEYYYDGRHSSRQKTDD 292

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +      +   +      D            ++      +K+           N V  G
Sbjct: 293 EYARDFSQFVGDIRCEVIVD---------PSAASFI----VKLRERRYRVIKADNDVLNG 339

Query: 236 ISDMLDRMRSGRWK 249
           I +    M SG  K
Sbjct: 340 IRETQTAMNSGEIK 353


>gi|323480189|gb|ADX79628.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           62]
          Length = 429

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 70/249 (28%), Gaps = 13/249 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T    +FDE    P+    +   R++           P          +L
Sbjct: 127 EASQDLVQGLTAAGFFFDEVALMPQSFVNQATARLSVDGAKSWFNCNPAGPHHWFKLEWL 186

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE-E 120
              +    + I  T+ + P  +E+   R    Y     +   +G  +L  G IF   + E
Sbjct: 187 DKLTEKHAIRIHFTMEDNPSLSERVINRYKRMYSGVFYDRYIRGLWVLSEGIIFDNFDAE 246

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            +V               +D+G  +          +  +  Y +  Y    +      + 
Sbjct: 247 TMVKEPPKNAIASQYYVSIDYGTQNATVFLLWA--KYEENWYCIDEYYYSGRDESKQKSD 304

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
            K       +            S     A  R  G K++          N V  GI    
Sbjct: 305 DKYLKDLNSFVEGKKVKIIVDPSAASFIALLRENGYKVI-------KAKNNVIDGIRATQ 357

Query: 241 DRMRSGRWK 249
             M  G+  
Sbjct: 358 TAMNEGKIY 366


>gi|293382499|ref|ZP_06628433.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           R712]
 gi|293387900|ref|ZP_06632439.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           S613]
 gi|312906897|ref|ZP_07765894.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           DAPTO 512]
 gi|312978848|ref|ZP_07790574.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           DAPTO 516]
 gi|291080047|gb|EFE17411.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           R712]
 gi|291082747|gb|EFE19710.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           S613]
 gi|310627151|gb|EFQ10434.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           DAPTO 512]
 gi|311288285|gb|EFQ66841.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           DAPTO 516]
          Length = 430

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 70/249 (28%), Gaps = 13/249 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T    +FDE    P+    +   R++           P          +L
Sbjct: 128 EASQDLVQGLTAAGFFFDEVALMPQSFVNQATARLSVDGAKSWFNCNPAGPHHWFKLEWL 187

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE-E 120
              +    + I  T+ + P  +E+   R    Y     +   +G  +L  G IF   + E
Sbjct: 188 DKLTEKHAIRIHFTMEDNPSLSERVINRYKRMYSGVFYDRYIRGLWVLSEGIIFDNFDAE 247

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            +V               +D+G  +          +  +  Y +  Y    +      + 
Sbjct: 248 TMVKEPPKNAIASQYYVSIDYGTQNATVFLLWA--KYEENWYCIDEYYYSGRDESKQKSD 305

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
            K       +            S     A  R  G K++          N V  GI    
Sbjct: 306 DKYLKDLNSFVEGKKVKIIVDPSAASFIALLRENGYKVI-------KAKNNVIDGIRATQ 358

Query: 241 DRMRSGRWK 249
             M  G+  
Sbjct: 359 TAMNEGKIY 367


>gi|257415566|ref|ZP_05592560.1| phage terminase large subunit [Enterococcus faecalis AR01/DG]
 gi|257157394|gb|EEU87354.1| phage terminase large subunit [Enterococcus faecalis ARO1/DG]
          Length = 429

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 70/249 (28%), Gaps = 13/249 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T    +FDE    P+    +   R++           P          +L
Sbjct: 127 EASQDLVQGLTAAGFFFDEVALMPQSFVNQATARLSVDGAKSWFNCNPAGPHHWFKLEWL 186

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE-E 120
              +    + I  T+ + P  +E+   R    Y     +   +G  +L  G IF   + E
Sbjct: 187 DKLTEKHAIRIHFTMEDNPSLSERVINRYKRMYSGVFYDRYIRGLWVLSEGIIFDNFDAE 246

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            +V               +D+G  +          +  +  Y +  Y    +      + 
Sbjct: 247 TMVKEPPKNAIASQYYVSIDYGTQNATVFLLWA--KYEENWYCIDEYYYSGRDESKQKSD 304

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
            K       +            S     A  R  G K++          N V  GI    
Sbjct: 305 DKYLKDLNSFVEGKKVKIIVDPSAASFIALLRENGYKVI-------KAKNNVIDGIRATQ 357

Query: 241 DRMRSGRWK 249
             M  G+  
Sbjct: 358 TAMNEGKIY 366


>gi|167746088|ref|ZP_02418215.1| hypothetical protein ANACAC_00783 [Anaerostipes caccae DSM 14662]
 gi|167654603|gb|EDR98732.1| hypothetical protein ANACAC_00783 [Anaerostipes caccae DSM 14662]
          Length = 421

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/251 (15%), Positives = 80/251 (31%), Gaps = 22/251 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E+ +D  Q  T+  V+FDE    PE    +   R +           P         +++
Sbjct: 126 ERSQDLIQGITLAGVFFDEVALMPESFVNQATGRCSVDGSKFWFNCNPDGPYHWFKTNWI 185

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +   R V    T+ +     E+ + R    Y     +    G   +  G IF + + +
Sbjct: 186 DRAEEKRLVYLHFTMEDNLSLTERIKARYRSMYSGVFYKRYILGLWAVAEGIIFDMFDAE 245

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE------QTPI 175
             I +        +   +D+G  +         N         K Y          +T  
Sbjct: 246 KHIVNGSQESIGSRYISIDYGTQNATVFLLWGKNLKG-KWICSKEYYYSGRDESSQKTDS 304

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +   L+ + K +      + +  D  +     A+ +++G ++           N V  G
Sbjct: 305 EYADDLEEFTKGIDI----ERVIVDPAAA-SFIAELKKRGFRI-------KKAKNDVLDG 352

Query: 236 ISDMLDRMRSG 246
           I  + + +  G
Sbjct: 353 IRFVGNMLNLG 363


>gi|30061788|ref|NP_835959.1| putative terminase large subunit [Shigella flexneri 2a str. 2457T]
 gi|30040030|gb|AAP15764.1| putative terminase large subunit [Shigella flexneri 2a str. 2457T]
          Length = 186

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 87/184 (47%), Positives = 120/184 (65%)

Query: 19  VWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINE 78
           +WFDEEPP  +Y EGLTR N       LT TPL G S ++  +L   S  ++V+ MTI +
Sbjct: 1   MWFDEEPPYSIYGEGLTRTNKYGQFSILTFTPLMGMSDVVTKFLKNPSKSQKVVNMTIYD 60

Query: 79  TPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGG 138
             HY ++++++II SYP HEREAR +G P +GSGRIF I EE I     + P+H+  IGG
Sbjct: 61  AEHYTDEQKEQIIASYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIGG 120

Query: 139 MDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQ 198
           MDFGW HP A   L W++++D IYV + ++ +E+T +    A+KSW   +P AWPHDG Q
Sbjct: 121 MDFGWDHPQAQVQLWWDKEADTIYVSRVWKAKEKTAVQAWGAVKSWAHKVPTAWPHDGNQ 180

Query: 199 HDKR 202
           H+K 
Sbjct: 181 HEKG 184


>gi|239631319|ref|ZP_04674350.1| phage terminase large subunit [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|239525784|gb|EEQ64785.1| phage terminase large subunit [Lactobacillus paracasei subsp.
           paracasei 8700:2]
          Length = 417

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/254 (16%), Positives = 84/254 (33%), Gaps = 25/254 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  ++FDE    P+    +   R++ T G     + P          ++
Sbjct: 116 ESSQDLIQGITLAGMFFDEAALMPQSFVNQATARVSVTGGKYWFNMNPEGPYHWFKTDWI 175

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +   R + +   + + P  +++   R    Y     +    G+ +L  G ++    +D
Sbjct: 176 DQADDKRALRLHFVMTDNPSLSDEVIDRYEHMYSGVFYQRYILGQWVLADGIVYDNFNKD 235

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRC------REQTPI 175
            ++N+            +D+G  +P     L+W +   V Y +K Y        R++T  
Sbjct: 236 GMVNNPSQQPS-RYYVSVDYGTQNPT--VFLLWGKCGSVWYCLKEYYYDGRHSSRQKTDD 292

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +      +   +      D       S      + R                 N V  G
Sbjct: 293 EYARDFSQFVGDIHCEVIVD------PSAASFITKLRE-------RRYRVIKADNDVLNG 339

Query: 236 ISDMLDRMRSGRWK 249
           I +    M SG  K
Sbjct: 340 IRETQTAMNSGEIK 353


>gi|289434977|ref|YP_003464849.1| phage terminase large subunit [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171221|emb|CBH27763.1| phage terminase large subunit [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 430

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/255 (16%), Positives = 89/255 (34%), Gaps = 26/255 (10%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  ++FDE    P+    + + R++           P          ++
Sbjct: 127 ESSQDLIQGITLAGMFFDEVALMPKSFVEQAIARLSIDGAKQWFNCNPDSPYHWFKLEFI 186

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +   + ++   T+++    +E+ ++R   S+     +    G  ++  G I+ +  +D
Sbjct: 187 DGAEEKQMLVLHFTMDDNLSLSERVKERYKRSFTGIFYQRYILGLWVMAEGVIYDMFNKD 246

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAA-GHLVWNRDSDVIYVVKNYRCRE------QTP 174
             +   +   +       D+G  +PFA     +++    V Y V+ Y          +T 
Sbjct: 247 KHVVKTEDRPYTRYYISCDYGTQNPFALGLWGLYD---GVWYKVREYHYGGREKGIQRTD 303

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
             +  AL  +   L      D       S        R++G K++          N V  
Sbjct: 304 EQYFTALDDFANRLTKKVIID------PSATSFITLVRQKGWKVI-------KAKNDVLE 350

Query: 235 GISDMLDRMRSGRWK 249
           GI ++   +     K
Sbjct: 351 GIRNVASCLGEESIK 365


>gi|315032537|gb|EFT44469.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0017]
          Length = 427

 Score =  125 bits (313), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 70/249 (28%), Gaps = 13/249 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T    +FDE    P+    +   R++           P          +L
Sbjct: 128 EASQDLVQGLTAAGFFFDEVALMPQSFVNQATARLSVDGAKSWFNCNPAGPHHWFKLEWL 187

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE-E 120
              +    + I  T+ + P  +E+   R    Y     +   +G  +L  G IF   + E
Sbjct: 188 DKLTEKHAIRIHFTMEDNPSLSERVINRYKRMYSGVFYDRYIRGLWVLSEGIIFDNFDAE 247

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            +V               +D+G  +          +  +  Y +  Y    +      + 
Sbjct: 248 TMVKEPPKNAIASQYYVSIDYGTQNATVFLLWA--KYEENWYCIDEYYYSGRDESKQKSD 305

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
            K       +            S     A  R  G K++          N V  GI    
Sbjct: 306 DKYLKDLNSFVEGKKVKIIVDPSAASFIALLRENGYKVI-------KAQNNVIDGIRATQ 358

Query: 241 DRMRSGRWK 249
             M  G+  
Sbjct: 359 TAMNEGKIY 367


>gi|154496017|ref|ZP_02034713.1| hypothetical protein BACCAP_00300 [Bacteroides capillosus ATCC
           29799]
 gi|150274900|gb|EDN01956.1| hypothetical protein BACCAP_00300 [Bacteroides capillosus ATCC
           29799]
          Length = 415

 Score =  125 bits (313), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 41/255 (16%), Positives = 77/255 (30%), Gaps = 25/255 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E      Q  T+  V  DE    P     +   R +     +     P        + ++
Sbjct: 115 EGSAALIQGVTLAGVLLDEVALMPRSFVEQACARCSVAGSRLWFNCNPEGPEHWFYKEWI 174

Query: 63  SASSSDRQ-VIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +   R   +  T+ + P    + + R    +          GE +   GR++   +E 
Sbjct: 175 QKAEERRALYLHFTMEDNPGLRPEVKARYGRMFSGAFYRRFVLGEWVAAEGRVYDFFDES 234

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPI 175
            +    D    W      D+G  +P + G   W     + Y VK +        R++T  
Sbjct: 235 YLEEPPDGLSRW--CISCDYGTVNPASFGLWGW--KDGIWYRVKEFYYNSRETKRQKTDG 290

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            +   L+              +     S        RR+G ++L          N V +G
Sbjct: 291 EYAQDLRELAGGRDI-----WMVVVDPSAASFIEVLRREGWRVL-------KAENDVLSG 338

Query: 236 ISDMLDRMRSGRWKV 250
           I      +R  +  +
Sbjct: 339 IRTTAGLLREKKLVI 353


>gi|39653713|ref|NP_945278.1| terminase, large subunit [Streptococcus phage EJ-1]
 gi|38638881|emb|CAE82121.1| terminase, large subunit [Streptococcus phage EJ-1]
          Length = 421

 Score =  125 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 86/256 (33%), Gaps = 23/256 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  ++FDE    PE    +G  R + T         P         +++
Sbjct: 127 ESSQDLIQGLTLAGIFFDEVALMPESFVNQGTGRCSVTGSKWWFNCNPDGPYHWFKVNWI 186

Query: 63  SA-SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIV-EE 120
               + +   +   +++    +E  +KR    Y     +   +G   +  G ++ +  ++
Sbjct: 187 DKAETKNMLYLHFDMDDNLSLSENIKKRYRSQYQGVFYQRYIQGLWTVAEGIVYDMFSKD 246

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE------QTP 174
             V+++L       +   +D+G  +         +      Y+ + Y          +T 
Sbjct: 247 KHVVSTLPEMSKLGKYVSVDYGTQNATVFLLWEKDIIG-KYYLTREYYYSGRDENVQKTN 305

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
             +   L +W          D +  D  S     A+ +++G K+           N V  
Sbjct: 306 AEYADDLTAWLGDTNI----DRIIID-PSAASFIAELKKRGYKI-------KKARNNVLE 353

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +   +   +  V
Sbjct: 354 GIRFVGSMLGQEKIAV 369


>gi|310828790|ref|YP_003961147.1| hypothetical protein ELI_3215 [Eubacterium limosum KIST612]
 gi|308740524|gb|ADO38184.1| hypothetical protein ELI_3215 [Eubacterium limosum KIST612]
          Length = 441

 Score =  125 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 44/273 (16%), Positives = 83/273 (30%), Gaps = 42/273 (15%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E+ +D  Q  T+  V+FDE    PE    +   R +           P         +++
Sbjct: 124 ERSQDLIQGITLAGVFFDEVALMPESFVNQATGRCSVDGSKFWFNCNPDGPYHWFKLNWI 183

Query: 63  SASS------------------SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK 104
              +                   D   +  T+ +    +E+ + R    Y     +    
Sbjct: 184 DQCTGYLTRKQQEELRNKNIELKDILYLHFTMEDNLSLSEKIKARYRAMYTGVFYKRYIL 243

Query: 105 GEPILGSGRIFPIVEE-DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYV 163
           G      G I+ + ++   V++ +            D+G  +              V Y 
Sbjct: 244 GLWCAADGLIYDMFDKAKHVVSQIKETLLPKHYVSCDYGTQNATVFLLWQRGESG-VWYC 302

Query: 164 VKNYRCRE------QTPIFHVAALKS-WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGM 216
           ++ Y          +T I +V  LK   G   P A   D       S     AQ ++ G 
Sbjct: 303 IREYYYSGRDESKQKTDIQYVEDLKQFLGGIKPTAVVVD------PSAASFIAQLKQSGF 356

Query: 217 KMLPECATFDDGSNGVEAGISDMLDRMRSGRWK 249
           ++           N V  GI  +  ++  G+ +
Sbjct: 357 RV-------KKAKNDVLDGIRFVGTQLNLGKIR 382


>gi|77405323|ref|ZP_00782419.1| phage terminase, large subunit, PBSX family [Streptococcus
           agalactiae H36B]
 gi|77176118|gb|EAO78891.1| phage terminase, large subunit, PBSX family [Streptococcus
           agalactiae H36B]
          Length = 426

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 41/248 (16%), Positives = 85/248 (34%), Gaps = 18/248 (7%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINAT---QGLVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D Y +   R+      +  V L   P+   
Sbjct: 119 FKGMD-NPEKIKSIKGISDVVMEEASEFTLDDYTQLTLRLRDKKHLEKQVYLMFNPVSKA 177

Query: 55  SPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRI 114
           + + + +   S  +  V + T  +    ++  R+ I +    +E   +        +   
Sbjct: 178 NWVYKAFFIKSPKNTVVYQTTYKDNRFLDDVTRENIEELANRNEAYYKIYALGQFATLEK 237

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
               + +  I + D   H     G+D+G+ + P A  H+  +  +  +Y+++ Y  +  T
Sbjct: 238 LIFPKYEKRILNKDKLSHLPSFFGLDYGFINDPSAFLHVKIDDANKKLYILEEYVRKNLT 297

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                 A+KS G            +           + R  G++          G+  V 
Sbjct: 298 NDKIANAIKSLGYAKEEIRGDSAEKKSN-------QELRNLGIQ---RMIDVKKGAGSVM 347

Query: 234 AGISDMLD 241
            GI  ML 
Sbjct: 348 QGIQYMLQ 355


>gi|325681270|ref|ZP_08160800.1| phage terminase, large subunit, PBSX family [Ruminococcus albus 8]
 gi|324107192|gb|EGC01478.1| phage terminase, large subunit, PBSX family [Ruminococcus albus 8]
          Length = 419

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 42/255 (16%), Positives = 81/255 (31%), Gaps = 22/255 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E      Q  T+  V  DE    P     + + R + T   +     P          ++
Sbjct: 121 EGSASLIQGVTLAGVLMDETALMPRSFVEQAVARCSVTGSKLWFNCNPDNPYHWFKREWI 180

Query: 63  SASS-SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +   +   +   +++ P  +E   KR    Y     E   +G      G ++P+ +E 
Sbjct: 181 DKADSKNLLYVHFELSDNPSLSEAVIKRYERLYTGAFYERFVRGRWSAAEGLVYPMFDER 240

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPI 175
             +      +    +   D+G  +P +    +W +   + Y +  Y          +T  
Sbjct: 241 KYVCGELPQDCGRFVVSCDYGTVNPSS--FGLWGQSGGIWYRLAEYYYDSAREGSRRTDE 298

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            H AAL+        ++    +  D  S        +R G              N V +G
Sbjct: 299 EHYAALEELAGGREISY----VVCD-PSAASFIQCIKRHG------KFRVIQAKNDVISG 347

Query: 236 ISDMLDRMRSGRWKV 250
           I    D +R G  ++
Sbjct: 348 IRRTQDFIRGGGLRI 362


>gi|94989072|ref|YP_597173.1| terminase large subunit [Streptococcus pyogenes MGAS9429]
 gi|94992963|ref|YP_601062.1| terminase large subunit [Streptococcus pyogenes MGAS2096]
 gi|94542580|gb|ABF32629.1| terminase large subunit [Streptococcus pyogenes MGAS9429]
 gi|94546471|gb|ABF36518.1| Terminase large subunit [Streptococcus pyogenes MGAS2096]
          Length = 428

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/248 (16%), Positives = 83/248 (33%), Gaps = 18/248 (7%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINAT---QGLVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D Y +   R+      +  + L   P+   
Sbjct: 122 FKGMD-NPEKIKSIKGISDVVMEEASEFTLDDYTQLTLRLRDKKHLEKQIYLMFNPVSKV 180

Query: 55  SPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRI 114
           + + + +   +  +  V + T  +    ++  R+ I +    +E   +        +   
Sbjct: 181 NWVYKAFFVKTPKNTVVYQTTYKDNRFLDDVTRENIEELADRNEAYYKIYALGQFATLDK 240

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
               + D  I + D   H     G+D+G+ + P A  H+  +  +  +YV++ Y  +  T
Sbjct: 241 LIFPKYDKQILNKDKLSHLSSFFGLDYGFINDPSAFLHVKIDDANKKLYVIEEYVRKNLT 300

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                 A+K  G            +           + R  G+   P       G   V 
Sbjct: 301 NDKIANAIKDLGYAKEEIRGDSAEKKSN-------QELRNLGI---PRMIDVTKGPGTVM 350

Query: 234 AGISDMLD 241
            GI  +L 
Sbjct: 351 QGIQYLLQ 358


>gi|50913388|ref|YP_059360.1| terminase large subunit [Streptococcus pyogenes MGAS10394]
 gi|50902462|gb|AAT86177.1| Terminase large subunit [Streptococcus pyogenes MGAS10394]
          Length = 428

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 83/248 (33%), Gaps = 18/248 (7%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINAT---QGLVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D Y +   R+      +  + L   P+   
Sbjct: 122 FKGMD-NPEKIKSIKGISDVVMEEASEFTLDDYTQLTLRLRDKKHLEKQIYLMFNPVSKV 180

Query: 55  SPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRI 114
           + + + +   +  +  V + T  +    ++  R+ I +    +E   +        +   
Sbjct: 181 NWVYKAFFVKTPKNTVVYQTTYKDNRFLDDVTRENIEELANRNEAYYKIYALGQFATLDK 240

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
               + D  I + D   H     G+D+G+ + P A  H+  +  +  +Y+++ Y  +  T
Sbjct: 241 LIFPKYDKQILNKDKLSHLPSFFGLDYGFINDPSALLHVKIDDANKKLYILEEYVRKNLT 300

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                 A+K  G            +           + R  G+   P       G   V 
Sbjct: 301 NDKIANAIKDLGYAKEEIRGDSAEKKSN-------QELRNLGI---PRMIDVTKGPGTVM 350

Query: 234 AGISDMLD 241
            GI  +L 
Sbjct: 351 QGIQYLLQ 358


>gi|71911253|ref|YP_282803.1| terminase large subunit [Streptococcus pyogenes MGAS5005]
 gi|71854035|gb|AAZ52058.1| terminase large subunit [Streptococcus pyogenes MGAS5005]
          Length = 425

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/248 (16%), Positives = 83/248 (33%), Gaps = 18/248 (7%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINAT---QGLVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D Y +   R+      +  + L   P+   
Sbjct: 119 FKGMD-NPEKIKSIKGISDVVMEEASEFTLDDYTQLTLRLRDKKHLEKQIYLMFNPVSKV 177

Query: 55  SPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRI 114
           + + + +   +  +  V + T  +    ++  R+ I +    +E   +        +   
Sbjct: 178 NWVYKAFFVKTPKNTVVYQTTYKDNRFLDDVTRENIEELADRNEAYYKIYALGQFATLDK 237

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
               + D  I + D   H     G+D+G+ + P A  H+  +  +  +YV++ Y  +  T
Sbjct: 238 LIFPKYDKQILNKDKLSHLSSFFGLDYGFINDPSAFLHVKIDDANKKLYVIEEYVRKNLT 297

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                 A+K  G            +           + R  G+   P       G   V 
Sbjct: 298 NDKIANAIKDLGYAKEEIRGDSAEKKSN-------QELRNLGI---PRMIDVTKGPGTVM 347

Query: 234 AGISDMLD 241
            GI  +L 
Sbjct: 348 QGIQYLLQ 355


>gi|21910971|ref|NP_665239.1| putative terminase large subunit - phage associated [Streptococcus
           pyogenes MGAS315]
 gi|28876465|ref|NP_795683.1| putative terminase large subunit [Streptococcus pyogenes phage
           315.6]
 gi|28895342|ref|NP_801692.1| hypothetical protein SPs0430 [Streptococcus pyogenes SSI-1]
 gi|157311161|ref|YP_001469206.1| terminase large subunit [Streptococcus phage P9]
 gi|225871330|ref|YP_002747277.1| phage terminase, large subunit [Streptococcus equi subsp. equi
           4047]
 gi|21905179|gb|AAM80042.1| putative terminase large subunit - phage-associated [Streptococcus
           pyogenes MGAS315]
 gi|28810588|dbj|BAC63525.1| hypothetical protein [Streptococcus pyogenes SSI-1]
 gi|119104310|gb|ABL61055.1| terminase large subunit [Streptococcus phage P9]
 gi|225700734|emb|CAW95367.1| putative phage terminase, large subunit [Streptococcus equi subsp.
           equi 4047]
          Length = 425

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 83/248 (33%), Gaps = 18/248 (7%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINAT---QGLVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D Y +   R+      +  + L   P+   
Sbjct: 119 FKGMD-NPEKIKSIKGISDVVMEEASEFTLDDYTQLTLRLRDKKHLEKQIYLMFNPVSKV 177

Query: 55  SPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRI 114
           + + + +   +  +  V + T  +    ++  R+ I +    +E   +        +   
Sbjct: 178 NWVYKAFFVKTPKNTVVYQTTYKDNRFLDDVTRENIEELANRNEAYYKIYALGQFATLDK 237

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
               + D  I + D   H     G+D+G+ + P A  H+  +  +  +Y+++ Y  +  T
Sbjct: 238 LIFPKYDKQILNKDKLSHLPSFFGLDYGFINDPSALLHVKIDDANKKLYILEEYVRKNLT 297

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                 A+K  G            +           + R  G+   P       G   V 
Sbjct: 298 NDKIANAIKDLGYAKEEIRGDSAEKKSN-------QELRNLGI---PRMIDVTKGPGTVM 347

Query: 234 AGISDMLD 241
            GI  +L 
Sbjct: 348 QGIQYLLQ 355


>gi|306826838|ref|ZP_07460138.1| PBSX family phage terminase [Streptococcus pyogenes ATCC 10782]
 gi|304430856|gb|EFM33865.1| PBSX family phage terminase [Streptococcus pyogenes ATCC 10782]
          Length = 425

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/248 (16%), Positives = 83/248 (33%), Gaps = 18/248 (7%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINAT---QGLVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D Y +   R+      +  + L   P+   
Sbjct: 119 FKGMD-NPEKIKSIKGISDVVMEEASEFTLDDYTQLTLRLRDKKHLEKQIYLMFNPVSKV 177

Query: 55  SPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRI 114
           + + + +   +  +  V + T  +    ++  R+ I +    +E   +        +   
Sbjct: 178 NWVYKAFFVKTPKNTVVYQTTYKDNRFLDDVTRENIEELADRNEAYYKIYALGQFATLDK 237

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
               + D  I + D   H     G+D+G+ + P A  H+  +  +  +YV++ Y  +  T
Sbjct: 238 LIFPKYDKQILNKDKLSHLSSFFGLDYGFINDPSAFLHVKIDDANKKLYVLEEYVRKNLT 297

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                 A+K  G            +           + R  G+   P       G   V 
Sbjct: 298 NDKIANAIKDLGYAKEEIRGDSAEKKSN-------QELRNLGI---PRMIDVTKGPGTVM 347

Query: 234 AGISDMLD 241
            GI  +L 
Sbjct: 348 QGIQYLLQ 355


>gi|304360664|ref|YP_003856795.1| putative terminase large subunit [Clostridium phage phiCTP1]
 gi|302495523|gb|ADL40303.1| putative terminase large subunit [Clostridium phage phiCTP1]
          Length = 472

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 34/245 (13%), Positives = 73/245 (29%), Gaps = 13/245 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  V+FDE    PE    +   R +     +     P          Y+
Sbjct: 142 EASQDLIQGITLAGVFFDEVALMPESFVSQATARCSVDGSKLWFNCNPEGPFHWFYVKYI 201

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +     + +   +++ P    +   R    Y     +    G+ +   G ++ + + +
Sbjct: 202 KKAKRRNALRLHFMMDDNPSLTPRILDRYKKQYSGVFYKRFILGQWVQAEGIVYSMFDRN 261

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH-VAA 180
           + +       +       D+G  +P     L+W +  D     K Y    +         
Sbjct: 262 VNVVPTKTRNYEAFYVSCDYGTKNPT--VFLLWGKIGDQWVCFKEYYYDGRKAGIQKTDK 319

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
             +        +          S     A+ R +G  ++         +N V  GI    
Sbjct: 320 QYADDYEDFIGYNKTVTIIVDPSAASFIAELRSRGYNVV-------SANNDVLDGIRLTG 372

Query: 241 DRMRS 245
             ++ 
Sbjct: 373 SLIKQ 377


>gi|167461539|ref|ZP_02326628.1| phage terminase large subunit [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322382498|ref|ZP_08056384.1| hypothetical protein PL1_2919 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153524|gb|EFX45922.1| hypothetical protein PL1_2919 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 431

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/255 (13%), Positives = 80/255 (31%), Gaps = 26/255 (10%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINAT----QGLVTLTLTPLKGRSPII 58
           +  +D  Q  T   ++ DE    P+    + + R +A        +     P        
Sbjct: 124 DSSQDVLQGLTAAGLYLDEVALFPKSFVEQAIGRCSAETDGNGAKMFFNCNPAGPYHWFK 183

Query: 59  EHYLSASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPI 117
             Y+  +     +I   T+++    +E+ ++R    +     +    G  ++  G I+ +
Sbjct: 184 TEYIDKAKEKNILILHFTMDDNLSLSEKVKERFRRMFTGVFYKRYILGLWVMAEGIIYDM 243

Query: 118 VEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CRE 171
             E   + +  I +       +D+G  +P     L+W +  +  Y +K Y        ++
Sbjct: 244 FSERHRVKAPPIKKCSRFYVSIDYGTQNPT--VFLLWGQYQNKWYCLKEYYYDGRKSEKQ 301

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
           +T   +   L  +   L              S        +        +        N 
Sbjct: 302 KTDRQYYDDLVQFIGDLQI-----SSIIIDPSAASFITTIQE------NDRFRVLKAKND 350

Query: 232 VEAGISDMLDRMRSG 246
           V  GI +    + + 
Sbjct: 351 VLEGIRNTATCLSND 365


>gi|318057426|ref|ZP_07976149.1| phage terminase, large subunit, PBSX family [Streptomyces sp.
           SA3_actG]
 gi|318075987|ref|ZP_07983319.1| phage terminase, large subunit, PBSX family [Streptomyces sp.
           SA3_actF]
          Length = 423

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 41/255 (16%), Positives = 74/255 (29%), Gaps = 21/255 (8%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           + +  T    + DE    P   + + L R++     +  T  P      +   +L     
Sbjct: 114 RLRGLTACLAYVDEATLIPRGFWNQLLGRLSVPGAKLMATTNPDNPGHWLRREFLDREGD 173

Query: 68  -DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D +    T+++ P  +      +   Y          G  +   G I+   +    +  
Sbjct: 174 LDLRSWHFTLDDNPALDAAYVTSLKSEYTGLWYRRFIAGHWVQSEGAIYETFDPARHVVR 233

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPIFHVAA 180
                       +D+G  +P+A   L    D   +YVV  +R       R  T   +  A
Sbjct: 234 DLPRIDRWVCDAIDYGTVNPYADVLLGVGAD-RRLYVVSEFRWDSRRERRSLTDAEYSKA 292

Query: 181 LKSWGKWLP-----WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            + W   +P                  S      Q  R G++            N V  G
Sbjct: 293 RRGWLARVPQPEQNIVGVAPEWTIVDPSASSYIEQLHRDGVR------GVQPADNAVLDG 346

Query: 236 ISDMLDRMRSGRWKV 250
           I  +     S   +V
Sbjct: 347 IRTVSSLFSSDLLRV 361


>gi|251778523|ref|ZP_04821443.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
 gi|243082838|gb|EES48728.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
          Length = 448

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 32/263 (12%), Positives = 80/263 (30%), Gaps = 29/263 (11%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPED--VYFEGLTRINATQG--LVTLTLTPLKGRS 55
            K  +   +K +S   +  +  +E    D   + +   R+ +  G   + +   P+   +
Sbjct: 124 FKGLD-DSEKIKSIANIDDIVVEECTEIDKQEFSQLGLRLRSKNGYNQIHVMFNPISKSN 182

Query: 56  PIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGS-G 112
            + E +        D  V++ T  +           +I          R        S  
Sbjct: 183 WVYEMWFQNGYDESDTMVLKTTYKDNKFLPYDYINALIKMKETDPVYYRIYALGEFASLD 242

Query: 113 RIFPIVEEDIVINSLDIPEHWVQ---IGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYR 168
           ++     E++  +   + +         G+DFG+ + P A   ++ +  +  IY+   + 
Sbjct: 243 KLIYTNWEELDFDWRKLMQQRPYAKACFGLDFGYVNDPSAFIAMIVDEVNKEIYIFDEFY 302

Query: 169 CREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
            +          +   G      +       D    + +    R      +P       G
Sbjct: 303 EKGLLNDALALKIVKRGYGKEIIF------ADSAERKSIDEIKR----NGVPRIKPAKKG 352

Query: 229 SNGVEAGISDMLDRMRSGRWKVF 251
            + +  GI  +        +K++
Sbjct: 353 KDSIVNGIQFLKQ------FKIY 369


>gi|139473881|ref|YP_001128597.1| putative phage terminase, large subunit [Streptococcus pyogenes
           str. Manfredo]
 gi|134272128|emb|CAM30373.1| putative phage terminase, large subunit [Streptococcus pyogenes
           str. Manfredo]
          Length = 425

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 83/248 (33%), Gaps = 18/248 (7%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINAT---QGLVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D Y +   R+      +  + L   P+   
Sbjct: 119 FKGMD-NPEKIKSIKGISDVVMEEASEFTLDDYTQLTLRLRDKKHLEKQIYLMFNPVSKV 177

Query: 55  SPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRI 114
           + + + +   +  +  V + T  +    ++  R+ I +    +E   +        +   
Sbjct: 178 NWVYKAFFVKTPKNTVVYQTTYKDNRFLDDVTRENIEELANRNEAYYKIYALGQFATLDK 237

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
               + D  I + D   +     G+D+G+ + P A  H+  +  +  +Y+++ Y  +  T
Sbjct: 238 LIFPKYDKQILNKDKLSYLPSFFGLDYGFINDPSALLHVKIDDANKKLYILEEYVRKNLT 297

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                 A+K  G            +           + R  G+   P       G   V 
Sbjct: 298 NDKIANAIKDLGYAKEEIRGDSAEKKSN-------QELRNLGI---PRMIDVTKGPGTVM 347

Query: 234 AGISDMLD 241
            GI  +L 
Sbjct: 348 QGIQYLLQ 355


>gi|225419955|ref|ZP_03762258.1| hypothetical protein CLOSTASPAR_06296 [Clostridium asparagiforme
           DSM 15981]
 gi|225041463|gb|EEG51709.1| hypothetical protein CLOSTASPAR_06296 [Clostridium asparagiforme
           DSM 15981]
          Length = 318

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 78/234 (33%), Gaps = 22/234 (9%)

Query: 18  YVWFDEE---PPEDVYFEGLT--RINATQG---LVTLTLTPLKGRSPIIEHYLSASSSDR 69
           +VW +E      ED + +     R    +G    +TLT  P    S +   +      D 
Sbjct: 35  WVWIEEAYEITNEDDFNKLDLSIRGEVPEGYFKQITLTFNPWSATSWLKARFFDTPDEDT 94

Query: 70  QVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVE-EDIVINS 126
            V   T       +E +R   +     + R  R   +GE  +  G I+  V  ED  ++ 
Sbjct: 95  FVKTTTWQCNEWLDESDRNIFLKMQKNNPRRYRIEGEGEWGIAEGLIYTNVVCEDFNVDE 154

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
           +           +DFG+  P A    + +  +  IY+   +     T       +K  G 
Sbjct: 155 IRAIPGIKSAFNLDFGFTDPNAFVCEMVDNAAMRIYIFDEWYQTGVTNKIIAEQIKKMGY 214

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                        D    + ++   + +G+K  P       G + V  GI  + 
Sbjct: 215 GGQKI------ICDNAEPKSIAE-LQDEGIKAEPSR----KGKDSVNHGIQLIQ 257


>gi|319440826|ref|ZP_07989982.1| Phage terminase large subunit [Corynebacterium variabile DSM 44702]
          Length = 400

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/249 (14%), Positives = 81/249 (32%), Gaps = 16/249 (6%)

Query: 7   GRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
              + +  TV   W DE     +  + + L R++     V  T  P      + + YL  
Sbjct: 107 SESRIRGMTVGRAWCDELTVLHQAFFKQLLARMSEKGAKVFATTNPDSPSHWLKKEYLDR 166

Query: 65  SSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIV 123
                      T+++ P   ++ +  +   Y          G+ +   G I+ + +++ +
Sbjct: 167 IEEIPWSYHHFTMDDNPSLEDEYKDALKAEYTGLWYRRFILGQWVSAEGAIYDMWDDESM 226

Query: 124 INSLDIPEHWVQI--GGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
           + + +      +    G+D+G  HP   G L+     + +Y+   +  +  T     A L
Sbjct: 227 VVAPEDMPDMQRTLALGIDYGTTHPT-IGTLLQLGVDNKLYISDEWHPKRSTDAALSADL 285

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             W    P         +   +      Q    G +            N V  GI  +  
Sbjct: 286 TRWMAHHP----DPEWIYVDPAAASFRLQLFEDGHR------RMKAADNKVIDGIRTVAS 335

Query: 242 RMRSGRWKV 250
            + + +  +
Sbjct: 336 LLDNHQLYI 344


>gi|269120042|ref|YP_003308219.1| phage terminase, large subunit, PBSX family [Sebaldella termitidis
           ATCC 33386]
 gi|268613920|gb|ACZ08288.1| phage terminase, large subunit, PBSX family [Sebaldella termitidis
           ATCC 33386]
          Length = 430

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 41/236 (17%), Positives = 77/236 (32%), Gaps = 22/236 (9%)

Query: 18  YVWFDEEP------PEDVYFEGLTRINATQG--LVTLTLTPLKGRSPIIEHYLSASSSDR 69
           + W +E          D+  E +           +TLT  P      + + +     SD 
Sbjct: 145 WCWIEEAYEITKEKDFDMLNESIRGEVPENLYKQITLTFNPWNQGHWLKKRFFDVEDSDI 204

Query: 70  QVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEE-DIVINS 126
                        +E ++K   D    + R  R    GE  +  G I+   EE +  I  
Sbjct: 205 MAKTTNYQCNEFLDESDKKLFEDMKVKNPRRYRVAGLGEWGIVEGLIYENWEEREFDIEK 264

Query: 127 LDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG 185
           L          G+DFG+   P        ++ + +IYV   +  +  +       +K  G
Sbjct: 265 LLSRTDIKTAFGLDFGYTNDPSGLFCGAVDKANKIIYVFDEFYKKGLSNRKIYEEIKIKG 324

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
                 +  + ++ D    + +    R  G+K+         G + +  GI  + D
Sbjct: 325 ------YSKERIRADCAEPKSIDELKRDFGLKIKGAR----KGKDSINNGIQYIQD 370


>gi|323699495|ref|ZP_08111407.1| protein of unknown function DUF264 [Desulfovibrio sp. ND132]
 gi|323459427|gb|EGB15292.1| protein of unknown function DUF264 [Desulfovibrio desulfuricans
           ND132]
          Length = 428

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 33/246 (13%), Positives = 73/246 (29%), Gaps = 16/246 (6%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS- 63
             D  +   +  V FDE  + P  V+ E +    + +    + +   +G++ + E +   
Sbjct: 110 NPDSLRGMYLDGVVFDEVAQMPLRVWTEVIRPALSDRKGWAMFIGTPRGKNALYEIWEKG 169

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGS-----GRIFPIV 118
            +  D        +ET     +E +         E E   +            G++    
Sbjct: 170 KTDPDWLAAMYRASETGILPVEELEASAREMSPEEYEQEFECSFTAAIRGAYFGQLLADA 229

Query: 119 EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
           + +  +  +            D G     +    V  R      V+  Y    +    + 
Sbjct: 230 DREGRMTDVPADPSMPVHTAWDLGMSDSTSI-WFVQARPGGTFAVIDYYEACGEGLDHYA 288

Query: 179 AALKSWGKWLP-WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
             L   G        PHD    +  +G+      R  G++           +  ++ GI+
Sbjct: 289 RILDDKGYKYGTHIAPHDIRVRELGTGKSRLETARSLGIRF------DIAANIPIQDGIN 342

Query: 238 DMLDRM 243
            +   +
Sbjct: 343 AVRTIL 348


>gi|262276634|ref|ZP_06054439.1| P-loop protein [alpha proteobacterium HIMB114]
 gi|262225214|gb|EEY75661.1| P-loop protein [alpha proteobacterium HIMB114]
          Length = 409

 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 34/263 (12%), Positives = 78/263 (29%), Gaps = 20/263 (7%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQ---GLVTLTLTPLKGRS 55
           LK  ++  D  +   ++++  DE  + PE+ + E L    + +   G V    TP    +
Sbjct: 96  LKGADKSADNLRGVGLNFLVLDEFADIPEEAWTEVLRPTISDKYANGKVLFVGTPKGYGN 155

Query: 56  PIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGR 113
              + +        + +  + T  E       E ++              +      +G 
Sbjct: 156 WSYDMFQRGQAGDPEWKSWKYTTIEGGQVEPHEIEQAKKDLDARSFRQEYEASFETYAGV 215

Query: 114 IFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR-CREQ 172
           ++   +    +  +   ++ V   GMDF      A    V      + Y  K        
Sbjct: 216 VYYNFDRAKNVKPVPYDQNAVIHIGMDFNIDPMSACLFYVKQ---GISYFFKEIVIYSSN 272

Query: 173 TPIFHVAALKSWGKWLPWAWPH--DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
           T        + +       +P      +     G+      +  G  +  +         
Sbjct: 273 TQEMIDEITRQYDPKRVIVYPDPASRQRKTSAGGKTDLMLLQNAGFNVKAKPTHAL---- 328

Query: 231 GVEAGISDMLDRM--RSGRWKVF 251
            V   I+ +  R+    G+  ++
Sbjct: 329 -VRDRINSVNSRLCNYEGKRFIY 350


>gi|209559305|ref|YP_002285777.1| Terminase large subunit [Streptococcus phage NZ131.2]
 gi|209540506|gb|ACI61082.1| Terminase large subunit [Streptococcus phage NZ131.2]
          Length = 425

 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 87/248 (35%), Gaps = 18/248 (7%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINAT---QGLVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D Y +   R+      +  + L   P+   
Sbjct: 119 FKGMD-NPEKIKSIKGISDVVMEEASEFTLDDYTQLTLRLRDKKHLEKQIYLMFNPVSKV 177

Query: 55  SPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRI 114
           + + + +   +  +  V + T  +    ++  R+ I +    +E   +        +   
Sbjct: 178 NWVYKAFFVKTPKNTVVYQTTYKDNRFLDDVTRENIEELANRNEAYYKIYALGQFATLDK 237

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
               + D  I + D   +     G+D+G+ + P A  H+  +  +  +Y+++ Y  +  T
Sbjct: 238 LIFPKYDKQILNKDKLSYLPSFFGLDYGFINDPSALLHVKIDDANKKLYILEEYVRKNLT 297

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                 A+   G      +  + ++ D    +      R+ G+   P       G   V 
Sbjct: 298 NDKIANAIMDLG------YAKEEIRGDSAEKKSNLE-LRKLGI---PRMIDVTKGPGTVM 347

Query: 234 AGISDMLD 241
            GI  +L 
Sbjct: 348 QGIQYLLQ 355


>gi|324325093|gb|ADY20353.1| phage terminase, large subunit, PBSX family [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 434

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 88/261 (33%), Gaps = 31/261 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDEE------PPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E          +   E +     +      +T+
Sbjct: 116 FRGLD-DPLKITSITVDVGALCWAWFEEAYEIEDQHKFETVVESIRGSYDSPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P      +  ++    +   D   I  T       +EQ+R R    Y  + R AR  
Sbjct: 175 TFNPWSENHWLKSYFFDEETQAYDTFAITTTYKCNEWLDEQDRARYESLYTKNPRRARIV 234

Query: 104 -KGEPILGSGRIFPIVE-EDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G ++   +  D  I+ +   +      G+DFG+   P A    + +  ++ 
Sbjct: 235 CDGEWGVADGLVYENFQVRDFDIDEIRQRKDVQSAFGLDFGYTNDPTALCCSLVDMRNET 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV   +  +  +       ++  G      +  + +  D    + +    +  G++   
Sbjct: 295 IYVFDEHYEKGMSNKRIAKVIEEKG------YSKEKITADSAEPKSIDEI-KSLGIR--- 344

Query: 221 ECATFDDGSNGVEAGISDMLD 241
                  G + V  GI  + D
Sbjct: 345 RIEGARKGKDSVNNGIQYIQD 365


>gi|227833811|ref|YP_002835518.1| putative phage terminase [Corynebacterium aurimucosum ATCC 700975]
 gi|262184752|ref|ZP_06044173.1| putative phage terminase [Corynebacterium aurimucosum ATCC 700975]
 gi|227454827|gb|ACP33580.1| putative phage terminase [Corynebacterium aurimucosum ATCC 700975]
          Length = 751

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 48/262 (18%), Positives = 89/262 (33%), Gaps = 30/262 (11%)

Query: 5   EQGRD-KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQG----LVTLTLTPLKGRSPI 57
           +QG + + +  T   +++DE    PE+V+    +R+ AT       V  T  P      +
Sbjct: 109 DQGAEGRIRGGTYQLLFYDELTLCPENVWEMLWSRMRATGNPNPPRVFATTNPATPAHYL 168

Query: 58  IEHYLSASSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFP 116
             +++      D      T+++ P   E+ ++R+  SY         +GE     G ++ 
Sbjct: 169 KTNFIDKPGETDTYARLFTMDDNPGLTEEYKERMKASYTGIFYRRMIRGEWAAAEGAVYE 228

Query: 117 IVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR-------- 168
             + D ++         V   G+D+G +HP A   L    D   + V   +         
Sbjct: 229 SWDPDTMVKG--RAVGTVLAVGIDYGTNHPSAGYALTVTEDG--LQVTHEWSPQTTGLGG 284

Query: 169 CREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
               T      +L+ W   LP         +   +      + RR               
Sbjct: 285 RTRLTDGELADSLQEWLSTLP---NQPKGLYIDPAAASFHEELRR-------RKVRTTKA 334

Query: 229 SNGVEAGISDMLDRMRSGRWKV 250
            N V  GI  +   + SG   +
Sbjct: 335 DNSVVDGIRQVDSLLTSGALTI 356


>gi|262184823|ref|ZP_06044244.1| Phage terminase large subunit [Corynebacterium aurimucosum ATCC
           700975]
          Length = 421

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 42/260 (16%), Positives = 82/260 (31%), Gaps = 30/260 (11%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY------ 61
           K +  T+   + DE        + + L+R++ +   +  T  P      + + Y      
Sbjct: 117 KIRGMTIGLAFADEITLLHPAFFKQLLSRLSKSYSKLFCTTNPDSQNHWLRKDYLVRVPG 176

Query: 62  ---------LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
                         +D      T+++ P   E  +  +   Y         +G  +   G
Sbjct: 177 CMHYDTKTQPEDQLADWTYWHFTMDDNPSLTEGYKSNLRKEYTGMWYLRFIQGLWVAAEG 236

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIG--GMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR 170
            I+ + +E   +   +      QI   G+D+G  HP     L    D + +Y V  +   
Sbjct: 237 AIYQMWDEAKHVVHPEDMPIMRQIIALGIDYGTTHPTTGILLGIG-DDNRLYAVDEWAPG 295

Query: 171 EQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
             T     A LK W     +        +   +      Q    G++        D  +N
Sbjct: 296 RLTNNALTADLKEWLTRHDY----PTWIYYDPAAASFGLQLHEDGIR------RIDKANN 345

Query: 231 GVEAGISDMLDRMRSGRWKV 250
            V  GI  +   + +G   +
Sbjct: 346 DVLDGIRTVASLLDNGNLLI 365


>gi|227833751|ref|YP_002835458.1| Phage terminase large subunit [Corynebacterium aurimucosum ATCC
           700975]
 gi|227454767|gb|ACP33520.1| Phage terminase large subunit [Corynebacterium aurimucosum ATCC
           700975]
          Length = 414

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 42/260 (16%), Positives = 82/260 (31%), Gaps = 30/260 (11%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY------ 61
           K +  T+   + DE        + + L+R++ +   +  T  P      + + Y      
Sbjct: 110 KIRGMTIGLAFADEITLLHPAFFKQLLSRLSKSYSKLFCTTNPDSQNHWLRKDYLVRVPG 169

Query: 62  ---------LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
                         +D      T+++ P   E  +  +   Y         +G  +   G
Sbjct: 170 CMHYDTKTQPEDQLADWTYWHFTMDDNPSLTEGYKSNLRKEYTGMWYLRFIQGLWVAAEG 229

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIG--GMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR 170
            I+ + +E   +   +      QI   G+D+G  HP     L    D + +Y V  +   
Sbjct: 230 AIYQMWDEAKHVVHPEDMPIMRQIIALGIDYGTTHPTTGILLGIG-DDNRLYAVDEWAPG 288

Query: 171 EQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
             T     A LK W     +        +   +      Q    G++        D  +N
Sbjct: 289 RLTNNALTADLKEWLTRHDY----PTWIYYDPAAASFGLQLHEDGIR------RIDKANN 338

Query: 231 GVEAGISDMLDRMRSGRWKV 250
            V  GI  +   + +G   +
Sbjct: 339 DVLDGIRTVASLLDNGNLLI 358


>gi|313115194|ref|ZP_07800678.1| conserved hypothetical protein [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310622472|gb|EFQ05943.1| conserved hypothetical protein [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 482

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 57/309 (18%), Positives = 95/309 (30%), Gaps = 64/309 (20%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGR--- 54
             Y + R  +Q     ++ FDE    +     Y     R       V +  T   G    
Sbjct: 108 MQYTKDRTNYQGKAFDFIGFDELTHFEWEEYSYMMSRNRPTGPGTRVYMRATTNPGGIGH 167

Query: 55  SPIIEHYLSASSSD----------------------RQVIRMTINETP--HYNEQERKRI 90
             +   +++ +                         R  I  +I + P    N+      
Sbjct: 168 GWVKARFITPAPPGTPITEEYTVKLPDGTEQKLQRARVFIPSSIFDNPALLANDPGYLAS 227

Query: 91  IDSYPLHEREARTKGEPILGSGRIFPIVEED----------IVINSLDIPEHWVQIGGMD 140
           + S P  E++A   G     SG++F     D           VI    IP+HW    G D
Sbjct: 228 LASMPEAEKQALLYGSWDSFSGQVFTEWRNDPAHYEDQRWTHVIAPFTIPKHWQLYRGFD 287

Query: 141 FGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH-------VAALKSWGKWLP---- 189
           FG+  PF+ G    + +  +  + + Y C  +               ++   +  P    
Sbjct: 288 FGFSKPFSVGWYAADEEGRLYRIKELYGCTGRPNEGLRIDPVEQARRIREAEQNDPLLRG 347

Query: 190 --WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR--- 244
                  D    D+  GE ++A   R      P    +  G N   AG      R+    
Sbjct: 348 RVIHGIADPAIFDESRGESIAAMMERS-----PNFLRWSPGDNTRLAGKMQFHYRLNFDA 402

Query: 245 SGR--WKVF 251
            GR  ++VF
Sbjct: 403 DGRPMFQVF 411


>gi|282919671|ref|ZP_06327403.1| phage terminase, large subunit [Staphylococcus aureus subsp. aureus
           C427]
 gi|282316309|gb|EFB46686.1| phage terminase, large subunit [Staphylococcus aureus subsp. aureus
           C427]
          Length = 447

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 135 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 193

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 194 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 253

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 254 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 313

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 314 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 363

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 364 VVQGLQFLMQ 373


>gi|152976656|ref|YP_001376173.1| PBSX family phage terminase large subunit [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152025408|gb|ABS23178.1| phage terminase, large subunit, PBSX family [Bacillus cytotoxicus
           NVH 391-98]
          Length = 434

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/260 (16%), Positives = 87/260 (33%), Gaps = 31/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDEE------PPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E          +   E +     +      +T+
Sbjct: 116 FRGLD-DPLKITSITVDVGILCWAWFEEAYEIEDQHKFETVVESIRGSWDSPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P      +  ++    +   D   I  T       ++Q+R R    Y  + R AR  
Sbjct: 175 TFNPWSENHWLKSYFFDEETQAYDTFAITTTYKCNEWLDKQDRARYESLYEKNPRRARIV 234

Query: 104 -KGEPILGSGRIFPIVE-EDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G ++   +  D  I+ +   +      G+DFG+   P A    + +  ++ 
Sbjct: 235 CDGEWGVADGLVYENFQVRDFDIDEIRQRKDVQSAFGLDFGYTNDPTALCCSLVDLRNET 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV   Y  +  +       ++  G      +  + +  D    + +    +  G++   
Sbjct: 295 IYVFDEYYEKGMSNKRIAKMIEEKG------YSKEKITADSAEPKSIDEI-KSLGIR--- 344

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + +  GI  + 
Sbjct: 345 RIEGARKGKDSINNGIQFIQ 364


>gi|116333739|ref|YP_795266.1| Phage terminase large subunit [Lactobacillus brevis ATCC 367]
 gi|116099086|gb|ABJ64235.1| Phage terminase large subunit [Lactobacillus brevis ATCC 367]
          Length = 420

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 79/256 (30%), Gaps = 25/256 (9%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  TV   +FDE    PE    +   R +           P          +L
Sbjct: 122 EGSQDLVQGITVAGFFFDEVALMPESFVNQATARASVDGAKFWFNCNPAGPYHWFKLEWL 181

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                 + + I  T+ + P  + +   R    Y     +    G+ +L  G I+   +++
Sbjct: 182 DQLDQHKAIHIHFTMKDNPSLSPETIDRYERMYTGVFYQRFILGQWVLSDGIIYDNFDKN 241

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPI 175
            ++              +D+G  +P            D  ++ K Y        +++T  
Sbjct: 242 KMVVKNPQGTARKYAVSIDYGTLNPTVFLMWGL--YGDTWHLTKMYYYDGRHKHKQKTDE 299

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            + A L  +   L      D       S        RR G  ++          N V  G
Sbjct: 300 EYSAELDRFEDGLNPVEIID------PSAASFITLRRRGGHHVI-------KADNDVLDG 346

Query: 236 ISDMLDRMRSGRWKVF 251
           I      M +G+  VF
Sbjct: 347 IRKTGMAMNTGKI-VF 361


>gi|260663805|ref|ZP_05864691.1| phage terminase large subunit [Lactobacillus fermentum 28-3-CHN]
 gi|260551619|gb|EEX24805.1| phage terminase large subunit [Lactobacillus fermentum 28-3-CHN]
          Length = 392

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 32/252 (12%), Positives = 78/252 (30%), Gaps = 22/252 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQGL---VTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D + +   R+   +     +     P+   
Sbjct: 84  FKGMD-DPEKIKSIKGLSDVVMEEASEFNQDDFTQLTLRLREPKHKQRQLFCMFNPVSKL 142

Query: 55  SPIIEHYLSA----SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILG 110
           +   + +        +S   + + T  +    +    + I +    +    +        
Sbjct: 143 NWTYKQWFDPTATVDTSRVAIHQSTYKDNHFLDADNIRTIENLKQTNPAYYKIYTLGEFA 202

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHP-FAAGHLVWNRDSDVIYVVKNYRC 169
           +       +      S     +     G+DFG+ +   A  H+  ++D+  IY+++ Y  
Sbjct: 203 TLDKLVFPDFSKRRLSAQRMVNLPSYFGLDFGYTNDETAFMHVKVDQDNHTIYIMEEYAK 262

Query: 170 REQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGS 229
                      +K  G      +  + +  D    + ++   R      +P       G 
Sbjct: 263 HGMLNSDIARMIKQMG------YSKEIITADAAEPKSIAEIKRD----GIPRIRPAKKGK 312

Query: 230 NGVEAGISDMLD 241
           + +  GIS M  
Sbjct: 313 DSIVQGISFMQQ 324


>gi|227505813|ref|ZP_03935862.1| phage terminase [Corynebacterium striatum ATCC 6940]
 gi|227197594|gb|EEI77642.1| phage terminase [Corynebacterium striatum ATCC 6940]
          Length = 378

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/260 (16%), Positives = 83/260 (31%), Gaps = 30/260 (11%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY------ 61
           K +  T+   + DE        + + L+R++ +   +  T  P      + + Y      
Sbjct: 117 KIRGMTIGLAFADEITLLHPAFFKQLLSRLSKSYSKLFCTTNPDSQNHWLRKDYLVRVPG 176

Query: 62  ---------LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
                         +D      T+++ P      +  +   Y         +G  +   G
Sbjct: 177 CMHYDTKTQPENQLTDWTYWHFTMDDNPSLTTAYKNNLKKEYTGMWFLRFIQGLWVAAEG 236

Query: 113 RIFPIVEE-DIVINSLDIPEHWVQIG-GMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR 170
            I+ + +E   V++  D+P     I  G+D+G  HP     L    D   +Y V  +   
Sbjct: 237 AIYSMWDESKHVVDPEDMPPMETIIALGIDYGTTHPTTGIMLGMGTD-RKLYAVDEWAPG 295

Query: 171 EQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
             T     A LK W     +        +   +      Q    G++           +N
Sbjct: 296 RLTNAALTADLKEWLTSHDY----PQWIYYDPAAASFGLQLHEDGVQ------RITTANN 345

Query: 231 GVEAGISDMLDRMRSGRWKV 250
            V  GI  +   + +G+  V
Sbjct: 346 DVLDGIRTISSLLDNGQLFV 365


>gi|29028593|ref|NP_803283.1| large terminase [Staphylococcus phage 11]
 gi|18920517|gb|AAL82258.1| large terminase [Staphylococcus phage 11]
          Length = 447

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 135 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 193

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 194 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 253

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 254 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 313

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 314 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 363

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 364 VVQGLQFLMQ 373


>gi|293368016|ref|ZP_06614649.1| large terminase subunit [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|291317838|gb|EFE58251.1| large terminase subunit [Staphylococcus epidermidis
           M23864:W2(grey)]
          Length = 421

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 81/256 (31%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFEG-------LTRINATQG--LVTLTLTP 50
            Q  ++ +S          +W +E        E        L              +  P
Sbjct: 113 AQNPERLKSLKDSRFPFSIMWIEELAEFKTEDEVTTITNSMLRGELDDGLFYKFFFSYNP 172

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y ++   D   V   T  + P  ++Q  +    +   +E   R +    
Sbjct: 173 PKRKQSWVNKKYETSFQPDNTFVHHSTYLDNPFISKQFIQEAESTKERNELRYRWEYMGE 232

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I     ++ + +  I   +DFG+   P A     +++   +IY V  
Sbjct: 233 AIGSGVVPFNNLQIEKIPDELYKSFDNIRNAVDFGYATDPLAFVRWHYDKKKRIIYAVDE 292

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           +   + +       LK  G      +  D +  D    + ++   +  G+K         
Sbjct: 293 HYGVQISNREFANWLKRRG------YQSDEIFADSAEPKSIAELKQEHGIK---RIKGVK 343

Query: 227 DGSNGVEAGISDMLDR 242
            G + VE G   + D 
Sbjct: 344 KGPDSVEHGEQWLDDL 359


>gi|151222005|ref|YP_001332827.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|282919879|ref|ZP_06327608.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A9765]
 gi|150374805|dbj|BAF68065.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|282594595|gb|EFB99579.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A9765]
          Length = 447

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 135 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 193

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 194 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 253

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 254 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 313

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 314 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 363

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 364 VVQGLQFLMQ 373


>gi|258420789|ref|ZP_05683726.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A9719]
 gi|257843231|gb|EEV67643.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A9719]
          Length = 447

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 135 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 193

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 194 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 253

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 254 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 313

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 314 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 363

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 364 VVQGLQFLMQ 373


>gi|15923876|ref|NP_371410.1| large terminase [Staphylococcus aureus subsp. aureus Mu50]
 gi|156979212|ref|YP_001441471.1| hypothetical protein SAHV_0881 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|255005677|ref|ZP_05144278.2| hypothetical protein SauraM_04380 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|14246655|dbj|BAB57048.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|156721347|dbj|BAF77764.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
          Length = 425

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 113 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 171

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 172 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 231

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 232 DKMVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 291

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 292 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 341

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 342 VVQGLQFLMQ 351


>gi|122891756|ref|YP_001004302.1| large terminase [Staphylococcus phage phiETA2]
 gi|121309235|dbj|BAF43857.1| large terminase [Staphylococcus phage phiETA2]
          Length = 425

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 113 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLIFNPVSKL 171

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 172 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 231

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 232 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 291

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 292 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 341

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 342 VVQGLQFLMQ 351


>gi|282917180|ref|ZP_06324935.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           subsp. aureus D139]
 gi|282318807|gb|EFB49162.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           subsp. aureus D139]
          Length = 447

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 135 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 193

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 194 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 253

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 254 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 313

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 314 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 363

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 364 VVQGLQFLMQ 373


>gi|237735535|ref|ZP_04566016.1| terminase [Mollicutes bacterium D7]
 gi|229381280|gb|EEO31371.1| terminase [Coprobacillus sp. D7]
          Length = 427

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/272 (14%), Positives = 82/272 (30%), Gaps = 41/272 (15%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY- 61
           E+ +D  Q  T+  ++FDE    PE    +   R +           P         ++ 
Sbjct: 106 ERSQDLIQGITLAGMFFDEVALMPESFVNQATARCSVKGSKWWFNCNPQGPFHWFKVNWI 165

Query: 62  -----------------LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK 104
                               +  +   +  T+N+    +++ ++R   +Y     +   +
Sbjct: 166 DKSIGYLNAEQIKELERKKETVKNILYVHFTMNDNLSLDKEVKRRYASAYNGVFYDRYIR 225

Query: 105 GEPILGSGRIFPIVEED--IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIY 162
           G   +  G I+ +   D  IV     I E+  +    D+G  +P           ++  Y
Sbjct: 226 GLWAVAEGVIYDMFNRDKHIVNKRPKIDENEKKYISCDYGTQNPMVFLLWEKG-VNETWY 284

Query: 163 VVKNYRCRE------QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGM 216
             K Y          +T   +   L  +   L   +          S      + + +G+
Sbjct: 285 ATKEYYYSGREERKQKTDSQYADDLIEFIGSLNIEYIIV-----DPSAASFITELKSRGL 339

Query: 217 KMLPECATFDDGSNGVEAGISDMLDRMRSGRW 248
            +           N V  GI  +   +  GR 
Sbjct: 340 SVKRAR-------NDVSNGIRSVGTMLNLGRI 364


>gi|258429000|ref|ZP_05688257.1| phage terminase large subunit [Staphylococcus aureus A9299]
 gi|257849720|gb|EEV73685.1| phage terminase large subunit [Staphylococcus aureus A9299]
          Length = 447

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 83/250 (33%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 135 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 193

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 194 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 253

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 254 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 313

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + ++ D    + ++   R  G+K          G   
Sbjct: 314 MLNDEIANVIKQLG------YAKEEIKADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 363

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 364 VVQGLQFLMQ 373


>gi|88195733|ref|YP_500542.1| PBSX family phage terminase large subunit [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|87203291|gb|ABD31101.1| phage terminase, large subunit, PBSX family [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|329727756|gb|EGG64210.1| phage terminase, large subunit, PBSX family [Staphylococcus aureus
           subsp. aureus 21189]
          Length = 425

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 113 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 171

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 172 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 231

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 232 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 291

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 292 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 341

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 342 VVQGLQFLMQ 351


>gi|66395301|ref|YP_239566.1| ORF008 [Staphylococcus phage 69]
 gi|62635652|gb|AAX90763.1| ORF008 [Staphylococcus phage 69]
          Length = 447

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 79/250 (31%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 135 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 193

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 194 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 253

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 254 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 313

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G              D    + ++   R  G+K          G   
Sbjct: 314 MLNDEIANVIKQLGYAREEI------TADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 363

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 364 VVQGLQFLMQ 373


>gi|119953680|ref|YP_950600.1| putative large terminase subunit [Staphylococcus phage CNPH82]
 gi|112361306|gb|ABI15678.1| putative large terminase subunit [Staphylococcus phage CNPH82]
 gi|329736010|gb|EGG72285.1| phage terminase, large subunit, PBSX family [Staphylococcus
           epidermidis VCU045]
          Length = 421

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/256 (15%), Positives = 82/256 (32%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFEG-------LTRINATQG--LVTLTLTP 50
            Q  ++ +S          +W +E        E        L              +  P
Sbjct: 113 AQNPERLKSLKDSRFPFSIMWIEELAEFKTEDEVTTITNSMLRGELDDGLFYKFFFSYNP 172

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y ++   D   V   T  + P  ++Q  +    +   +E+  R +    
Sbjct: 173 PKRKQSWVNKKYETSFQPDNTFVHHSTYLDNPFISKQFIQEAESAKERNEQRYRWEYMGE 232

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I     D+ + +  I   +DFG+   P A     +++   +IY V  
Sbjct: 233 AIGSGVVPFNNLQIEKIPDDLYKTFDNIRNAVDFGYATDPLAFVRWHYDKKKRIIYAVDE 292

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           +   + +       LK  G      +  D +  D    + ++   +  G+K         
Sbjct: 293 HYGVQISNREFANWLKRRG------YQSDEIYADSAEPKSIAELKQEHGIK---RIKGVK 343

Query: 227 DGSNGVEAGISDMLDR 242
            G + VE G   + D 
Sbjct: 344 KGPDSVEHGEQWLDDL 359


>gi|118430762|ref|YP_873987.1| phage terminase large subunit [Staphylococcus phage phiNM]
 gi|151221227|ref|YP_001332049.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|297246862|ref|ZP_06930649.1| PBSX family phage terminase [Staphylococcus aureus A8796]
 gi|104641654|gb|ABF73068.1| phage terminase large subunit [Staphylococcus aureus phage phiNM1]
 gi|104641756|gb|ABF73134.1| phage terminase large subunit [Staphylococcus aureus phage phiNM2]
 gi|150374027|dbj|BAF67287.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|297176295|gb|EFH35577.1| PBSX family phage terminase [Staphylococcus aureus A8796]
 gi|315128338|gb|EFT84353.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           CGS03]
          Length = 425

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 113 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 171

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 172 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 231

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 232 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 291

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 292 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 341

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 342 VVQGLQFLMQ 351


>gi|160945639|ref|ZP_02092865.1| hypothetical protein FAEPRAM212_03168 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443370|gb|EDP20375.1| hypothetical protein FAEPRAM212_03168 [Faecalibacterium prausnitzii
           M21/2]
 gi|295103135|emb|CBL00679.1| Terminase-like family. [Faecalibacterium prausnitzii SL3/3]
          Length = 481

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 56/309 (18%), Positives = 95/309 (30%), Gaps = 64/309 (20%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGR--- 54
             Y + R  +Q     ++ FDE    +     Y     R       V +  T   G    
Sbjct: 107 MQYTKDRTNYQGKAYDFIGFDELTHFEWDEYSYMMSRNRPTGPGTRVYMRATTNPGGIGH 166

Query: 55  SPIIEHYLSASSSD----------------------RQVIRMTINETP--HYNEQERKRI 90
             +   +++ +                         R  I  ++ + P    N+      
Sbjct: 167 GWVKARFITPAPPGTPIVETVTVRLPDGTDQQMERARVFIPSSVFDNPALLANDPGYLAS 226

Query: 91  IDSYPLHEREARTKGEPILGSGRIFPIVEED----------IVINSLDIPEHWVQIGGMD 140
           + S P  E++A   G     SG++F     D           VI    IP+HW    G D
Sbjct: 227 LASLPEAEKQALLYGSWDSFSGQVFTEWRNDPAHYQDQRWTHVIAPFAIPKHWPIWRGYD 286

Query: 141 FGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH-------VAALKSWGKWLP---- 189
           FG+  PF+ G    + +  +  + + Y C  +               ++   +  P    
Sbjct: 287 FGFSKPFSVGWYAVDEEGRLYRIKELYGCTGRPNEGLRIDPVEQAKRIREAEQNDPLLRG 346

Query: 190 --WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR--- 244
                  D    D+  GE ++A   R      P    +  G +   AG      R+R   
Sbjct: 347 RVIHGVADPAIFDESRGESIAAMMERS-----PHFLHWQPGDHTRLAGKMQFHYRLRFAP 401

Query: 245 SGR--WKVF 251
            GR   +VF
Sbjct: 402 DGRPMLQVF 410


>gi|319894679|gb|ADV76490.1| phage terminase large subunit [Staphylococcus phage TEM126]
          Length = 425

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 113 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHMNKQIFLMFNPVSKL 171

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 172 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 231

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 232 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 291

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 292 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 341

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 342 VVQGLQFLMQ 351


>gi|257795796|ref|ZP_05644775.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A9781]
 gi|257789768|gb|EEV28108.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A9781]
          Length = 425

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 113 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 171

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 172 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 231

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 232 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 291

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 292 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 341

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 342 VVQGLQFLMQ 351


>gi|66395379|ref|YP_239642.1| ORF009 [Staphylococcus phage 53]
 gi|148717883|ref|YP_001285355.1| terminase large subunit [Staphylococcus phage 80alpha]
 gi|62635729|gb|AAX90840.1| ORF009 [Staphylococcus phage 53]
 gi|103058669|gb|ABF71612.1| terminase large subunit [Staphylococcus phage 80alpha]
          Length = 447

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 82/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 135 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHVNKQIFLMFNPVSKL 193

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 194 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFSTL 253

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H   +     +Y+++ Y  + 
Sbjct: 254 DKLVFPKYEKRLINKDELRHLPSYFGLDFGYVNDPSAFIHSKIDVKKKKLYIIEEYVKQG 313

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++   R  G+K          G   
Sbjct: 314 MLNDEIANVIKQLG------YAKEEITADSAEQKSIAE-LRNLGLK---RILPTKKGKGS 363

Query: 232 VEAGISDMLD 241
           V  G+  ++ 
Sbjct: 364 VVQGLQFLMQ 373


>gi|169344384|ref|ZP_02865357.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens C str. JGS1495]
 gi|169297509|gb|EDS79616.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens C str. JGS1495]
          Length = 415

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 28/253 (11%), Positives = 72/253 (28%), Gaps = 23/253 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPEDVYFE----GLTRINATQGLVTLTLTPLKGRS 55
            K  +   +K +S   +  +  +E    D +         R       + +   P+   +
Sbjct: 107 FKGID-DPEKIKSIAGIDDIVVEECTEIDEFDFDQLNLRLRSKNPYNQIHVMFNPVSKSN 165

Query: 56  PIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGS 111
            + + +        D  V+  T        +     ++     +         GE     
Sbjct: 166 WVYKRWFKNGYDTKDTIVLHTTYKNNKFLPKDYIDSLLKLEKDNPVYFRIYALGEFATLD 225

Query: 112 GRIFPIVEED--IVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYR 168
             I+   +E+       L    +   I  +DFG+   P A    + ++ +  +++   ++
Sbjct: 226 KLIYTNWKEESFDYKEILKNNRNTKAIFSLDFGYTNDPTAFVCSIIDKINKKLWIFDEFQ 285

Query: 169 CREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
            +          +   G              D    + +  + +R G+           G
Sbjct: 286 EKGLLNDEIAEKIIDLGYRKEVIVC------DSAEPKSI-EELKRNGLS---RVKGAVKG 335

Query: 229 SNGVEAGISDMLD 241
            + +  GI  +  
Sbjct: 336 RDSIINGIQLIQQ 348


>gi|149004427|ref|ZP_01829167.1| Phage terminase large subunit [Streptococcus pneumoniae SP14-BS69]
 gi|147757676|gb|EDK64694.1| Phage terminase large subunit [Streptococcus pneumoniae SP14-BS69]
          Length = 392

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/248 (14%), Positives = 93/248 (37%), Gaps = 17/248 (6%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G  + +  T    + +E     E V+ E ++R +     +     P      +   Y++
Sbjct: 113 SGLKRARGFTAFGAYVNEASLANEQVFKEIISRCSGEGARIVWDSNPDIPTHWLRRDYIN 172

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEEDI 122
           +           +++    +++ R+ I ++ P     +    G  + G G ++    E++
Sbjct: 173 SGDDMIIDFHFKLDDNTFMSDRYRENIKNATPAGVFYDRDILGLWVTGEGVVYRDFSENM 232

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
           V++++   +      G+D+G+ H  +   +         Y+++ +  + +   F V    
Sbjct: 233 VVDNVP-EDITKVYAGVDWGYEHFGSIVVIGET-SGGSAYLLEEHAHQYKEIDFWVD--- 287

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
              K +   + +     D    E ++        +   E     + +  V +GI ++   
Sbjct: 288 -LAKNIKERYGNITFWADSARPEHVA--------RFQREQLRTFNANKAVLSGIEEVAKL 338

Query: 243 MRSGRWKV 250
           M++GR+ V
Sbjct: 339 MKAGRFFV 346


>gi|321157064|emb|CBW39051.1| Phage terminase large subunit [Streptococcus phage 34117]
          Length = 404

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/248 (14%), Positives = 93/248 (37%), Gaps = 17/248 (6%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G  + +  T    + +E     E V+ E ++R +     +     P      +   Y++
Sbjct: 113 SGLKRARGFTAFGAYVNEASLANEQVFKEIISRCSGEGARIVWDSNPDIPTHWLRRDYIN 172

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEEDI 122
           +           +++    +++ R+ I ++ P     +    G  + G G ++    E++
Sbjct: 173 SGDDMIIDFHFKLDDNTFMSDRYRENIKNATPAGVFYDRDILGLWVTGEGVVYRDFSENM 232

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
           V++++   +      G+D+G+ H  +   +         Y+++ +  + +   F V    
Sbjct: 233 VVDNVP-KDITKVYAGVDWGYEHFGSIVVIGET-SGGSAYLLEEHAHQYKEIDFWVD--- 287

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
              K +   + +     D    E ++        +   E     + +  V +GI ++   
Sbjct: 288 -LAKNIKERYGNITFWADSARPEHVA--------RFQREQLRTFNANKAVLSGIEEVAKL 338

Query: 243 MRSGRWKV 250
           M++GR+ V
Sbjct: 339 MKAGRFFV 346


>gi|148990210|ref|ZP_01821441.1| Phage terminase large subunit [Streptococcus pneumoniae SP6-BS73]
 gi|147924477|gb|EDK75566.1| Phage terminase large subunit [Streptococcus pneumoniae SP6-BS73]
          Length = 404

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 35/248 (14%), Positives = 93/248 (37%), Gaps = 17/248 (6%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G  + +  T    + +E     E V+ E ++R +     +     P      +   Y++
Sbjct: 113 SGLKRARGFTAFGAYVNEASLANEQVFKEIISRCSGEGARIVWDSNPDIPTHWLRRDYIN 172

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEEDI 122
           +           +++    +++ R+ I ++ P     +    G  + G G ++    E++
Sbjct: 173 SGDDMIIDFHFKLDDNTFMSDRYRENIKNATPAGVFYDRDILGLWVTGEGVVYRDFSENM 232

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
           V++++   +      G+D+G+ H  +   +         Y+++ +  + +   F V    
Sbjct: 233 VVDNVP-EDITKVYAGVDWGYEHFGSIVVIGET-SGGSAYLLEEHAHQYKEIDFWVD--- 287

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
              K +   + +     D    E ++        +   E     + +  V +GI ++   
Sbjct: 288 -LAKNIKERYGNITFWADSARPEHVA--------RFQREQLRTFNANKAVLSGIEEVAKL 338

Query: 243 MRSGRWKV 250
           M++GR+ V
Sbjct: 339 MKAGRFFV 346


>gi|300768463|ref|ZP_07078363.1| PBSX family phage terminase [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|300493981|gb|EFK29149.1| PBSX family phage terminase [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
          Length = 412

 Score =  115 bits (287), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 36/246 (14%), Positives = 76/246 (30%), Gaps = 18/246 (7%)

Query: 11  WQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS- 67
            +  T    + +E     E+V+ E L R +A    +     P      +   Y+      
Sbjct: 120 IRGMTSFGAYINEASLANEEVFNEILNRCSAQGARIICDTNPDVPTHYLKASYIDNDDPK 179

Query: 68  -DRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEEDIVIN 125
                   TI++      Q  +      P     +    G  + G G ++    +D +I 
Sbjct: 180 AGTVSFHFTIDDNTFLPPQYVEHQKAGTPSGMFYDRAILGLWVSGEGMVYKDFNKDEMII 239

Query: 126 SLDIPE-HWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
                        G+D+G+ H      +  +R  +  Y+++ +  + +   + V   K  
Sbjct: 240 PRAQLPADLTYYAGVDWGYEHKGTIVVMADDRVGNT-YLIEEHTRQFEEIDYWVEIAKDI 298

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
            +             D    E ++        +   E     +    V +GI  +   M+
Sbjct: 299 QRRYGRNVK---FWADSARPEHVA--------RFQREGLKAFNAKKSVLSGIESVAKCMK 347

Query: 245 SGRWKV 250
            G + V
Sbjct: 348 QGHFFV 353


>gi|269119880|ref|YP_003308057.1| phage terminase, large subunit, PBSX family [Sebaldella termitidis
           ATCC 33386]
 gi|268613758|gb|ACZ08126.1| phage terminase, large subunit, PBSX family [Sebaldella termitidis
           ATCC 33386]
          Length = 416

 Score =  115 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 40/236 (16%), Positives = 71/236 (30%), Gaps = 22/236 (9%)

Query: 18  YVWFDEE---PPEDVYFEGLTRINATQ-----GLVTLTLTPLKGRSPIIEHYLSASSSDR 69
           +VW +E      ED + +    I           +T T  P   +  +   +      D 
Sbjct: 126 WVWIEEAYELMSEDAFNKLDLSIRGKLPEHLWKQITFTFNPWNEKHWLKARFFDVEDEDI 185

Query: 70  QVIRMTINETPHYNEQERKRIIDSYPLHEREARTKG--EPILGSGRIFPIVEEDIV-INS 126
             +  T       ++ +RK        + +  R +G  E  +  G IF   EE       
Sbjct: 186 LALTTTYKINEFLDDDDRKVFEKMKRDNPKRYRVEGEAEWGIAEGLIFENWEEKEFDYRE 245

Query: 127 LDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG 185
           +   +  V   G+DFG+   P A    + +  +  IYV   +             +K  G
Sbjct: 246 ISKRKGVVSRFGLDFGYTNDPSAFTGYLEDEKNKEIYVFDEFYKSGMLNDEIANQIKYMG 305

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
                       Q           + +R G++          G + V  GI  +  
Sbjct: 306 YAKEEIIGDSSEQKS-------IEEIKRYGIR---RIRPSVKGKDSVLHGIQLLQQ 351


>gi|297565631|ref|YP_003684603.1| hypothetical protein Mesil_1197 [Meiothermus silvanus DSM 9946]
 gi|296850080|gb|ADH63095.1| hypothetical protein Mesil_1197 [Meiothermus silvanus DSM 9946]
          Length = 434

 Score =  115 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 54/258 (20%), Positives = 94/258 (36%), Gaps = 22/258 (8%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPP----EDVYFEGLTRINATQGLVTLTLTPLKGRSP 56
              + Q  D  +S T    W DE        D +   L R++  QG V +T TP      
Sbjct: 129 FFGHAQDPDSLESATAKAAWLDEAGQKKFRRDSWQAILRRLSIHQGRVLITTTPYYLG-W 187

Query: 57  II---EHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGR 113
           +             D +++     + P++   E +R   + P  + +    G     +G+
Sbjct: 188 LKADLHDPARQGHPDIELVNFKSVDNPNFPRAEYERARATLPRWKFDMFYNGLFTRPAGQ 247

Query: 114 IFPIVEEDIVINS-LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ 172
           I+   + ++ +    ++PE W +  G+DFG  +  AA  L  N  S+  +V   Y+   +
Sbjct: 248 IYDCFDPEVHVRPAFNVPEDWPRFIGLDFGGVN-TAAVKLAKNPASEEYFVYAEYKAGGR 306

Query: 173 TPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
           T   H   L       P A         K  G      +   G+ +             V
Sbjct: 307 TAREHAEVLLKGEPRAPHAVGGA-----KSEGNWRLE-FAAAGLGVAAPPVA------DV 354

Query: 233 EAGISDMLDRMRSGRWKV 250
           E GI+ +   ++SGR  V
Sbjct: 355 EVGINRVYGLLKSGRLYV 372


>gi|295102643|emb|CBL00188.1| Terminase-like family [Faecalibacterium prausnitzii L2-6]
          Length = 464

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 56/309 (18%), Positives = 96/309 (31%), Gaps = 64/309 (20%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGR--- 54
             Y + R  +Q     ++ FDE    +     Y     R       V L  T   G    
Sbjct: 90  MQYTKDRTNYQGKAFDFIGFDELTHFEWEEYSYMMSRNRPTGPGTRVYLRATTNPGGVGH 149

Query: 55  SPIIEHYLSASSSD----------------------RQVIRMTINETP--HYNEQERKRI 90
             +   +++ +                         R  I  +I + P    N+ +    
Sbjct: 150 GWVKARFITPAPPGTPIVEEYPVRMPDGTEKVLRRARVFIPSSIFDNPALLENDPDYLAS 209

Query: 91  IDSYPLHEREARTKGEPILGSGRIFPIVEED----------IVINSLDIPEHWVQIGGMD 140
           + + P  E++A   G     SG++F     D           VI    IP+HW    G D
Sbjct: 210 LAAMPEAEKQALLYGSWDSFSGQVFTEWRNDPNHYEDQRWTHVIAPFTIPKHWKIYRGYD 269

Query: 141 FGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH-------VAALKSWGKWLP---- 189
           FG+  PF+ G    + +  +  + + Y C  +               ++   +  P    
Sbjct: 270 FGFSKPFSVGWYAADEEGRLYRIKELYGCTGRPNEGLRIDPVEQARRIREAEQNDPVLRG 329

Query: 190 --WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR--- 244
                  D    D+  GE +++   R      P    +  G +   AG   M  R+    
Sbjct: 330 RVIQGIADPAIFDESRGESIASMMERG-----PNFLHWMPGDHTRLAGKMQMHYRLNFDG 384

Query: 245 SGR--WKVF 251
            GR   +VF
Sbjct: 385 EGRPMLQVF 393


>gi|29832064|ref|NP_826698.1| phage-related terminase large subunit [Streptomyces avermitilis
           MA-4680]
 gi|29609182|dbj|BAC73233.1| putative phage-related terminase large subunit [Streptomyces
           avermitilis MA-4680]
          Length = 432

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 33/268 (12%), Positives = 83/268 (30%), Gaps = 23/268 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY- 61
           E  +DK +  ++   + DE    PE  +    +R++     +  T  P      + + Y 
Sbjct: 104 ESSKDKIRGLSLVGAYVDELSTMPESFFSMLTSRMSDANPRLIGTSNPDSANHWLKKKYL 163

Query: 62  --------------LSASSSDRQVIRMTINETPHYNEQERKR--IIDSYPLHEREARTKG 105
                            +  D   +   I++ P       ++     +      +    G
Sbjct: 164 DKARVHLTRTGEVRTPGNDLDLARLTFVIDDNPTLTPTYVQQRKAEYAATPLLYKRLILG 223

Query: 106 EPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVK 165
           E  +  G ++ + ++   +  +          G+D+G  +  AA  +    D   +YV  
Sbjct: 224 EWCIAEGAVYEVFDDQRHVVDIVPEIVQWLGVGLDYGTSNATAALLVGIGSDG-CVYVTN 282

Query: 166 NYRCREQTPIFHVA-ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMK--MLPEC 222
            +R    T        +    +         G +       +L        ++  +  + 
Sbjct: 283 EWRHDGHTEEQLSDGQISQRLRTWMRTLTVPGSRDKGIEPPRLIVDPSAASLRKQLQLDG 342

Query: 223 ATFDDGSNGVEAGISDMLDRMRSGRWKV 250
                  N V +GI  + + + + + ++
Sbjct: 343 LGSMRAHNKVLSGIRIVANLLAADKLRI 370


>gi|289551569|ref|YP_003472473.1| Phage terminase, large subunit [Staphylococcus lugdunensis
           HKU09-01]
 gi|289181100|gb|ADC88345.1| Phage terminase, large subunit [Staphylococcus lugdunensis
           HKU09-01]
          Length = 424

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 27/250 (10%), Positives = 81/250 (32%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 113 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHINKQIFLMFNPVSKL 171

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 172 NWVYKYFFEHDKPMENVMIRQSSYRDNKFLDEMTRQNLELLASRNPAYYKIYALGEFATL 231

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + +     H      +DFG+ + P A  H   + ++  +Y+V+ Y  + 
Sbjct: 232 DKLVFPKYEKKLLNKQELSHLQSYFAIDFGYVNDPSAFIHCKVDMENKKLYIVEEYVKKG 291

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + ++      G+           G + 
Sbjct: 292 MLNNEIAEVIKRLG------YAKEIITADSAEQKSIAEI-SNHGI---TRIRPAMKGKDS 341

Query: 232 VEAGISDMLD 241
           + +GI  +  
Sbjct: 342 IISGIQYLNQ 351


>gi|238018850|ref|ZP_04599276.1| hypothetical protein VEIDISOL_00710 [Veillonella dispar ATCC 17748]
 gi|237864616|gb|EEP65906.1| hypothetical protein VEIDISOL_00710 [Veillonella dispar ATCC 17748]
          Length = 415

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 74/234 (31%), Gaps = 21/234 (8%)

Query: 19  VWFDEE---PPEDVYF---EGLTRINATQG--LVTLTLTPLKGRSPIIEHYLSASSSDRQ 70
           +W +E      ED +    E +           V LT  P   R  + + +    S +  
Sbjct: 133 LWIEEAYEIMSEDAFNRLDESIRGQLPDGLYHQVVLTFNPWSDRHWLKKRFFDEPSDNVL 192

Query: 71  VIRMTINETPHYNEQERKRIIDSYPLHEREART-KGEPILGSGRIFPIVEEDIVINSLDI 129
            +          +E +     +     +R      G   +  G ++   +E         
Sbjct: 193 AMTTNYLCNEFLSESDLVLFEEMKKNPKRYQVAGLGNWGVVEGLVYENWKEQEFSVDYIR 252

Query: 130 PEHWVQIG-GMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKW 187
            +   +   G+DFG+   P A   ++ +  +  IY+         T     + +   G  
Sbjct: 253 GQTGTKSAFGLDFGYTVDPTALVCMLVDMVNKKIYIFDELYETGLTNQQLASRIIDMG-- 310

Query: 188 LPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
               +  + ++ D    + +  +  + G+K +        G + +  GI  + D
Sbjct: 311 ----YAKEKIRADSAEPKSI-EELYQAGLKGI---TRARKGKDSILNGIQRIQD 356


>gi|317152051|ref|YP_004120099.1| hypothetical protein Daes_0328 [Desulfovibrio aespoeensis Aspo-2]
 gi|316942302|gb|ADU61353.1| protein of unknown function DUF264 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 428

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/246 (12%), Positives = 66/246 (26%), Gaps = 16/246 (6%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS- 63
             D  +   +    FDE  + P  V+ E +    + +    + +   +G++ +   +   
Sbjct: 110 NPDSLRGMYLDGAVFDEVAQMPHRVWTEVIRPALSDRMGWAMFIGTPRGKNALYRLWQDA 169

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFP-----IV 118
               D        ++T      E           E E   +          +        
Sbjct: 170 RRDPDWFAAMYRASQTGIIEPGELAAAAREMSPEEYEQEFECSFTAAIRGAYFSALIGEA 229

Query: 119 EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
           ++   I  +            D G     A    V  R  +   +V  Y    +    + 
Sbjct: 230 DKGGRITKVPHDPSLPVHTAWDLGMSDSTAI-WFVQARPGNAFAIVDYYEASGEGLDHYA 288

Query: 179 AALKSWGKWLP-WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
             L            PHD    +  +G+      R  G++           +  ++ GI+
Sbjct: 289 RVLDERRYAYGSHIAPHDIRVRELGTGKSRLEIARALGIRFDIAP------NIPIQDGIN 342

Query: 238 DMLDRM 243
            +   +
Sbjct: 343 AVRAML 348


>gi|169343347|ref|ZP_02864353.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens C str. JGS1495]
 gi|169298524|gb|EDS80608.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens C str. JGS1495]
          Length = 415

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/236 (12%), Positives = 80/236 (33%), Gaps = 22/236 (9%)

Query: 18  YVWFDEEPP------EDVYFEGLTRINATQ--GLVTLTLTPLKGRSPIIEHYLSASSSDR 69
           + WF+E          +     +           +TL+  P   +  + + +      + 
Sbjct: 132 WAWFEEAFQVMNEDDFNKVDMSIRGELPMGYFKQITLSFNPWSEKHWLKKRFFDTKDDNI 191

Query: 70  QVIRMTINETPHYNEQERKRIIDSYPLHEREARTK--GEPILGSGRIFPIVEE-DIVINS 126
             +           + +RK        + R  + +  GE  +  G ++    E +  +  
Sbjct: 192 LALTTNYKCNEFLGDDDRKLFESMKENNPRRYKIEGLGEWGIADGLVYENFTELEFDVKE 251

Query: 127 LDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG 185
           +   +  + + G+DFG+   P A    + +  +  +++   +  +  +    V  +K  G
Sbjct: 252 ISKRKGIISVFGLDFGYTNDPTAFICCLVDEKTKELFIFDEHYQKAMSNTDIVNMIKYKG 311

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
                 +  + +  D    + +    ++QG++          G + +  GI ++ D
Sbjct: 312 ------YSKEKIIADSAEPKSIDDI-KKQGIR---RIKAAQKGKDSILNGIQNIQD 357


>gi|256847412|ref|ZP_05552858.1| PBSX family phage terminase, large subunit [Lactobacillus
           coleohominis 101-4-CHN]
 gi|256716076|gb|EEU31051.1| PBSX family phage terminase, large subunit [Lactobacillus
           coleohominis 101-4-CHN]
          Length = 386

 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 92/256 (35%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
            +G +  +  T +  + +E      DV+ E L R +     V     P   +  +   Y+
Sbjct: 114 ARGMNAIRGMTSYGAYVNETSLSTHDVFQEILDRCSVPNARVLCDTNPDNPQHWLKVDYI 173

Query: 63  SASSS---DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIV 118
             S+      +    TI++ P  +      +    P      R   G  + G G ++   
Sbjct: 174 DKSNEPKNRIKAFHFTIDDNPTLDPTYVSTLKAVTPSGMYYDRSILGLWVTGEGAVYKDF 233

Query: 119 EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH- 177
           +E  +I    +P     I G+D+G+ H  +      ++D +  Y+V+ +  + +   +  
Sbjct: 234 DERKMIVD-KVPPMARYIAGVDWGYQHYGSIVVFGVDKDDN-WYLVEEHSEKYKEIDYWT 291

Query: 178 ---VAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
                  + +GK +P+       +H           ++  G+  L        G   V  
Sbjct: 292 DIAHELQEKYGKNMPFYCDTARTEH--------IDHFKHSGINALY-------GWKSVVP 336

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +   M+ GR+ V
Sbjct: 337 GIEIVASLMKQGRFFV 352


>gi|258424837|ref|ZP_05687711.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A9635]
 gi|257845001|gb|EEV69041.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A9635]
          Length = 427

 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/250 (12%), Positives = 86/250 (34%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSN-TVHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   V  +  +E      D Y +   R+   +     + L   P+   
Sbjct: 116 FKGLD-NPEKIKSIKAVSDIVMEEASEFTLDDYTQLTLRLRERKHESKQIFLMFNPVSKL 174

Query: 55  SPIIEHYLSASS--SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++ +         + + +  +    ++  +  + +    +    +        + 
Sbjct: 175 NWVYKYFFANGVQMEGVLIRQSSYKDNKFLDKMTKNNLEELANRNPAYYKIYALGEFATL 234

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  I + D   H     G+DFG+ + P A  HL  + ++  +Y++  Y  + 
Sbjct: 235 DKLVFPKYEKRIINTDKIRHLPSYFGLDFGYINDPSALIHLKIDIENKKLYIISEYVKKG 294

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K+ G      +  + +  D    + ++   R+ G+           G + 
Sbjct: 295 MLNDEIAKLIKNLG------FSKEVISADSAEQKSIAEI-RKHGI---GRIKPAIKGKDS 344

Query: 232 VEAGISDMLD 241
           + AGI  +  
Sbjct: 345 IMAGIQFISQ 354


>gi|256375788|ref|YP_003099448.1| phage terminase, large subunit, PBSX family [Actinosynnema mirum
           DSM 43827]
 gi|255920091|gb|ACU35602.1| phage terminase, large subunit, PBSX family [Actinosynnema mirum
           DSM 43827]
          Length = 437

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/255 (15%), Positives = 78/255 (30%), Gaps = 21/255 (8%)

Query: 11  WQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS- 67
            +  T+   + DE    PE  + + + R++     +  T  P      +   YL    + 
Sbjct: 118 LRGLTLAGAYVDEITLVPEAFWQQLMGRLSVAGAQLFGTTNPDSPMHWLRVDYLDREHTE 177

Query: 68  ---DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED-IV 123
                +  +  +++ P   E+++++    +          GE +   G I+ ++++    
Sbjct: 178 PALGLRSFKFVLDDNPGIPEEKKRQYKAQFTGLWYRRFILGEWVGAEGSIYDMLDDALHC 237

Query: 124 INSLDIPEHWVQIGGMDFGWHHPF--AAGHLVWNRDS-DVIYVVKNYRCREQTPIFHVAA 180
             +             D+G  +P       L  +      +YVV  +    +       A
Sbjct: 238 RTAPPRERWQAAWMAADYGTSNPTHAVMVVLAVDEQGVPGLYVVAEWEHDGRKKGSLADA 297

Query: 181 L--KSWGKWLPWAWPHDGLQHD---KRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +  K    W        GL        S   L  Q R  G   L          N V+ G
Sbjct: 298 VISKRLADWATGVLDGTGLVPTPVLDPSAASLRTQMRADGWPGLRS------ADNRVDVG 351

Query: 236 ISDMLDRMRSGRWKV 250
           + +        R  V
Sbjct: 352 LRNTASLFAGARLFV 366


>gi|239502629|ref|ZP_04661939.1| hypothetical protein AbauAB_09982 [Acinetobacter baumannii AB900]
          Length = 414

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/251 (12%), Positives = 70/251 (27%), Gaps = 18/251 (7%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
             D  +   + ++  DE  +  E+ + + L    A+ G   + +   K  + +   Y+  
Sbjct: 105 DPDSLRGVGIDFLVLDEFQDISEEAWTQCLRPTLASTGGHAIFIGTPKAYNQLYTVYMQG 164

Query: 65  SSSD------RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIV 118
                      Q  +     +P   E E +           +          SGR++   
Sbjct: 165 QDPKKVKAGQWQSWQFPTITSPFIPESEIEAARADMDEKSFKQEFLASFETMSGRVYYPF 224

Query: 119 EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
           +    +             GMDF           +  + +  ++VV              
Sbjct: 225 DRKEHVGKYPFDPKLPIWIGMDFNIDPMSTVI--MQPQPNGEVWVVDEIVQFGSNTEEIC 282

Query: 179 AALK----SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
             ++     + K +       G Q     GE      R +G K +            +  
Sbjct: 283 EEIERKYWRYMKQIVIFPDPAGGQRQHARGESDLDIMREKGFKKILYRRKHP----AIAD 338

Query: 235 GISDMLDRMRS 245
            ++ +   +R+
Sbjct: 339 RVNAVNRMLRT 349


>gi|223044351|ref|ZP_03614386.1| phage terminase, large subunit, pbsx family [Staphylococcus capitis
           SK14]
 gi|222442319|gb|EEE48429.1| phage terminase, large subunit, pbsx family [Staphylococcus capitis
           SK14]
          Length = 426

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/250 (11%), Positives = 83/250 (33%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 113 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHDFKQIFLMFNPVSKL 171

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++           + + +  +    +E  R  +      +    +        + 
Sbjct: 172 NWVYKYFFEHGEDMKGVMIRQSSYKDNKFLDEITRNNLELLAQRNPAYYKIYALGEFATL 231

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  + + D   H     G+DFG+ + P A  H+  ++++  +Y+++ Y    
Sbjct: 232 DKLVFPKYEKRLLNKDELRHLPSYFGLDFGYVNDPSAFIHVKIDKNNKKLYIIEEYVKTG 291

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +K  G      +  + +  D    + +    ++ G++          G   
Sbjct: 292 MLNDEIARTIKQLG------YAKEEITADSAEQKSIQEI-KKLGVE---RIKPTRKGKGS 341

Query: 232 VEAGISDMLD 241
           V  GI  ++ 
Sbjct: 342 VVQGIQFLMQ 351


>gi|66395220|ref|YP_239489.1| ORF005 [Staphylococcus phage 187]
 gi|62635572|gb|AAX90683.1| ORF005 [Staphylococcus phage 187]
          Length = 446

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 31/250 (12%), Positives = 79/250 (31%), Gaps = 20/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQ---GLVTLTLTPLKGR 54
            K  +   +K +S   +  +  +E      + Y +   R+   +     + L   P+   
Sbjct: 135 FKGLD-NPEKIKSIKGISDIVMEEASEFTLNDYTQLTLRLRERKHMNKQIFLMFNPVSKL 193

Query: 55  SPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
           + + +++        +  + + +  +    +E  R+ +      +    +        + 
Sbjct: 194 NWVYKYFFEHGEPMENVMIRQSSYRDNKFLDEMTRQNLELLANRNPAYYKIYALGEFATL 253

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                 + +  I S     H     G+DFG+ + P A  H+  + D+  +YV+  Y  + 
Sbjct: 254 DKLVFPKYEKRIISDKEVGHLPSYFGLDFGYVNDPSAFIHVKIDNDNKKLYVISEYVKKG 313

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    +   G      +  + +  D    + +           +        G + 
Sbjct: 314 MLNNEIAQVINDLG------YSKEKITADSAEQKSIMEIKT----NGIDRIVPAMKGKDS 363

Query: 232 VEAGISDMLD 241
           V AGI  +  
Sbjct: 364 VMAGIQFVSQ 373


>gi|266622404|ref|ZP_06115339.1| phage terminase, large subunit, PBSX family [Clostridium hathewayi
           DSM 13479]
 gi|288865857|gb|EFC98155.1| phage terminase, large subunit, PBSX family [Clostridium hathewayi
           DSM 13479]
          Length = 479

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/290 (13%), Positives = 74/290 (25%), Gaps = 57/290 (19%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E+ +D  Q  T+  ++ DE    PE    +   R + T         P         +++
Sbjct: 146 ERSQDLIQGITLAGLFCDEVALMPESFVNQATGRCSVTGSKYWFNCNPDGPYHWFKVNWI 205

Query: 63  ------------------------SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE 98
                                     +      +  T+++    +E+ + R    Y    
Sbjct: 206 DKAIGYLGKEKVAKIREDAAKTGADPALKKLLYVHFTMDDNLSLSEEIKARYRSMYTGVF 265

Query: 99  REARTKGEPILGSGRIFPIVEEDIVINSLD------------IPEHWVQIGGMDFGWHHP 146
            E    G   +  G I+ + +        +                  +    D+G  +P
Sbjct: 266 FERYIMGLWAMAEGIIYDMFDLARNATDTEALAVSYKTKTGHDFWTDERYVSCDYGTQNP 325

Query: 147 FAAGHLVWNRDSDVIYVVKNYRCRE------QTPIFHVAALKSWGKWLPWAWPHDGLQHD 200
            A        D    Y  + Y          +T       L +W   +            
Sbjct: 326 TAFLLWNKAAD-KKWYCRREYYYSGRDKGRQKTDKEFSDDLTAWLDGIAIKA-----VIL 379

Query: 201 KRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
             +     AQ  + G K+           N V  GI  +   +  G   +
Sbjct: 380 DPAAASFKAQLEKDGYKV-------KKAKNDVLDGIRFVATLLLQGSIFI 422


>gi|315162649|gb|EFU06666.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0645]
          Length = 440

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 74/259 (28%), Gaps = 21/259 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T    +FDE    P+    +   R++           P          +L
Sbjct: 130 EASQDLVQGLTAAGFFFDEVALMPQSFVNQATARLSVDGAKSWFNCNPAGPHHWFKLEWL 189

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
              +    + I  T+ + P  +E+   R    Y     +   +G  +L  G IF   ++ 
Sbjct: 190 DKLTEKHAIRIHFTMEDNPSLSERVIDRYKRMYSGVFYDRYIRGLWVLSEGIIFDNFDKT 249

Query: 122 IVINSLDIPEHWVQ-IGGMDFGWHHPFAAGHLVWNRDS-----DVIYVVKNYRCREQTPI 175
            ++  L    ++ +    +D+G  +           D         Y    +    +   
Sbjct: 250 TMVVDLPENTNYKKSYVSVDYGTQNATVFKLWSLPIDGTGNDMPFWYCRDEFYYSGRESS 309

Query: 176 FH---VAALKSWGKWLPWAWPHDGLQHD--KRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
                   +    K+                 S     A  ++ G  +           N
Sbjct: 310 KQKTDAQFVDEMEKFFSINNLSKKKTKILLDPSAASFKAALKQSGFIV-------KSAKN 362

Query: 231 GVEAGISDMLDRMRSGRWK 249
            V  GI  ML  M + + K
Sbjct: 363 NVLDGIRTMLSNMDNQKVK 381


>gi|268319311|ref|YP_003292967.1| phage terminase large subunit [Lactobacillus johnsonii FI9785]
 gi|262397686|emb|CAX66700.1| phage terminase large subunit [Lactobacillus johnsonii FI9785]
          Length = 423

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/254 (15%), Positives = 82/254 (32%), Gaps = 24/254 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPED--VYFEGLTRINATQGL---VTLTLTPLKGR 54
            K  +   +K +S   +  V  +E    +   Y +   R+   +     +     P+   
Sbjct: 113 FKGMD-DPEKIKSIKGLSDVVMEEASEFNHNDYTQLTLRLREPKHKKRQIFCMFNPVSKL 171

Query: 55  SPIIEHYLSAS----SSDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPI 108
           +     + +       S   + + T  +    +E   + I D    +    +  T GE  
Sbjct: 172 NWTYTTWFAPDVNLDKSRVAIHQSTYKDNQFLDEDNIRTIEDLKNTNPAYYKIYTLGEFA 231

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNY 167
                +FP  E   +        +     G+DFG+ + P A  H   +  + VIYV+  +
Sbjct: 232 TLDKLVFPSFETRRLDPHSSDLVNIPDYFGLDFGYVNDPSAFTHTKIDMKNKVIYVIDEF 291

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             +          +K  G      +  + +  D    + ++   RR G+           
Sbjct: 292 VKKGLLNNELAQVIKDLG------YSKEVITADSAEKKSIAE-MRRDGIY---RIRPALK 341

Query: 228 GSNGVEAGISDMLD 241
           G + +  GI  +  
Sbjct: 342 GPDSIIQGIQFLQQ 355


>gi|256964516|ref|ZP_05568687.1| phage terminase large subunit [Enterococcus faecalis HIP11704]
 gi|256955012|gb|EEU71644.1| phage terminase large subunit [Enterococcus faecalis HIP11704]
          Length = 439

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 74/259 (28%), Gaps = 21/259 (8%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T    +FDE    P+    +   R++           P          +L
Sbjct: 129 EASQDLVQGLTAAGFFFDEVALMPQSFVNQATARLSVDGAKSWFNCNPAGPHHWFKLEWL 188

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
              +    + I  T+ + P  +E+   R    Y     +   +G  +L  G IF   ++ 
Sbjct: 189 DKLTEKHAIRIHFTMEDNPSLSERVIDRYKRMYSGVFYDRYIRGLWVLSEGIIFDNFDKT 248

Query: 122 IVINSLDIPEHWVQ-IGGMDFGWHHPFAAGHLVWNRDS-----DVIYVVKNYRCREQTPI 175
            ++  L    ++ +    +D+G  +           D         Y    +    +   
Sbjct: 249 TMVVDLPENTNYKKSYVSVDYGTQNATVFKLWSLPIDGTGNDMPFWYCRDEFYYSGRESS 308

Query: 176 FH---VAALKSWGKWLPWAWPHDGLQHD--KRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
                   +    K+                 S     A  ++ G  +           N
Sbjct: 309 KQKTDAQFVDEMEKFFSINNLSKKKTKILLDPSAASFKAALKQSGFIV-------KSAKN 361

Query: 231 GVEAGISDMLDRMRSGRWK 249
            V  GI  ML  M + + K
Sbjct: 362 NVLDGIRTMLSNMDNQKVK 380


>gi|329768643|ref|ZP_08260127.1| PBSX family phage terminase [Gemella haemolysans M341]
 gi|328836357|gb|EGF86022.1| PBSX family phage terminase [Gemella haemolysans M341]
          Length = 407

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 31/244 (12%), Positives = 75/244 (30%), Gaps = 17/244 (6%)

Query: 11  WQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            +  T    + +E     E V+ E ++R +     +     P      + + Y+ + S +
Sbjct: 120 IRGMTAFGAYINEASLANETVFKEIISRCSGDGARIVFDTNPDNPEHWLKKEYIDSESEN 179

Query: 69  RQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSG-RIFPIVEEDIVINS 126
                  +++    +E+  K I +S P     +   +G  + G G             + 
Sbjct: 180 IISYHFRLDDNTFLSERYIKNIKESTPSGMFYDRDIEGLWVTGEGIVYSDFDRNKHYFDD 239

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
                   +  G+D+G+ H  +   +  + D    Y+++ +  + +     V   K   +
Sbjct: 240 YSNITFKKKFAGVDWGYSHYGSIVVMGESVDG-KFYLLEEHAYQFKEIDDWVEIAKEIKE 298

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSG 246
                        D    E +         +   E     + +    AGI  +    +  
Sbjct: 299 RHGNI----TFYCDSARPEHVD--------RFYRERLNSVNANKERLAGIEQVARLFKKD 346

Query: 247 RWKV 250
              +
Sbjct: 347 SLFI 350


>gi|196048452|ref|ZP_03115627.1| phage terminase, large subunit, pbsx family [Bacillus cereus
           03BB108]
 gi|196020709|gb|EDX59441.1| phage terminase, large subunit, pbsx family [Bacillus cereus
           03BB108]
          Length = 419

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 43/260 (16%), Positives = 87/260 (33%), Gaps = 31/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDEE------PPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E          +   E +            +T+
Sbjct: 107 FRGLD-DPLKITSITVDVGNLCWAWFEEAYEIEDQHKFETVVESIRGSFDAPDFFKQITV 165

Query: 47  TLTPLKGRSPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P      +  ++   ++   D   I  T       +EQ+R R    Y  + R AR  
Sbjct: 166 TFNPWSENHWLKSYFFDEATQAYDTFAITTTYKCNEWLDEQDRARYESLYVKNPRRARIV 225

Query: 104 -KGEPILGSGRIFPIVE-EDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G ++   +  D  I+ +   +      G+DFG+   P A    + +  ++ 
Sbjct: 226 CDGEWGVADGLVYENFQVRDFDIDEIRQRKDVQSAFGLDFGYTNDPTALTCSLVDLKNET 285

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV   +  +  +     A ++  G      +  + +  D    + +       G++   
Sbjct: 286 IYVFDEHSQKGMSNKKIAAMIEKKG------YMKERITADSAEPKSIDE-LESLGIR--- 335

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + +  GI  + 
Sbjct: 336 RIEGARKGKDSINNGIQFIQ 355


>gi|257438500|ref|ZP_05614255.1| putative phage terminase, large subunit [Faecalibacterium
           prausnitzii A2-165]
 gi|257199079|gb|EEU97363.1| putative phage terminase, large subunit [Faecalibacterium
           prausnitzii A2-165]
          Length = 477

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 56/309 (18%), Positives = 95/309 (30%), Gaps = 64/309 (20%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGR--- 54
             Y + R  +Q     ++ FDE    +     Y     R       V L  T   G    
Sbjct: 103 MQYTKDRTNYQGKAFDFIGFDELTHFEWEEYSYMMSRNRPTGPGTRVYLRATTNPGGVGH 162

Query: 55  SPIIEHYLSASSSD----------------------RQVIRMTINETP--HYNEQERKRI 90
             +   +++ +                         R  I  ++ + P    N+ +    
Sbjct: 163 GWVKARFITPAPPGTPIVEQFPVRMPDGTEKVLERARVFIPSSVFDNPALLENDPDYLAS 222

Query: 91  IDSYPLHEREARTKGEPILGSGRIFPIVEED----------IVINSLDIPEHWVQIGGMD 140
           + S P  E++A   G     SG++F     D           VI    IP HW    G D
Sbjct: 223 LASLPEAEKQALLYGSWDSFSGQVFTEWRNDPGHYQDQRWTHVIAPFAIPRHWKIYRGYD 282

Query: 141 FGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH-------VAALKSWGKWLP---- 189
           FG+  PF+ G    + +  +  + + Y C  +               ++   +  P    
Sbjct: 283 FGFSKPFSVGWYAADEEGRLYRIKELYGCTGRPNEGLRIDPVEQARRIREAEQNDPMLKG 342

Query: 190 --WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM---R 244
                  D    D+  GE ++A   R      P    +  G +   AG      R+    
Sbjct: 343 RTILGVADPAIFDESRGESIAAMMERG-----PHFLHWVPGDHTRLAGKMQFHYRLAFDG 397

Query: 245 SGR--WKVF 251
            GR  ++VF
Sbjct: 398 EGRPMFQVF 406


>gi|304437549|ref|ZP_07397505.1| PBSX family phage terminase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369471|gb|EFM23140.1| PBSX family phage terminase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 416

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 38/263 (14%), Positives = 93/263 (35%), Gaps = 31/263 (11%)

Query: 5   EQGRDKW-QSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY 61
           ++G +K+ +  T+   + DE    PE  + + L R++     +  T  P      + + Y
Sbjct: 113 DEGSEKFIRGKTLAGAYCDELTLMPERFFKQLLNRLSVPGAKLYSTTNPDSPMHYLYKEY 172

Query: 62  LSASSSDR----QVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPI 117
           +++    R     V+   +++ P+  +  +  I  SY     +    G  +L  G I+ +
Sbjct: 173 VTSEQKLRDGLVSVVHFELDDNPNLTDDYKTNIRSSYSGMWFKRMILGLWVLAEGIIYDM 232

Query: 118 VEEDIVINSLDI----PEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR----- 168
             ++++ +  +          +    D+G  +P     +  +   + I++   Y      
Sbjct: 233 FSDELLFDDAEFTNTLRSTCRRYIACDYGTKNPMVFLDIYDD--GETIWIPNLYYWDSRK 290

Query: 169 -CREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             R++T   +  AL+            D +  D               ++         D
Sbjct: 291 KQRQKTDAQYADALEKMVGEEY----PDFIVIDPS--------AASFKLECQGRGFRVKD 338

Query: 228 GSNGVEAGISDMLDRMRSGRWKV 250
             N V  GI ++   +   + ++
Sbjct: 339 ADNSVNDGIREVAKLLTKKKIRI 361


>gi|218781804|ref|YP_002433122.1| hypothetical protein Dalk_3968 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763188|gb|ACL05654.1| protein of unknown function DUF264 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 443

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 33/221 (14%), Positives = 64/221 (28%), Gaps = 10/221 (4%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY-LS 63
             D+ +   +     DE  + PE V+ E +    + +    + +   +G +   + Y  +
Sbjct: 123 NPDRLRGIYLDGAVLDEMAQMPERVWGEIIRPALSDRLGWAMFIGTPRGHNAFYDLYQFA 182

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIV----- 118
            S  D        +ET      E           + E   +          +        
Sbjct: 183 RSDPDWFCAMYRASETGIVGRDELDAAKKEMTPEQYEQEFECSFSAAIVGAYYGPLIAQA 242

Query: 119 EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
           E++  I +L +          D G     A      +     I VV       Q   ++V
Sbjct: 243 EKEGRIVTLPVERALPVHTAWDLGMSDSTAVWFFQVSP-GGEIRVVDYLEDAGQGLDYYV 301

Query: 179 AALKSWGKWLPWAW-PHDGLQHDKRSGEQLSAQYRRQGMKM 218
            AL+           PHD    +  +G+      +  G+  
Sbjct: 302 RALRERDYLYGTHLAPHDIRVRELGTGKSRLESAKSLGVSF 342


>gi|291460129|ref|ZP_06599519.1| phage terminase, large subunit, PBSX family [Oribacterium sp. oral
           taxon 078 str. F0262]
 gi|291417470|gb|EFE91189.1| phage terminase, large subunit, PBSX family [Oribacterium sp. oral
           taxon 078 str. F0262]
          Length = 408

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 73/233 (31%), Gaps = 21/233 (9%)

Query: 18  YVWFDE-----EPPEDVYFEGLTRINATQ--GLVTLTLTPLKGRSPIIEHYLSASSSDRQ 70
           +VW +E     E   +     +           +TLT  P    S +   +  A      
Sbjct: 126 FVWIEEAYEVAEDDFNKLDMSIRGEVPEGYFKQLTLTFNPWSATSWLKARFFDAPDDTIF 185

Query: 71  VIRMTINETPHYNEQERKRIIDSYPLHEREARTKGE--PILGSGRIFPIVE-EDIVINSL 127
               T       ++ +R         + R  R +G+    +  G I+P    ED  +  +
Sbjct: 186 TKTTTWQCNEWLDDADRHIFEMMRRQNPRRYRIEGDGEWGIAEGLIYPNHRMEDFDVGEI 245

Query: 128 DIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKW 187
              E       +DFG+  P A    + +  +  IY+   +     T       +K  G  
Sbjct: 246 RAQEGVKAAFNLDFGFTDPNAFVCELVDGQAKKIYIFDEWYQSGVTNRIIAETIKEKGYG 305

Query: 188 LPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                    +  D    + ++   + +G++          G + V+ GI  + 
Sbjct: 306 GQ------RIICDCAEPKSIAE-LQDEGIRAEASL----KGRDSVQHGIQLIQ 347


>gi|194466764|ref|ZP_03072751.1| phage terminase, large subunit, PBSX family [Lactobacillus reuteri
           100-23]
 gi|194453800|gb|EDX42697.1| phage terminase, large subunit, PBSX family [Lactobacillus reuteri
           100-23]
          Length = 421

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/252 (12%), Positives = 76/252 (30%), Gaps = 22/252 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQGL---VTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D + +   R+   +     +     P+   
Sbjct: 113 FKGMD-DPEKIKSIKGLSDVVMEEASEFNQDDFTQLTLRLREPKHKKRQLFCMFNPVSKL 171

Query: 55  SPIIEHYLSAS----SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILG 110
           +   + +             + + T  +    +      I +    +    +        
Sbjct: 172 NWTYKQWFDPKAKVNPERVSIHQSTYKDNHFLDADNIATIENLKQTNPAYYKIYTLGEFA 231

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHP-FAAGHLVWNRDSDVIYVVKNYRC 169
           +       E +    S+          G+DFG+ +   A  H+  + ++  IYV++ Y  
Sbjct: 232 TLDKLVFPEFEKRRLSIRTLSQLPSYFGLDFGYTNDETAFMHVKVDENTQTIYVMEEYAK 291

Query: 170 REQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGS 229
                      +K  G      +  + +  D    + ++   R    ++ P       G 
Sbjct: 292 HGMLNDDIARIIKQMG------YSKEVITADAAEPKSIAEIKRDGISRIRPA----KKGK 341

Query: 230 NGVEAGISDMLD 241
           + +  G+S M  
Sbjct: 342 DSIIQGLSFMQQ 353


>gi|194466550|ref|ZP_03072537.1| phage terminase, large subunit, PBSX family [Lactobacillus reuteri
           100-23]
 gi|194453586|gb|EDX42483.1| phage terminase, large subunit, PBSX family [Lactobacillus reuteri
           100-23]
          Length = 421

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 32/251 (12%), Positives = 81/251 (32%), Gaps = 17/251 (6%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           +G    +  + +  + +E     ++ + E + R +     +     P   +  + + Y+ 
Sbjct: 113 RGASAIRGMSSYGSYINEASLATQEAFQEIIQRCSKPGARIICDTNPDSPQHYLKKDYID 172

Query: 64  ASSSDRQV--IRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVEE 120
                 ++      +++     +     +  + P      R   G  + G G ++   +E
Sbjct: 173 NKDPKARIKTFHFVLDDNTFLPKDYVDSLKAATPSGMYYDRSILGLWVTGEGAVYKDFDE 232

Query: 121 -DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
             + +   D+P+      G+D+G+ HP A   +  + D    Y+V     + +    H  
Sbjct: 233 RTMTVKREDLPDSLTYTAGVDWGYDHPTAIEIIGHD-DKGNYYLVDEAYGQFEQVDPHWI 291

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
           A+    +             D    E ++                   G   V  GI  +
Sbjct: 292 AVAQKFRKKYG--LKMPFYADTARTEHIA--------NFKEHHINAKYGYKNVLDGIERV 341

Query: 240 LDRMRSGRWKV 250
              ++  ++ V
Sbjct: 342 AKIIKQHKFYV 352


>gi|153954494|ref|YP_001395259.1| putative terminase large subunit [Clostridium kluyveri DSM 555]
 gi|153954586|ref|YP_001395351.1| hypothetical protein CKL_1968 [Clostridium kluyveri DSM 555]
 gi|219855077|ref|YP_002472199.1| hypothetical protein CKR_1734 [Clostridium kluyveri NBRC 12016]
 gi|146347444|gb|EDK33980.1| Phage-related protein [Clostridium kluyveri DSM 555]
 gi|152206097|gb|EDK33912.2| putative terminase large subunit [Clostridium kluyveri DSM 555]
 gi|219568801|dbj|BAH06785.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 423

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/251 (15%), Positives = 76/251 (30%), Gaps = 14/251 (5%)

Query: 7   GRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
              K +  T+     DE     E    + L+R++        T  P      I   Y+  
Sbjct: 115 DEGKIRGITIGGWMADEITLHHESFVKQALSRMSLKGAKAFWTTNPDSPYHYIRTEYIDK 174

Query: 65  SSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIV 123
              +        +++    +E+ ++ I  +Y     +   KG  ++  G I+P  +E   
Sbjct: 175 CKENEYCHWHFDLDDNLTLSEEYKENIKKAYSGLFYDRFIKGLWVMADGVIYPGFDEKKH 234

Query: 124 INSLDIPEHWV--QIGGMDFGWHHPFAAGHLVWNRDSDVIY--VVKNYRCREQTPIFHVA 179
             S+D             D+G  +P             + +  +V  Y  +         
Sbjct: 235 CISIDEVPRDNLIFYIPCDYGITNPHVYLKAAVRLYEHIPHIFIVDEYYNKGDGGSPKTD 294

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
            L                     S   L   +R+ G+ +L       +  N V  GIS++
Sbjct: 295 NLFLSDYKDFAKGIKPRNVIIDPSATSLINLFRQDGISVL-------EADNTVIDGISNV 347

Query: 240 LDRMRSGRWKV 250
              +   R  +
Sbjct: 348 TTWLNDERIHI 358


>gi|13491652|gb|AAK27930.1|AF195901_20 terminase large subunit [Lactobacillus prophage Lj928]
          Length = 423

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/248 (13%), Positives = 80/248 (32%), Gaps = 23/248 (9%)

Query: 7   GRDKWQSNT-VHYVWFDEEPPED--VYFEGLTRINATQGL---VTLTLTPLKGRSPIIEH 60
             +K +S   +  V  +E    +   Y +   R+   +     +     P+   +   + 
Sbjct: 119 DPEKIKSIKGLSDVVMEEASEFNHNDYTQLTLRLREPKHKQRQIFCMFNPVSKLNWTYQT 178

Query: 61  YLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRI 114
           +   S+        + + T  +    +E   + I +    +    +  T GE       +
Sbjct: 179 WFDPSADYDRSRVAIHQSTYKDNRFLDEDNIRTIEELKNTNPAYYKIYTLGEFATLDKLV 238

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
           FP  E   +              G+D+G+ + P A  H+  +  +  +YV+  +  +   
Sbjct: 239 FPYFETKRLNPRDPKLLALNDYFGLDYGFINDPSAFMHIKLDMRNKTLYVMDEFVKKGLL 298

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                  +K  G      +  + +  D    + ++   +R G+           G + + 
Sbjct: 299 NNQLAQVIKDMG------YSKEVITADSAEKKSIAE-MKRDGIY---RIRPALKGPDSII 348

Query: 234 AGISDMLD 241
            GI  +  
Sbjct: 349 QGIQFLQQ 356


>gi|41179314|ref|NP_958532.1| hypothetical protein Ljo_1439 [Lactobacillus prophage Lj928]
 gi|42519311|ref|NP_965241.1| Lj928 prophage protein [Lactobacillus johnsonii NCC 533]
 gi|38731443|gb|AAR27373.1| putative protein [Lactobacillus prophage Lj928]
 gi|41583599|gb|AAS09207.1| Lj928 prophage protein [Lactobacillus johnsonii NCC 533]
          Length = 422

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/248 (13%), Positives = 80/248 (32%), Gaps = 23/248 (9%)

Query: 7   GRDKWQSNT-VHYVWFDEEPPED--VYFEGLTRINATQGL---VTLTLTPLKGRSPIIEH 60
             +K +S   +  V  +E    +   Y +   R+   +     +     P+   +   + 
Sbjct: 118 DPEKIKSIKGLSDVVMEEASEFNHNDYTQLTLRLREPKHKQRQIFCMFNPVSKLNWTYQT 177

Query: 61  YLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRI 114
           +   S+        + + T  +    +E   + I +    +    +  T GE       +
Sbjct: 178 WFDPSADYDRSRVAIHQSTYKDNRFLDEDNIRTIEELKNTNPAYYKIYTLGEFATLDKLV 237

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
           FP  E   +              G+D+G+ + P A  H+  +  +  +YV+  +  +   
Sbjct: 238 FPYFETKRLNPRDPKLLALNDYFGLDYGFINDPSAFMHIKLDMRNKTLYVMDEFVKKGLL 297

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                  +K  G      +  + +  D    + ++   +R G+           G + + 
Sbjct: 298 NNQLAQVIKDMG------YSKEVITADSAEKKSIAE-MKRDGIY---RIRPALKGPDSII 347

Query: 234 AGISDMLD 241
            GI  +  
Sbjct: 348 QGIQFLQQ 355


>gi|66395738|ref|YP_240074.1| ORF009 [Staphylococcus phage 37]
 gi|62636161|gb|AAX91272.1| ORF009 [Staphylococcus phage 37]
          Length = 419

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/256 (15%), Positives = 79/256 (30%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFE------GLTRINATQG---LVTLTLTP 50
            Q  ++ +S           W +E        E       L R     G       T  P
Sbjct: 111 AQNPERIKSLKDAQFPYAIAWIEELAEFKTEDEVTTITNSLLRGELDNGLFYKFFYTYNP 170

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y S+   D   V   T    P   ++  +    +  ++E   R +    
Sbjct: 171 PKRKQSWVNKKYESSFQPDNTFVHHSTYLNNPFIAKEFIEEAKAAKAINELRYRWEYLGE 230

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I     +  + +  I   +DFG+   P A     +++   +IY V  
Sbjct: 231 AIGSGVVPFNNLRIETIPKEQFDTFDNIRNAVDFGYATDPLAFVRWHYDKKKRIIYAVDE 290

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           +   + +       LK  G      +  D +  D    + ++   +   ++         
Sbjct: 291 HYGVQISNREFANWLKKKG------YQSDEIYADSAEPKSIAELKQEHSIR---RIKGVK 341

Query: 227 DGSNGVEAGISDMLDR 242
            G + VE G   + D 
Sbjct: 342 KGPDSVEHGEQWLNDL 357


>gi|225405808|ref|ZP_03760997.1| hypothetical protein CLOSTASPAR_05029 [Clostridium asparagiforme
           DSM 15981]
 gi|225042675|gb|EEG52921.1| hypothetical protein CLOSTASPAR_05029 [Clostridium asparagiforme
           DSM 15981]
          Length = 475

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 35/280 (12%), Positives = 73/280 (26%), Gaps = 49/280 (17%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  V+FDE    PE    +   R +           P         +++
Sbjct: 144 ESSQDLVQGITLAGVFFDEVALMPESFVDQATGRCSVDGSKYWFNCNPAGPYHWFKANWI 203

Query: 63  SAS------------------------SSDRQVIRMTINETPHYNEQERKRIIDSYPLHE 98
             +                              +  T+++    +E+ + R    Y    
Sbjct: 204 DRAIGYLGKAEVERQKKEAEEKKQDISFKRLLYVHFTMDDNLSLSEEIKARYRSLYTGVF 263

Query: 99  REARTKGEPILGSGRIFPIVEEDIVI----NSLDIPEHWVQIGGMDFGWHHPFAAGHLVW 154
            +    G   +  G I+ + +    +       D      +    D+G  +  A      
Sbjct: 264 FKRYILGLWAMAEGIIYDMFDTARHVIRLAAVEDRLIPGGRYVSCDYGTQNALAFLLWNK 323

Query: 155 NRDSDVIYVVKNYRCRE------QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLS 208
             D  V Y  + Y          ++   +    + W                  S    +
Sbjct: 324 GTDG-VWYCTREYYYSGRDIGKQKSDSQYADDFEKWLAGTRIKA-----VIIDPSAASFA 377

Query: 209 AQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRW 248
            +   +G        +     N V  GI  +   + +G+ 
Sbjct: 378 VELNNRG-------YSTIKADNDVADGIRLVATLLNTGKI 410


>gi|300361372|ref|ZP_07057549.1| PBSX family phage terminase [Lactobacillus gasseri JV-V03]
 gi|300353991|gb|EFJ69862.1| PBSX family phage terminase [Lactobacillus gasseri JV-V03]
          Length = 412

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 36/249 (14%), Positives = 79/249 (31%), Gaps = 16/249 (6%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
           G    +  T +  + +E     E V+ E   R +     +     P      +  +Y+  
Sbjct: 119 GLKSARGFTAYGAYVNEASLANEAVFNEIQNRCSKGGSHIICDTNPDIPTHWLKTNYIDN 178

Query: 65  SSSDRQVI--RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFP-IVEED 121
            + D  V+    TI++         K +  S      +    G    G G ++    ++ 
Sbjct: 179 KNPDAGVVSFNFTIDDNTTLASDYVKSMKASKIGVFYDRDILGLWATGDGIVYQDFNKDT 238

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
           +V++ +     +       F   H      +  + D+D+ Y++  Y+   +   + V   
Sbjct: 239 MVVDEVPDDLEYYCGVDWGFAKGHENVITVMGDDPDTDISYLIGVYKSTGKYIDYWVDIA 298

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
           +       +         D    E +S            +     +    V  GI     
Sbjct: 299 QQIQDKRGYGIN---FWCDSARPEYVS--------YFQQQDIQARNADKSVMDGIEYCSS 347

Query: 242 RMRSGRWKV 250
           R++ G++KV
Sbjct: 348 RIKLGKFKV 356


>gi|70727357|ref|YP_254273.1| putative phage terminase large subunit [Staphylococcus haemolyticus
           JCSC1435]
 gi|68448083|dbj|BAE05667.1| putative phage terminase large subunit [Staphylococcus haemolyticus
           JCSC1435]
          Length = 421

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 76/256 (29%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFEG-------LTRINATQG--LVTLTLTP 50
            Q  ++ +S          +W +E        E        L              +  P
Sbjct: 113 AQNPERLKSLKDSRFPFSIMWIEELGEFKTEDEVTTITNSMLRGELDEGLFYKFYFSYNP 172

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K +      ++  S    +  V   T    P  ++Q  +    +   +E   R +    
Sbjct: 173 AKRKQHWANKKYETSFQPDNTFVHHSTYLNNPFISKQFIQEAESAKQRNELRYRWEYLGE 232

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I     D+   +  I   +DFG+   P A     +++   +IY V  
Sbjct: 233 AIGSGVVPFNNLRIEKIPDDLYNSFDNIRNAVDFGYATDPLAFVRWHYDKKKRIIYAVDE 292

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           +   + +       LK  G      +  D +  D    + ++   +  G++         
Sbjct: 293 HYGVQISNREFGNWLKKKG------YQSDEIYADSAEPKSIAELKQEHGIR---RIKGVK 343

Query: 227 DGSNGVEAGISDMLDR 242
            G + VE G   + D 
Sbjct: 344 KGPDSVEHGEQWLDDL 359


>gi|221067857|ref|ZP_03543962.1| phage terminase, large subunit, PBSX family [Comamonas testosteroni
           KF-1]
 gi|220712880|gb|EED68248.1| phage terminase, large subunit, PBSX family [Comamonas testosteroni
           KF-1]
          Length = 434

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 36/246 (14%), Positives = 83/246 (33%), Gaps = 15/246 (6%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++      VW +E        +   +  I      + LTL P        + +++ 
Sbjct: 122 SIKSFEG--CDIVWVEEAHGVSKKSWDTLIPTIRKEGSEIWLTLNPDMETDETYQRFIAT 179

Query: 65  SSSDRQVIRMTINETPHYN---EQERKRIIDSYPLHEREARTKGE-PILGSGRIFPIVEE 120
              D  V+ +   + P +    ++ER++   +    +     +G+   + +G I+    E
Sbjct: 180 PCPDTWVVEINWRDNPWFPRVLDEERRKAKRTMLADDYAHIWEGKARRVAAGAIYRHEME 239

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPF--AAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
            + +++      +     +   W   +  A    +  R    + ++ +     +T  ++V
Sbjct: 240 SVYLDNRARDVPYDPTLPVHTVWDLGWNDAMSIALVQRGPQDVRIIGHIEDSHRTLDWYV 299

Query: 179 AALKSWGKWLPWAW-PHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
           A L+         + PHDG   + ++G+      R  G                VE GI 
Sbjct: 300 AKLEKLPYRWGTDYLPHDGKTRNFQTGKSTEQLLRELG----RRSVMVQPRGTDVEEGIK 355

Query: 238 DMLDRM 243
            +   M
Sbjct: 356 QVRMLM 361


>gi|54025903|ref|YP_120145.1| putative phage terminase [Nocardia farcinica IFM 10152]
 gi|54017411|dbj|BAD58781.1| putative phage terminase [Nocardia farcinica IFM 10152]
          Length = 436

 Score =  111 bits (277), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 33/255 (12%), Positives = 80/255 (31%), Gaps = 16/255 (6%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +  T      DE    PE+ + +   R++     +  T  P   +  +  +++  +  
Sbjct: 117 KIRGMTACLAMVDEATLLPENFWTQLGARLSVPGAKLLATTNPDNPQHYLKVNFIDRAGE 176

Query: 68  DR---QVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
                     T+++ P  +++    +              G+ +   G ++   +    +
Sbjct: 177 RGMRLCAWDFTLDDNPGLDDEYVASLKAENQGLFYLRNILGQWVAADGAVYDCYDPAKHL 236

Query: 125 NSLDIPEHWVQI--GGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPIF 176
                          G+D G  +P AA  +    D+ V+Y V  +R          T + 
Sbjct: 237 VKWSELPEMQFYVGVGVDHGTTNPTAAVLIGLGADN-VLYAVDEWRYAPSNKEARWTNVQ 295

Query: 177 HVAALKSWGKWLPWAWPHDGLQHDKRSGE-QLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
               L+ W    P     D  Q  + +    +        +++  +    +     V  G
Sbjct: 296 LSEGLRGWLAG-PHHPKDDPHQPPRVTAPVHVDQAAADYRVQLKQDGLRNNPAVKDVLYG 354

Query: 236 ISDMLDRMRSGRWKV 250
           I  +     + + ++
Sbjct: 355 IRTVSALFSTDKLRI 369


>gi|139437136|ref|ZP_01771296.1| Hypothetical protein COLAER_00275 [Collinsella aerofaciens ATCC
           25986]
 gi|133776783|gb|EBA40603.1| Hypothetical protein COLAER_00275 [Collinsella aerofaciens ATCC
           25986]
          Length = 398

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/249 (18%), Positives = 71/249 (28%), Gaps = 19/249 (7%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
              K Q  T  +V+ DE     EDV+    +R+         T  P              
Sbjct: 104 SVSKIQGATFEWVYGDEVATWSEDVFQMLKSRLRCEHSHFDGTCNPDSPNHWFKR--FLD 161

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
             SD      TI +     +     I D       +    G+  L  G ++P  E    +
Sbjct: 162 GDSDIYRQDYTIWDGALAPDVIEALIKDYGSGVYYDRYILGKWTLAEGLVYPEWEG--AL 219

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH---VAAL 181
            S             D+G  + FAA       D  V + V  YR   +           +
Sbjct: 220 ESRYTGSAAKYAVSCDYGTQNAFAALLWA--FDGKVWHAVDEYRYSGRDTGHQKTDADYV 277

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
                ++           D  S     A  R+ G K          G N V  GI +   
Sbjct: 278 ADMADFVRGLGKPPTFIID-PSATSFIAAMRQAGFK-------TKKGRNDVADGIRETGV 329

Query: 242 RMRSGRWKV 250
            + +G  ++
Sbjct: 330 CLGNGTVRI 338


>gi|282851552|ref|ZP_06260917.1| phage terminase, large subunit, PBSX family [Lactobacillus gasseri
           224-1]
 gi|282557520|gb|EFB63117.1| phage terminase, large subunit, PBSX family [Lactobacillus gasseri
           224-1]
          Length = 409

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/251 (14%), Positives = 90/251 (35%), Gaps = 18/251 (7%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           +G    +  T +  + +E      +V+ E + R +     +     P      +   Y+ 
Sbjct: 115 RGIGAIRGMTSYGAYVNEASLATHEVFQEIVQRCSVRSARIICDTNPDIPTHWLKTDYID 174

Query: 64  ASSSDRQV--IRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVEE 120
                 ++     TI++    ++   + +  + P      R   G+ + G G ++    +
Sbjct: 175 NHDPKARIKAFSFTIDDNTFLSKDYVEALKAATPRGMFYDRSILGQWVTGDGIVYQDFNK 234

Query: 121 DIVINSLDIPEHW-VQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
           D ++   +          G+D+G+ HP     L  ++D +  YV+++Y  + +   + V 
Sbjct: 235 DKMVIPKNRVPDGLDYYVGVDWGYEHPNPIILLGDDKDGNT-YVLEDYTQKHKFINYWVK 293

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
             ++                D    + ++  ++  G+  +            V  GI  +
Sbjct: 294 IAQNLQTRFGRNL---IFYADSARPDNVNE-FQSNGLNCINANKN-------VLPGIECV 342

Query: 240 LDRMRSGRWKV 250
             +MR G++ V
Sbjct: 343 AKKMREGKFYV 353


>gi|256027856|ref|ZP_05441690.1| PBSX family phage terminase large subunit [Fusobacterium sp. D11]
 gi|289765807|ref|ZP_06525185.1| phage terminase [Fusobacterium sp. D11]
 gi|289717362|gb|EFD81374.1| phage terminase [Fusobacterium sp. D11]
          Length = 424

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/269 (14%), Positives = 84/269 (31%), Gaps = 35/269 (13%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQG--LVTLT 47
            + ++    K  S +V      + W +E      E   ++  E +  +        + LT
Sbjct: 109 FRGFD-DPLKITSISVSVGSLCWCWVEEAYELTDETAFNMLDESIRGVVEEPLFKQIILT 167

Query: 48  LTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KG 105
             P   R  +   +    + +   +          +E ++K   D    + R  +    G
Sbjct: 168 FNPWNERHWLKPRFFDRIAPNILALTTNYLCNEWLDEADKKLFEDMKINNPRRYQVAGLG 227

Query: 106 EPILGSGRIFPIVEEDIVINSLDIPEHWVQIG--GMDFGWH-HPFAAGHLVWNRDSDVIY 162
              +  G ++   +E        + +        G+DFG+   P A    + +++   IY
Sbjct: 228 NWGIVDGLVYENWQELEFDWREILNKRQKAKAVFGLDFGYTNDPAAFFCGILDQEQKEIY 287

Query: 163 VVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPEC 222
           V      +        ++++  G              D    + +    +  G+      
Sbjct: 288 VFDEIYQKGMQNTAIYSSIEKLGFKKEII------VADSAEPKSI-DHLKSLGLY---RI 337

Query: 223 ATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
                G + V AGI  + D      +K+F
Sbjct: 338 KASKKGKDSVNAGIQFIQD------FKIF 360


>gi|329735579|gb|EGG71866.1| phage terminase, large subunit, PBSX family [Staphylococcus
           epidermidis VCU028]
          Length = 420

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 81/256 (31%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFEG-------LTRINATQG--LVTLTLTP 50
            Q  ++ +S          +W +E        E        L              +  P
Sbjct: 112 AQNPERLKSLKDSRFPFSIMWIEELAEFKTEDEVTTITNSMLRGELDDGLFYKFFFSYNP 171

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y ++   D   V   T  + P  ++Q  +    +   +E   R +    
Sbjct: 172 PKRKQSWVNKKYETSFQPDNTFVHHSTYLDNPFISKQFIQEAESTKERNELRYRWEYMGE 231

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I     ++ + +  I  G+DFG+   P A     +++   VIY +  
Sbjct: 232 AIGSGVVPFNNLQIETIPQEMIDGFDNIRNGLDFGYADDPLAFVRWHYDKKKRVIYAIDE 291

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           Y   + +   +   +          +  D +  D    + ++   +  GMK +       
Sbjct: 292 YYGVQISNRQYANEMWKRK------YQSDDIYADHAEPKSIAELKQEHGMKKVRP---VK 342

Query: 227 DGSNGVEAGISDMLDR 242
            G +  E G   + D 
Sbjct: 343 KGPDSREYGEQWLSDL 358


>gi|187251258|ref|YP_001875740.1| phage terminase large subunit [Elusimicrobium minutum Pei191]
 gi|186971418|gb|ACC98403.1| Phage terminase, large subunit [Elusimicrobium minutum Pei191]
          Length = 397

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 90/239 (37%), Gaps = 19/239 (7%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINAT-----QGLVTLTLTPLKG 53
             + +   +K +S   +Y+W +E      + Y   LTR++A      +  + LTL P   
Sbjct: 105 FFSLD-NPEKIKSAEFNYIWMEEATEFTYEDYVTLLTRLSAPIKEPYKNQIFLTLNPSDS 163

Query: 54  RSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGR 113
            S I +  LSA   + Q+I+ +  + P  ++     ++    + E   R       G+ +
Sbjct: 164 NSWIAKKLLSAQ--NTQIIKSSYKDNPFLSKDYINTLLGLKDIDENYYRVFALGQWGANK 221

Query: 114 IFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
                         +I      I G+DFG+++P A   L  + +   +Y  +       T
Sbjct: 222 NIVYDNYTF---VDEIKNTDNVIWGLDFGFNNPSALVKLYISDEG--VYTEEKLYKSGLT 276

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
                A +K+  + +P +  H+ +  D     +++      G  + P       G   V
Sbjct: 277 NS---ALIKNLAEIIPPSQRHESIYADAAEPARIAEI-SEAGFNIHPALKDVKAGILSV 331


>gi|299531659|ref|ZP_07045064.1| putative phage associated protein [Comamonas testosteroni S44]
 gi|298720375|gb|EFI61327.1| putative phage associated protein [Comamonas testosteroni S44]
          Length = 436

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/246 (15%), Positives = 85/246 (34%), Gaps = 15/246 (6%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++      VW +E        +   +  I      + LTL P        + +++ 
Sbjct: 122 SIKSFEG--CDIVWVEEAHGVSKKSWDTLIPTIRKEGSEIWLTLNPDMETDETYQRFIAT 179

Query: 65  SSSDRQVIRMTINETPHYN---EQERKRIIDSYPLHEREARTKGE-PILGSGRIFPIVEE 120
            S D  V+ +   + P +    ++ER++   +    +     +G+   + +G I+    E
Sbjct: 180 PSPDTWVVEINWRDNPWFPRVLDEERRKAKRTMLADDYAHIWEGKARRVAAGAIYRHEME 239

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPF--AAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
            + +++      +     +   W   +  A    +  R    + ++ +     +T  ++V
Sbjct: 240 SVYLDNRARDVPYDPTLPVHTVWDLGWNDAMSIALVQRGPQDVRIIGHIEDSHRTLDWYV 299

Query: 179 AALKSWGKWLPWAW-PHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
           A L+         + PHDG   + ++G+      R  G             +  VE GI 
Sbjct: 300 AKLEKLPYRWGTDYLPHDGKTKNFQTGKSTEQLLRELG----RRSVMVQPRATDVEEGIK 355

Query: 238 DMLDRM 243
            +   M
Sbjct: 356 QVRMLM 361


>gi|229074033|ref|ZP_04207093.1| Phage terminase large subunit [Bacillus cereus F65185]
 gi|228709108|gb|EEL61222.1| Phage terminase large subunit [Bacillus cereus F65185]
          Length = 399

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/250 (14%), Positives = 78/250 (31%), Gaps = 16/250 (6%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T      DE    P+    + + R +     + +   P      +    +
Sbjct: 100 ENSQDTLQGLTAAGSLADEAALFPKSFIDQMIGRCSVDGAKIFMNCNPGSPYHFVKTELI 159

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                      + T+++    +E+ + R    +     +    G  ++  G I+ +  E 
Sbjct: 160 DKKKEKLVCHLKFTMDDNLSLSEKVKDRFKRMFSGVFYQRYILGLWVMAEGLIYSMFNEA 219

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
             +      ++       D+G  +P A    +W     + Y VK Y         H  A 
Sbjct: 220 EHVVPSHPRKYEQYYISCDYGTQNPMA--FGLWGLSGGIWYKVKEY---------HHDAR 268

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATF--DDGSNGVEAGISDM 239
           K   +     +  D ++      +++          +L +   +      N V  GI ++
Sbjct: 269 KRNLQKSDEQYYEDLVEFANGLTKRIIVDPSASSFIILLKQKGWKVKKAKNDVLDGIRNV 328

Query: 240 LDRMRSGRWK 249
              + +   K
Sbjct: 329 ATALTTELIK 338


>gi|307270316|ref|ZP_07551624.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX4248]
 gi|306513370|gb|EFM81994.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX4248]
          Length = 427

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 84/254 (33%), Gaps = 24/254 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQG---LVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      + Y +   R+   +     + L   P+   
Sbjct: 117 FKGMD-DPEKIKSIKGLSDVVMEEATEFTLEDYTQLTLRLRERKHVKRQIFLMFNPVSKL 175

Query: 55  SPIIEHYLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK--GEPI 108
           + + + +    +        +   T  +    + + +K I D    +    R    GE  
Sbjct: 176 NWVYKSFFDEEAEVDQRRTGIYHSTYKDNRFLDSENKKVIEDLAKRNPAYYRIYALGEFA 235

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNY 167
                +FP  +   +    ++        G+DFG+ + P A  H   +  +  IYV++ Y
Sbjct: 236 TLDKLVFPNYQRKRLDKHDELLRQIDSYFGLDFGYVNDPSAFVHAKVDEKNKRIYVLEEY 295

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             +          +K  G      +  + +  D    + ++   +      +        
Sbjct: 296 VKKGLLNDEISTVIKDLG------YAKEVITADSAEKKSIAEIKK----NGITRIRAAKK 345

Query: 228 GSNGVEAGISDMLD 241
           G + +  G+S +L 
Sbjct: 346 GPDSIRQGLSFLLQ 359


>gi|206971568|ref|ZP_03232518.1| phage terminase, large subunit, pbsx family [Bacillus cereus
           AH1134]
 gi|206733553|gb|EDZ50725.1| phage terminase, large subunit, pbsx family [Bacillus cereus
           AH1134]
          Length = 423

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/257 (15%), Positives = 79/257 (30%), Gaps = 30/257 (11%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T      DE    P+    + + R +     + +   P      +    +
Sbjct: 124 ENSQDTLQGLTAAGSLADEAALFPKTFIDQMIGRCSVDGAKIFMNCNPGSPYHFVKTELI 183

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                      + T+++     E+ + R    +     +    G  ++  G I+ +  ED
Sbjct: 184 DKKKEKLVCHLKFTMDDNLSLPEKVKDRFKRMFSGVFYQRYILGLWVMAEGLIYSMFNED 243

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
             + S    ++       D+G  +P A    +W     + Y VK Y         H  A 
Sbjct: 244 EHVVSSHPRKYEQYYISCDYGTQNPMA--FGLWGLCGCIWYKVKEY---------HHDAR 292

Query: 182 KSWGKWLPWAWPHDGLQHDKR---------SGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
           K   +     +  D ++             S        +++G K+           N V
Sbjct: 293 KKNLQKSDEQYYDDLVEFANGLTKCIIVDPSASSFIILLKQKGWKV-------KKAKNDV 345

Query: 233 EAGISDMLDRMRSGRWK 249
             GI ++   + +   K
Sbjct: 346 LDGIRNVATALTTELIK 362


>gi|291334534|gb|ADD94186.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C1220]
 gi|291335526|gb|ADD95137.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C491]
 gi|291335665|gb|ADD95272.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C846]
          Length = 354

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/257 (13%), Positives = 72/257 (28%), Gaps = 19/257 (7%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
                +  ++  V  DE      +V+FE +   +   +G      TP    S   + +  
Sbjct: 44  NAMALRGRSLSGVVLDEAAFMDAEVWFEVIRPALADKEGWALFISTPDGTASWFYDLWCY 103

Query: 64  ASSS---DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
                  + Q    T  +  + ++ E +               +      +G +     +
Sbjct: 104 VPDDETNEWQRWSYTTIDGGNVSKHEVEAARAQLDTRTFRQEFEASFENLTGLVAISFSD 163

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE--QTPIFHV 178
           + +            + G+DF          +   ++ + +YV           T  F  
Sbjct: 164 ENISQEAKDISIQPLLLGVDFNVDPMSGICAV---KNGETLYVFDEVMLTGGATTWDFAE 220

Query: 179 AALKSWGKWLPWAWPHD---GLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN--GVE 233
              + +G         D   G +     G    A  RR G  +    + +        V 
Sbjct: 221 EVTRRYGVDRRIIACPDPTGGARKTSGVGVTDHAILRRSGFTVQSPRSPWKIRDKITAVN 280

Query: 234 AGISDMLDRMRSGRWKV 250
            G+ D      + R K+
Sbjct: 281 TGLMDAS---GARRVKI 294


>gi|291337121|gb|ADD96636.1| hypothetical protein Syncc9605_0456 [uncultured organism
           MedDCM-OCT-S12-C92]
          Length = 354

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/257 (13%), Positives = 72/257 (28%), Gaps = 19/257 (7%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
                +  ++  V  DE      +V+FE +   +   +G      TP    S   + +  
Sbjct: 44  NAMALRGRSLSGVVLDEAAFMDAEVWFEVIRPALADKEGWALFISTPDGTASWFYDLWCY 103

Query: 64  ASSS---DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
                  + Q    T  +  + ++ E +               +      +G +     +
Sbjct: 104 VPDDETNEWQRWSYTTIDGGNVSKHEVEAARAQLDTRTFRQEFEASFENLTGLVAISFSD 163

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE--QTPIFHV 178
           D +            + G+DF          +   ++ + +YV           T  F  
Sbjct: 164 DNISTEAKDISIQPLLLGVDFNVDPMSGICAV---KNGETLYVFDEVMLTGGATTWDFAE 220

Query: 179 AALKSWGKWLPWAWPHD---GLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN--GVE 233
              + +G         D   G +     G    A  RR G  +    + +        V 
Sbjct: 221 EVTRRYGVDRRIIACPDPTGGARKTSGVGVTDHAILRRSGFTVQSPRSPWKIRDKITAVN 280

Query: 234 AGISDMLDRMRSGRWKV 250
            G+ D      + R K+
Sbjct: 281 TGLMDAS---GARRVKI 294


>gi|300362021|ref|ZP_07058198.1| PBSX family phage terminase [Lactobacillus gasseri JV-V03]
 gi|300354640|gb|EFJ70511.1| PBSX family phage terminase [Lactobacillus gasseri JV-V03]
          Length = 409

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/251 (15%), Positives = 89/251 (35%), Gaps = 18/251 (7%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           +G    +  T +  + +E      +V+ E + R +     +     P      +   Y+ 
Sbjct: 115 RGIGAIRGMTSYGAYINEASLATHEVFQEIVQRCSVRSARIICDTNPDIPTHWLKTDYID 174

Query: 64  ASSSDRQV--IRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVEE 120
                 ++     TI +    ++   + +  + P      R   G+ + G G ++    +
Sbjct: 175 NHDPKARIKAFSFTIGDNTFLSKDYVEALKAATPRGMFYDRSILGQWVTGDGIVYQDFNK 234

Query: 121 DIVINSLDIPEHW-VQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
           D +I   +          G+D+G+ HP     L  ++D +  YV+++Y  + +   + V 
Sbjct: 235 DTMIIPRNRVPDGLDYYVGVDWGYEHPNPIILLGDDKDGNT-YVLEDYTQKHKFINYWVE 293

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
             K+                D    + ++  ++  G+  +            V  GI  +
Sbjct: 294 IAKNLQTRFGRNL---IFYADSARPDNVNE-FQSNGLNCINANKN-------VLPGIECV 342

Query: 240 LDRMRSGRWKV 250
             +MR G++ V
Sbjct: 343 ARKMREGKFYV 353


>gi|251810445|ref|ZP_04824918.1| large terminase subunit [Staphylococcus epidermidis BCM-HMP0060]
 gi|251806049|gb|EES58706.1| large terminase subunit [Staphylococcus epidermidis BCM-HMP0060]
          Length = 420

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 82/256 (32%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFEG-------LTRINATQG--LVTLTLTP 50
            Q  ++ +S          +W +E        E        L              +  P
Sbjct: 112 AQNPERLKSLKDSRFPFSIMWIEELAEFKTEDEVTTITNSMLRGELDDGLFYKFFFSYNP 171

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y ++   D   V   T  + P  ++Q  +    +   +E+  R +    
Sbjct: 172 PKRKQSWVNKKYETSFQPDNTFVHHSTYLDNPFISKQFIQEAESAKERNEQRYRWEYMGE 231

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I     ++ + +  I  G+DFG+   P A     +++   VIY +  
Sbjct: 232 AIGSGVVPFNNLQIETIPQEMIDGFDNIRNGLDFGYADDPLAFVRWHYDKKKRVIYAIDE 291

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           Y   + +   +   +          +  D +  D    + ++   +  GMK +       
Sbjct: 292 YYGVQISNRQYANEMWKRK------YQSDDIYADHAEPKSIAELKQEHGMKKVRP---VK 342

Query: 227 DGSNGVEAGISDMLDR 242
            G +  E G   + D 
Sbjct: 343 KGPDSREYGEQWLSDL 358


>gi|256956438|ref|ZP_05560609.1| Lj928 prophage protein [Enterococcus faecalis DS5]
 gi|256946934|gb|EEU63566.1| Lj928 prophage protein [Enterococcus faecalis DS5]
 gi|315034567|gb|EFT46499.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0027]
 gi|315161409|gb|EFU05426.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0645]
          Length = 427

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 84/254 (33%), Gaps = 24/254 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQG---LVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      + Y +   R+   +     + L   P+   
Sbjct: 117 FKGMD-DPEKIKSIKGLSDVVMEEATEFTLEDYTQLTLRLRERKHVKRQIFLMFNPVSKL 175

Query: 55  SPIIEHYLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK--GEPI 108
           + + + +    +        +   T  +    + + +K I D    +    R    GE  
Sbjct: 176 NWVYKSFFDEEAEVDQRRTGIYHSTYKDNRFLDSENKKVIEDLAKRNPAYYRIYALGEFA 235

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNY 167
                +FP  +   +    ++        G+DFG+ + P A  H   +  +  IYV++ Y
Sbjct: 236 TLDKLVFPNYQRKRLDKHDELLRQIDSDFGLDFGYVNDPSAFVHAKVDEKNKRIYVLEEY 295

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             +          +K  G      +  + +  D    + ++   +      +        
Sbjct: 296 VKKGLLNDEISTVIKDLG------YAKEVITADSAEKKSIAEIKK----NGITRIRAAKK 345

Query: 228 GSNGVEAGISDMLD 241
           G + +  G+S +L 
Sbjct: 346 GPDSIRQGLSFLLQ 359


>gi|256962625|ref|ZP_05566796.1| Lj928 prophage protein [Enterococcus faecalis HIP11704]
 gi|257087218|ref|ZP_05581579.1| Lj928 prophage protein [Enterococcus faecalis D6]
 gi|256953121|gb|EEU69753.1| Lj928 prophage protein [Enterococcus faecalis HIP11704]
 gi|256995248|gb|EEU82550.1| Lj928 prophage protein [Enterococcus faecalis D6]
 gi|315026019|gb|EFT37951.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX2137]
          Length = 427

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 84/254 (33%), Gaps = 24/254 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQG---LVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      + Y +   R+   +     + L   P+   
Sbjct: 117 FKGMD-DPEKIKSIKGLSDVVMEEATEFTLEDYTQLTLRLRERKHVKRQIFLMFNPVSKL 175

Query: 55  SPIIEHYLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK--GEPI 108
           + + + +    +        +   T  +    + + +K I D    +    R    GE  
Sbjct: 176 NWVYKSFFDEEAEVDQRRTGIYHSTYKDNRFLDSENKKVIEDLAKRNPAYYRIYALGEFA 235

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNY 167
                +FP  +   +    ++        G+DFG+ + P A  H   +  +  IYV++ Y
Sbjct: 236 TLDKLVFPNYQRKRLDKHDELLRQIDSDFGLDFGYVNDPSAFVHAKVDEKNKRIYVLEEY 295

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             +          +K  G      +  + +  D    + ++   +      +        
Sbjct: 296 VKKGLLNDEISTVIKDLG------YAKEVITADSAEKKSIAEIKK----NGITRIRAAKK 345

Query: 228 GSNGVEAGISDMLD 241
           G + +  G+S +L 
Sbjct: 346 GPDSIRQGLSFLLQ 359


>gi|256853532|ref|ZP_05558898.1| Lj928 prophage protein [Enterococcus faecalis T8]
 gi|256711138|gb|EEU26180.1| Lj928 prophage protein [Enterococcus faecalis T8]
          Length = 430

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 84/254 (33%), Gaps = 24/254 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQG---LVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      + Y +   R+   +     + L   P+   
Sbjct: 120 FKGMD-DPEKIKSIKGLSDVVMEEATEFTLEDYTQLTLRLRERKHVKRQIFLMFNPVSKL 178

Query: 55  SPIIEHYLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK--GEPI 108
           + + + +    +        +   T  +    + + +K I D    +    R    GE  
Sbjct: 179 NWVYKSFFDEEAEVDQRRTGIYHSTYKDNRFLDSENKKVIEDLAKRNPAYYRIYALGEFA 238

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNY 167
                +FP  +   +    ++        G+DFG+ + P A  H   +  +  IYV++ Y
Sbjct: 239 TLDKLVFPNYQRKRLDKHDELLRQIDSDFGLDFGYVNDPSAFVHAKVDEKNKRIYVLEEY 298

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             +          +K  G      +  + +  D    + ++   +      +        
Sbjct: 299 VKKGLLNDEISTVIKDLG------YAKEVITADSAEKKSIAEIKK----NGITRIRAAKK 348

Query: 228 GSNGVEAGISDMLD 241
           G + +  G+S +L 
Sbjct: 349 GPDSIRQGLSFLLQ 362


>gi|315143442|gb|EFT87458.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX2141]
 gi|315157239|gb|EFU01256.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0043]
          Length = 427

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 84/254 (33%), Gaps = 24/254 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQG---LVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      + Y +   R+   +     + L   P+   
Sbjct: 117 FKGMD-DPEKIKSIKGLSDVVMEEATEFTLEDYTQLTLRLRERKHVKRQIFLMFNPVSKL 175

Query: 55  SPIIEHYLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK--GEPI 108
           + + + +    +        +   T  +    + + +K I D    +    R    GE  
Sbjct: 176 NWVYKSFFDEEAEVDQRRTGIYHSTYKDNRFLDSENKKVIEDLAKRNPAYYRIYALGEFA 235

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNY 167
                +FP  +   +    ++        G+DFG+ + P A  H   +  +  IYV++ Y
Sbjct: 236 TLDKLVFPNYQRKRLDKHDELLRQIDSDFGLDFGYVNDPSAFVHAKVDEKNKRIYVLEEY 295

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             +          +K  G      +  + +  D    + ++   +      +        
Sbjct: 296 VKKGLLNDEISTVIKDLG------YAKEVITADSAEKKSIAEIKK----NGITRIRAAKK 345

Query: 228 GSNGVEAGISDMLD 241
           G + +  G+S +L 
Sbjct: 346 GPDSIRQGLSFLLQ 359


>gi|257422201|ref|ZP_05599191.1| prophage protein [Enterococcus faecalis X98]
 gi|257164025|gb|EEU93985.1| prophage protein [Enterococcus faecalis X98]
          Length = 427

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 84/254 (33%), Gaps = 24/254 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQG---LVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      + Y +   R+   +     + L   P+   
Sbjct: 117 FKGMD-DPEKIKSIKGLSDVVMEEATEFTLEDYTQLTLRLRERKHVKRQIFLMFNPVSKL 175

Query: 55  SPIIEHYLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK--GEPI 108
           + + + +    +        +   T  +    + + +K I D    +    R    GE  
Sbjct: 176 NWVYKSFFDEEAEVDQRRTGIYHSTYKDNRFLDSENKKVIEDLAKRNPAYYRIYALGEFA 235

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNY 167
                +FP  +   +    ++        G+DFG+ + P A  H   +  +  IYV++ Y
Sbjct: 236 TLDKLVFPNYQRKRLDKHDELLRQIDSDFGLDFGYVNDPSAFVHAKVDEKNKRIYVLEEY 295

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             +          +K  G      +  + +  D    + ++   +      +        
Sbjct: 296 VKKGLLNDEISTVIKDLG------YAKEVITADSAEKKSIAEVKK----NGITRIRAAKK 345

Query: 228 GSNGVEAGISDMLD 241
           G + +  G+S +L 
Sbjct: 346 GPDSIRQGLSFLLQ 359


>gi|260887046|ref|ZP_05898309.1| phage terminase, large subunit, PBSX family [Selenomonas sputigena
           ATCC 35185]
 gi|330839176|ref|YP_004413756.1| phage terminase, large subunit, PBSX family [Selenomonas sputigena
           ATCC 35185]
 gi|260863108|gb|EEX77608.1| phage terminase, large subunit, PBSX family [Selenomonas sputigena
           ATCC 35185]
 gi|329746940|gb|AEC00297.1| phage terminase, large subunit, PBSX family [Selenomonas sputigena
           ATCC 35185]
          Length = 416

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/263 (15%), Positives = 92/263 (34%), Gaps = 33/263 (12%)

Query: 5   EQGRDKW-QSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY 61
           ++G +K+ +  T+   + DE    PE  + + L R++     +  T  P      + + Y
Sbjct: 113 DEGSEKFIRGKTLAGAYCDELTLMPERFFKQLLNRLSVPGAKLYSTTNPDSPMHYLYKEY 172

Query: 62  LSASSSDR----QVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPI 117
           +++    R     V+   +++ P+  +  +  I  SY     +    G  +L  G I+ +
Sbjct: 173 VTSDEKLRDGLVSVVHFELDDNPNLTDDYKTNIRSSYSGMWFKRMILGLWVLAEGVIYDM 232

Query: 118 VEEDIVINSLDI----PEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR----- 168
             +D++ +  +          +    D+G  +P     +  +   D I++   Y      
Sbjct: 233 FSDDLLFDDAEFTNTLKSTCRRHIACDYGTKNPMVFLDIYDD--GDTIWIPAMYYWDSRK 290

Query: 169 -CREQTPIFHVAALKSW-GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
             R++T   +   L+   G+  P     D                    ++         
Sbjct: 291 EQRQKTDAQYADDLERMLGEEYPDFIVIDP-------------SAASFKLECQGRGFRVK 337

Query: 227 DGSNGVEAGISDMLDRMRSGRWK 249
           D  N V  GI ++   +   + +
Sbjct: 338 DADNSVNDGIREVAKLLTKKKIR 360


>gi|312951247|ref|ZP_07770149.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0102]
 gi|310630781|gb|EFQ14064.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0102]
          Length = 427

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 84/254 (33%), Gaps = 24/254 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQG---LVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      + Y +   R+   +     + L   P+   
Sbjct: 117 FKGMD-DPEKIKSIKGLSDVVMEEATEFTLEDYTQLTLRLRERKHVKRQIFLMFNPVSKL 175

Query: 55  SPIIEHYLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK--GEPI 108
           + + + +    +        +   T  +    + + +K I D    +    R    GE  
Sbjct: 176 NWVYKSFFDEEAEVDQRRTGIYHSTYKDNRFLDSENKKVIEDLAKRNPAYYRIYALGEFA 235

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNY 167
                +FP  +   +    ++        G+DFG+ + P A  H   +  +  IYV++ Y
Sbjct: 236 TLDKLVFPNYQRKRLDKHDELLRQIDSDFGLDFGYVNDPSAFVHAKVDEKNKRIYVLEEY 295

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             +          +K  G      +  + +  D    + ++   +      +        
Sbjct: 296 VKKGLLNDEISTVIKDLG------YAKEVITADSAEKKSIAEVKK----NGITRIRAAKK 345

Query: 228 GSNGVEAGISDMLD 241
           G + +  G+S +L 
Sbjct: 346 GPDSIRQGLSFLLQ 359


>gi|315033367|gb|EFT45299.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0017]
          Length = 424

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/254 (14%), Positives = 84/254 (33%), Gaps = 24/254 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQG---LVTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      + Y +   R+   +     + L   P+   
Sbjct: 117 FKGMD-DPEKIKSIKGLSDVVMEEATEFTLEDYTQLTLRLRERKHVKRQIFLMFNPVSKL 175

Query: 55  SPIIEHYLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK--GEPI 108
           + + + +    +        +   T  +    + + +K I D    +    R    GE  
Sbjct: 176 NWVYKSFFDEEAEVDQRRTGIYHSTYKDNRFLDSENKKVIEDLAKRNPAYYRIYALGEFA 235

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNY 167
                +FP  +   +    ++        G+DFG+ + P A  H   +  +  IYV++ Y
Sbjct: 236 TLDKLVFPNYQRKRLDKHDELLRQIDSDFGLDFGYVNDPSAFVHAKVDEKNKRIYVLEEY 295

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             +          +K  G      +  + +  D    + ++   +      +        
Sbjct: 296 VKKGLLNDEISTVIKDLG------YAKEVITADSAEKKSIAEVKK----NGITRIRAAKK 345

Query: 228 GSNGVEAGISDMLD 241
           G + +  G+S +L 
Sbjct: 346 GPDSIRQGLSFLLQ 359


>gi|260664700|ref|ZP_05865552.1| PBSX family phage terminase, large subunit [Lactobacillus jensenii
           SJ-7A-US]
 gi|260561765|gb|EEX27737.1| PBSX family phage terminase, large subunit [Lactobacillus jensenii
           SJ-7A-US]
          Length = 408

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 32/250 (12%), Positives = 82/250 (32%), Gaps = 18/250 (7%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           +G    +  T +  + +E       V+ E + R +     +     P      +   Y+ 
Sbjct: 115 RGLGAIRGMTSYGAYVNEASLATYAVFQEIIQRCSQPNARIICDTNPDTPTHWLKAKYID 174

Query: 64  ASSSD--RQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEE 120
               +   +V   TI++    +    K +  S P     +   KG  + G G ++P  ++
Sbjct: 175 NKKPEAKIKVYNFTIDDNTFLDPDYVKTLKASTPSGMFYDRNIKGLWVTGDGVVYPDFDK 234

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
             ++    +P+      G+D+G+ H  +      +   +  Y+++ +  + +   + V  
Sbjct: 235 KRMVVD-KVPDGLTCYCGVDWGFEHKGSLLVFGDDEQGNT-YLIEEHTHQHRFISYWVDL 292

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                              D    + L+               +  +    +  G+  + 
Sbjct: 293 AHKIQDKYGHNIN---FWCDSARPDNLNE--------FQTANISAFNAKKAILPGVESVA 341

Query: 241 DRMRSGRWKV 250
             M++G + V
Sbjct: 342 KLMKTGHFFV 351


>gi|229176385|ref|ZP_04303827.1| Phage terminase large subunit [Bacillus cereus MM3]
 gi|228607075|gb|EEK64455.1| Phage terminase large subunit [Bacillus cereus MM3]
          Length = 413

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/247 (16%), Positives = 77/247 (31%), Gaps = 11/247 (4%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+   +FDE          +   R +     V     P          +L
Sbjct: 107 EASQDLIQGITLAGCFFDEVVLMVRSFVNQATGRCSVEGSKVWFNCNPGGPYHWFKTEWL 166

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +     + IR T+++    +E+ ++R    Y     +    G     SG IF + +ED
Sbjct: 167 DKAKEKNLLHIRFTMDDNLSLSEKVKQRYYKMYSGVFFKRYILGLWAAASGLIFDMFDED 226

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV--WNRDSDVIYVVKNYRCREQTPIFHVA 179
                    E+       D+G  +    G       +  +V Y VK YR   +       
Sbjct: 227 KHKVPTIEREYVEYFVSCDYGTQNAMVYGLWGKCIEKGKEVWYKVKEYRYSGRETEKQKT 286

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
             + +  +  +    D            ++        ++          N V+ GI ++
Sbjct: 287 DQEYYEDFEKFV--GDLPIRGTVVDPSAASFIAL----LVRNKRKVYKARNNVKEGIGNV 340

Query: 240 LDRMRSG 246
              + +G
Sbjct: 341 GVALNTG 347


>gi|251778259|ref|ZP_04821179.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
 gi|243082574|gb|EES48464.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
          Length = 416

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 29/258 (11%), Positives = 79/258 (30%), Gaps = 28/258 (10%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPEDVYFE----GLTRINATQGLVTLTLTPLKGRS 55
            K  +   ++ +S   +  +  +E    D +         R       V +   P+   +
Sbjct: 106 FKGLD-DPERIKSINGIDDIIVEECTEIDDFTFDQLCLRLRSKKPYNQVHVMFNPVSKSN 164

Query: 56  PIIEHYLSASS-------SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK--GE 106
            +   + +  +       ++  V++ T  +     +     +++    +    R    GE
Sbjct: 165 WVFSRWFNPMNSNPRTDLNNTMVLKTTYRDNKFLPQDYIDNLLEMKATNRVYYRIYALGE 224

Query: 107 PILGSGRIFPIVEEDIVINSLDIPEHWVQIGG--MDFGWH-HPFAAGHLVWNRDSDVIYV 163
               S  ++   E         + E++ +     +DFG+   P A G  + +  + +I++
Sbjct: 225 FATLSKLVYTNWEVKEFDYKQILKENYNRQAVFNLDFGYTNDPTAFGAEILDEPNKIIWI 284

Query: 164 VKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
              ++ +          +   G              D    + +    +R G+       
Sbjct: 285 FDEFQEKGLLNDEIAEKITDLGYRKEVIVC------DSAEPKSIDE-LKRNGIN---RAV 334

Query: 224 TFDDGSNGVEAGISDMLD 241
               G + +  GI  +  
Sbjct: 335 PSIKGRDSIINGIQLLQQ 352


>gi|56964603|ref|YP_176334.1| terminase large subunit G2p [Bacillus clausii KSM-K16]
 gi|56910846|dbj|BAD65373.1| terminase large subunit G2p [Bacillus clausii KSM-K16]
          Length = 426

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/242 (14%), Positives = 74/242 (30%), Gaps = 24/242 (9%)

Query: 16  VHYVWFDEEPPEDVYFE------GLTRINATQG---LVTLTLTPL-KGRSPIIEHYLSAS 65
             + W +E        E       L R     G       +  P  + +S + + Y ++ 
Sbjct: 128 FAFAWIEELAEFKTEDEVTTITNSLLRGELDNGLFYKFFYSYNPPKRKQSWVNKKYETSF 187

Query: 66  SS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
              +  V   T  + P  ++Q  +    +   +E+  R +         I P     +  
Sbjct: 188 QPTNTFVHHSTYLDNPFISKQFIEEAEATKERNEKRYRWEYLGEAIGSGIVPFDNLTVKP 247

Query: 125 ---NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
                  + +      G D+G+   P+A     +++  + IY +     ++ +       
Sbjct: 248 GIITDEMVAQFDNIRQGQDYGYGPDPYAFVRWHYDKKKNGIYAIDELYGQKISNREASKW 307

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +K  G              D    + +  Q  + G++          G + VE G   + 
Sbjct: 308 IKKKGYDRQEI------ITDSSEPKSIDEQKSQHGIR---RIRGAKKGPDSVEYGEEWLD 358

Query: 241 DR 242
           D 
Sbjct: 359 DL 360


>gi|196037176|ref|ZP_03104491.1| phage terminase, large subunit, pbsx family [Bacillus cereus W]
 gi|195990280|gb|EDX54333.1| phage terminase, large subunit, pbsx family [Bacillus cereus W]
          Length = 436

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/247 (15%), Positives = 77/247 (31%), Gaps = 11/247 (4%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T   ++FDE     +    +   R++ T   +     P        E +L
Sbjct: 130 ESSQDLIQGITAAGMFFDEVALMVQSFVNQATGRLSVTGSKMWFNCNPAGPYHWFKEKWL 189

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                   +  + ++++    +E+ ++R    Y         KGE    SG IF + +E+
Sbjct: 190 DQKKEKNLLHLKFSMDDNLSLDEKTKRRYHRMYSGVFYRRYIKGEWAAASGLIFDMFDEN 249

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV--WNRDSDVIYVVKNYRCREQTPIFHVA 179
                    E+       D+G  +    G       +  +V Y VK YR   +       
Sbjct: 250 KHKVPTIQREYVEYFVSCDYGTQNAMVYGLWGKCIEKGEEVWYKVKEYRYSGRETEKQKT 309

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
                       +  D            ++        ++          N V+ GI ++
Sbjct: 310 --DQEYYEDFEGFVGDLPIRGTVVDPSAASFIAL----LVRNKRKVYKARNNVKEGIGNV 363

Query: 240 LDRMRSG 246
              + +G
Sbjct: 364 GVALNTG 370


>gi|228937110|ref|ZP_04099813.1| Phage terminase large subunit [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228822570|gb|EEM68496.1| Phage terminase large subunit [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 375

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 40/247 (16%), Positives = 77/247 (31%), Gaps = 11/247 (4%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+   +FDE          +   R +     V     P          +L
Sbjct: 69  EASQDLIQGITLAGCFFDEVVLMVRSFVNQATGRCSVEGSKVWFNCNPGGPYHWFKTEWL 128

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +     + IR T+++    +E+ ++R    Y     +    G     SG IF + +ED
Sbjct: 129 DKAKEKNLLHIRFTMDDNLSLSEKVKQRYYKMYSGVFFKRYILGLWAAASGLIFDMFDED 188

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV--WNRDSDVIYVVKNYRCREQTPIFHVA 179
                    E+       D+G  +    G       +  +V Y VK YR   +       
Sbjct: 189 KHKVPTIPREYVEYFVSCDYGTQNAMVYGLWGKRIEKGKEVWYKVKEYRYSGRETEKQKT 248

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
             + +  +  +    D            ++        ++          N V+ GI ++
Sbjct: 249 DQEYYEDFEKFV--GDLPIRGTVVDPSAASFIAL----LVRNKRKVYKARNNVKEGIGNV 302

Query: 240 LDRMRSG 246
              + +G
Sbjct: 303 GVALNTG 309


>gi|329919929|ref|ZP_08276833.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           SPIN 1401G]
 gi|328936867|gb|EGG33301.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           SPIN 1401G]
          Length = 409

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/258 (14%), Positives = 92/258 (35%), Gaps = 21/258 (8%)

Query: 2   KAY---EQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSP 56
           KAY   E+GRD  +  T    + +E       V+ E   R +A +  +     P      
Sbjct: 108 KAYTGSERGRDSIRGMTAWGAYINEASLAKASVFSEIQKRCSAPEARIICDTNPDAPTHW 167

Query: 57  IIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGR 113
           + ++Y+  +      +    T ++ P  ++  ++++  S P     +    G    G G 
Sbjct: 168 LKKNYIDNTDPKAGIKTFFFTFDDNPTLDDDYKEKLKASTPSGVFYDRDILGLWCTGEGV 227

Query: 114 IFPIVEE-DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ 172
           ++   ++  + I+   +P       G+D+G+ H         +   +  Y+++ +  + +
Sbjct: 228 VYRDFDQSTMTIDRYKLPTDLTYYVGVDWGYEHTGTLIVFADDSQGNT-YLIEEHAHKHR 286

Query: 173 TPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
              + V       +      P      D    + L+      G++           +  +
Sbjct: 287 FIDYWVDLAHDVQQKYGSTIP---FWCDSARPDNLNEFLI-HGIRAYN-------ANKAI 335

Query: 233 EAGISDMLDRMRSGRWKV 250
            +GI  +   M++  + V
Sbjct: 336 NSGIEAVGSLMKAKHFFV 353


>gi|327198351|ref|YP_004306925.1| terminase large subunit [Streptococcus phage Dp-1]
 gi|314912653|gb|ADT64044.1| terminase large subunit [Streptococcus phage Dp-1]
          Length = 463

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/267 (14%), Positives = 85/267 (31%), Gaps = 27/267 (10%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  ++ DE    PE    +   R + T   +  +  P        ++++
Sbjct: 132 ESSQDLIQGVTLAGIFCDEVALMPESFVNQATGRCSVTGSKMWFSCNPANPNHYFKKNWI 191

Query: 63  SASSSDRQ-VIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                 R   +  T+++ P   +  ++R    Y    R+    G  +   G ++ +  E+
Sbjct: 192 DKQVEKRILYLHFTMDDNPSLTDSIKRRYEKMYAGVFRKRFILGLWVTADGLVYSMFNEE 251

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
             +  L+I E        DFG ++    G   +++     +++++Y    +        L
Sbjct: 252 QHVKKLNI-EFDRLFVAGDFGIYNATTFGLYGFSKRHKRYHLIESYYHSGREAE---EQL 307

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYR--------------------RQGMKMLPE 221
                     +     +  K     L    R                    ++   +  +
Sbjct: 308 TEADVNSNIQFSSVLQKTTKEYANDLVDMIRGKQIEYIILDPSASAMIVELQKHPYIARK 367

Query: 222 CATFDDGSNGVEAGISDMLDRMRSGRW 248
                   N V  GIS   + +   R+
Sbjct: 368 NIPIIPARNDVTLGISFHAELLAENRF 394


>gi|291334627|gb|ADD94276.1| hypothetical protein Syncc9605_0456 [uncultured phage
           MedDCM-OCT-S04-C231]
          Length = 320

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 35/257 (13%), Positives = 72/257 (28%), Gaps = 19/257 (7%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
                +  ++  V  DE      +V+FE +   +   +G      TP    S   + +  
Sbjct: 44  NAMALRGRSLSGVVLDEAAFMDAEVWFEVIRPALADKEGWALFISTPDGTASWFYDLWCY 103

Query: 64  ASSS---DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
                  + Q    T  E  + ++ E +               +      +G +     +
Sbjct: 104 VPEDETGEWQRWSYTTIEGGNVSKHEVEAARAQLDNRTFRQEFEASFENLTGLVAISFSD 163

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE--QTPIFHV 178
           + +            + G+DF          +   ++ + +YV           T  F  
Sbjct: 164 ENISQEAKDISIQPLLLGVDFNVDPMSGICAV---KNGETLYVFDEIMLTGGATTWDFAE 220

Query: 179 AALKSWGKWLPWAWPHD---GLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN--GVE 233
              + +G         D   G +     G    A  RR G  +    + +        V 
Sbjct: 221 EVTRRYGVDRRVIACPDPTGGARKTSGVGVTDHAILRRSGFTVQSPRSPWKIRDKITAVN 280

Query: 234 AGISDMLDRMRSGRWKV 250
            G+ D      + R K+
Sbjct: 281 TGLMDAS---GARRVKI 294


>gi|325956963|ref|YP_004292375.1| prophage protein [Lactobacillus acidophilus 30SC]
 gi|325333528|gb|ADZ07436.1| prophage protein [Lactobacillus acidophilus 30SC]
          Length = 422

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/254 (13%), Positives = 79/254 (31%), Gaps = 24/254 (9%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQGL---VTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      + Y +   R+   +     +     P+   
Sbjct: 113 FKGMD-DPEKIKSIKGLSDVVMEEASEFTANDYTQLTLRLREPKHKQRQIFCMFNPVSKL 171

Query: 55  SPIIEHYLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPI 108
           +   + +   ++        + + T  +    + +  K I D    +    +  T GE  
Sbjct: 172 NWTYQTWFDPNAEYDKKRVVIHQSTYKDNKFLDAENIKTIEDLKRTNPAYYKIYTLGEFA 231

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNY 167
                +FP  E   +              G+D+G+ + P A  H+  +  +  +YV+  +
Sbjct: 232 TLDKLVFPYFETRRLNPRDPKLLALNDYFGLDYGFVNDPSAFMHIKLDMKNKKLYVMDEF 291

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
             +          +K  G              D    + +  + RR G+           
Sbjct: 292 VKKGLLNNQLAQVIKDMGYRKEII------TADSAEKKSI-EEMRRAGIY---RIRPALK 341

Query: 228 GSNGVEAGISDMLD 241
           G + +  G+  +  
Sbjct: 342 GPDSIIQGLQFLQQ 355


>gi|90592610|ref|YP_529870.1| putative phage terminase large subunit B [Lactobacillus phage KC5a]
 gi|89891939|gb|ABD78812.1| putative phage terminase large subunit B [Lactobacillus phage KC5a]
          Length = 409

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 37/249 (14%), Positives = 85/249 (34%), Gaps = 24/249 (9%)

Query: 11  WQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            +  T +  + +E      DV+ E L R +     +     P      +   Y+      
Sbjct: 120 IRGMTSYGAYVNEASLATHDVFQEILQRCSIEGARIICDTNPDIPTHWLKTDYIDNHDPK 179

Query: 69  --RQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVEEDIVIN 125
              +    TI++    ++   + I  + P      R   G+ + G G ++    +D ++ 
Sbjct: 180 ARIKSFTFTIDDNTFLSKDYVESIKAATPRGMFYDRGILGQWVTGDGIVYQDFNKDTMVI 239

Query: 126 SLDIPEHW-VQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH---VAAL 181
             +          G+D+G+ HP     L  ++D +  YV+++Y  + +   +       L
Sbjct: 240 PKNRVPDGLDYYVGVDWGYEHPNPIILLGDDKDGNT-YVLEDYTQKHKFINYWVKVAQNL 298

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
           ++        +                 +++  G+  +            V  GI  +  
Sbjct: 299 QTRFGRNLIFYADSAR-------PDNVNEFQSNGLNCINANKN-------VLPGIECVAR 344

Query: 242 RMRSGRWKV 250
           +MR G++ V
Sbjct: 345 KMREGKFYV 353


>gi|261209747|ref|ZP_05924059.1| phage terminase large subunit [Enterococcus faecium TC 6]
 gi|289567070|ref|ZP_06447466.1| PBSX family phage terminase, large subunit [Enterococcus faecium
           D344SRF]
 gi|260076297|gb|EEW64112.1| phage terminase large subunit [Enterococcus faecium TC 6]
 gi|289161121|gb|EFD09025.1| PBSX family phage terminase, large subunit [Enterococcus faecium
           D344SRF]
          Length = 414

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 37/248 (14%), Positives = 88/248 (35%), Gaps = 16/248 (6%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
           G    +  T +  + +E     ++V+ E ++R + T   +     P      + + Y+  
Sbjct: 116 GVGAIRGMTAYGAYINEASLARQEVFAEIISRCSGTGARILADTNPDNPEHWLKKEYIDN 175

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVE-EDI 122
            S   Q     +++    +E+ R  I +S P     +   KG  +   G ++   +    
Sbjct: 176 PSKSIQSFHFELDDNTFLSERYRNNIKESTPSGMFYDRDIKGLWVSAEGVVYRDFDASKH 235

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
            I S D+P       G+D+G+ H  +   +    D    Y+++ +  + +   + V   K
Sbjct: 236 YIQSKDLPPLSNFYCGVDWGYEHWGSIVVIGET-DDGTAYLIEEHATQFEEIDYWVDIAK 294

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
              +      P      D    E ++        + + E     +      +G+ ++  R
Sbjct: 295 GIQERYGLRVP---FYCDSARPEHVA--------RFVREKVNAKNAHKARLSGVEEVAKR 343

Query: 243 MRSGRWKV 250
            +  +  +
Sbjct: 344 FKQDKLFI 351


>gi|229188177|ref|ZP_04315256.1| Phage terminase large subunit [Bacillus cereus BGSC 6E1]
 gi|228595287|gb|EEK53028.1| Phage terminase large subunit [Bacillus cereus BGSC 6E1]
          Length = 375

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 40/247 (16%), Positives = 77/247 (31%), Gaps = 11/247 (4%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+   +FDE          +   R +     V     P          +L
Sbjct: 69  EASQDLIQGITLAGCFFDEVVLMVRSFVNQATGRCSVEGSKVWFNCNPGGPYHWFKTEWL 128

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +     + IR T+++    +E+ ++R    Y     +    G     SG IF + +ED
Sbjct: 129 DKAREKNLLHIRFTMDDNLSLSEKVKQRYYKMYSGVFFKRYILGLWAAASGLIFDMFDED 188

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV--WNRDSDVIYVVKNYRCREQTPIFHVA 179
                    E+       D+G  +    G       +  +V Y VK YR   +       
Sbjct: 189 KHKVPTIEREYVEYFVSCDYGTQNAMVYGLWGKCIEKGEEVWYKVKEYRYSGRETEKQKT 248

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
             + +  +  +    D            ++        ++          N V+ GI ++
Sbjct: 249 DQEYYEDFEKFV--GDLPIRGTVVDPSAASFIAL----LVRNKRKVYKARNNVKEGIGNV 302

Query: 240 LDRMRSG 246
              + +G
Sbjct: 303 GVALNTG 309


>gi|66395816|ref|YP_240151.1| ORF009 [Staphylococcus phage EW]
 gi|62636238|gb|AAX91349.1| ORF009 [Staphylococcus phage EW]
          Length = 421

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 42/256 (16%), Positives = 77/256 (30%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFEG-------LTRINATQG--LVTLTLTP 50
            Q  ++ +S          +W +E        E        L              +  P
Sbjct: 113 AQNPERLKSLKDSRFPFSIMWIEELAEFKTEDEVTTITNSMLRGELDEGLFYKFFFSYNP 172

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y S+   D   V   T  + P   +Q       +   +E   R +    
Sbjct: 173 PKRKQSWVNKKYESSFQPDNTFVHHSTYLDNPFIAKQFIDEAEAAKERNELRYRWEYLGE 232

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I     ++   +  I   +DFG+   P A     +++   VIY V  
Sbjct: 233 AIGSGVVPFNNLQIEKIPDELFRSFDNIRNAVDFGYATDPLAFVRWHYDKKKRVIYAVDE 292

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           Y   + +       L S G      +  D +  D    + +    +  G+K         
Sbjct: 293 YYGVQISNRQFGKWLWSKG------YQSDDIYADSAEPKSIDELRKEHGIK---RIKGVK 343

Query: 227 DGSNGVEAGISDMLDR 242
            G + VE G   + D 
Sbjct: 344 KGPDSVEYGEQWLNDL 359


>gi|258440753|ref|ZP_05690695.1| phage terminase [Staphylococcus aureus A8115]
 gi|282894690|ref|ZP_06302917.1| phage terminase large subunit [Staphylococcus aureus A8117]
 gi|257852494|gb|EEV76414.1| phage terminase [Staphylococcus aureus A8115]
 gi|282762967|gb|EFC03100.1| phage terminase large subunit [Staphylococcus aureus A8117]
          Length = 431

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 41/259 (15%), Positives = 84/259 (32%), Gaps = 28/259 (10%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDEEPPEDVYF------EGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E    + +       E +     +      +T+
Sbjct: 107 FRGLD-DPLKITSITVDTGILCWAWFEEAYQIETFAKFSTVVESIRGSYDSPEFFKQITV 165

Query: 47  TLTPLKGRSPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +    +   +      T       ++ + +R  D Y  + R AR  
Sbjct: 166 TFNPWSERHWLKPTFFDEETKLNNTFSDTTTYRVNEWLDKVDIERYEDLYIKNPRRARIV 225

Query: 104 -KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVI 161
             G+  +  G +F   + +      +         GMDFG+   P      V +  +  I
Sbjct: 226 CDGDWGVAEGLVFNNFKVEDFDWFAEFKRTQEITHGMDFGFSQDPTTVVSTVVDLKNKKI 285

Query: 162 YVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
           ++   Y  +          L   G          G       G+++ ++ + +G+K +  
Sbjct: 286 FIYDEYYKKAMLTDDIKQMLIKKGLDDVDIAADYG-----AGGDRVISELKSKGIKGIR- 339

Query: 222 CATFDDGSNGVEAGISDML 240
                 G+N +  GI  + 
Sbjct: 340 --KALKGANTILPGIQFIQ 356


>gi|325912773|ref|ZP_08175152.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           UPII 60-B]
 gi|325477904|gb|EGC81037.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           UPII 60-B]
          Length = 409

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 38/258 (14%), Positives = 92/258 (35%), Gaps = 21/258 (8%)

Query: 2   KAY---EQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSP 56
           KAY   E+GRD  +  T    + +E       V+ E   R +A +  +     P      
Sbjct: 108 KAYTGSERGRDSIRGMTAWGAYINEASLAKASVFSEIQKRCSAPEARIICDTNPDAPTHW 167

Query: 57  IIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGR 113
           + ++Y+  +      +    T ++ P  ++  ++++  S P     +    G    G G 
Sbjct: 168 LKKNYIDNTDPKAGIKTFFFTFDDNPTLDDDYKEKLKASTPSGVFYDRDILGLWCTGEGV 227

Query: 114 IFPIVEE-DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ 172
           ++   ++  + I+   +P       G+D+G+ H         +   +  Y+++ +  + +
Sbjct: 228 VYRDFDQSTMTIDRDKLPTDLTYYVGVDWGYEHTGTLIVFADDSQGNT-YLIEEHAHKHR 286

Query: 173 TPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
              + V       +      P      D    + L+      G++           +  +
Sbjct: 287 FIDYWVDLAHDVQQKYGSTIP---FWCDSARPDNLNEFLT-HGIRAYN-------ANKAI 335

Query: 233 EAGISDMLDRMRSGRWKV 250
            +GI  +   M++  + V
Sbjct: 336 NSGIEAVGSLMKAKHFFV 353


>gi|116512790|ref|YP_811697.1| Phage terminase large subunit [Lactococcus lactis subsp. cremoris
           SK11]
 gi|116108444|gb|ABJ73584.1| Phage terminase large subunit [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 411

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 33/248 (13%), Positives = 85/248 (34%), Gaps = 16/248 (6%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
           G    +  T +  + +E     ++V+ E ++R +     +     P      + + Y+  
Sbjct: 115 GVGAIRGMTAYGAYINEASLAKQEVFAEIVSRCSGNGARILADTNPDNPEHWLKKEYIDK 174

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVE-EDI 122
            + + +     +++    +E+ R+ I  + P     +   KG  +   G ++   +    
Sbjct: 175 PNENVKAFHFELDDNTFLSERYRENIKAATPSGMFYDRDIKGLWVSADGVVYQDFDSNKH 234

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
            I S D+P+      G+D+G+ H  +   +    D    Y+++ +  + +   + V   K
Sbjct: 235 YIQSKDLPKLSTFYCGVDWGYEHWGSIVVIGET-DDGTAYLIEEHAKQHEEIDYWVDIAK 293

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
              +      P      D    E +         +   E     +       G+  +  R
Sbjct: 294 EIQERYGSRVP---FYCDSARPEHVD--------RFKREHIEAFNADKARLTGVEAVARR 342

Query: 243 MRSGRWKV 250
            +  +  +
Sbjct: 343 FKKDKLFI 350


>gi|229125411|ref|ZP_04254482.1| Phage terminase large subunit [Bacillus cereus 95/8201]
 gi|228658044|gb|EEL13813.1| Phage terminase large subunit [Bacillus cereus 95/8201]
          Length = 376

 Score =  107 bits (268), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 77/248 (31%), Gaps = 12/248 (4%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T   ++FDE     +    +   R++ T   +     P        E +L
Sbjct: 69  ESSQDLIQGITAAGMFFDEVALMVQSFVNQATGRLSVTGSKMWFNCNPAGPYHWFKEKWL 128

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                   +  + ++++    +E+ ++R    Y         KGE    SG IF + +E+
Sbjct: 129 DQKKEKNLLHLKFSMDDNLSLDEKTKRRYHRMYSGVFYRRYIKGEWAAASGLIFDMFDEN 188

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVW---NRDSDVIYVVKNYRCREQTPIFHV 178
           I         +       D+G  +  A G         D +V Y +K Y    +      
Sbjct: 189 IHKVESVDRNYVEYYVSCDYGTQNAMAYGLWGKCIEEGDKEVWYKIKEYHYSGRDTEKQK 248

Query: 179 AALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
                        +  D            ++        ++          N V+ GI +
Sbjct: 249 T--DQEYYEDYEEFVGDLPIRGTVVDPSAASFIAL----LVRNKRKVYKARNNVKEGIGN 302

Query: 239 MLDRMRSG 246
           +   + +G
Sbjct: 303 VGVALNTG 310


>gi|125623674|ref|YP_001032157.1| terminase large subunit [Lactococcus lactis subsp. cremoris MG1363]
 gi|124492482|emb|CAL97424.1| terminase large subunit [Lactococcus lactis subsp. cremoris MG1363]
 gi|300070440|gb|ADJ59840.1| terminase large subunit [Lactococcus lactis subsp. cremoris NZ9000]
          Length = 411

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/248 (13%), Positives = 86/248 (34%), Gaps = 16/248 (6%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
           G    +  T +  + +E     ++V+ E ++R +     +     P      + + Y+  
Sbjct: 115 GVGAIRGMTAYGAYVNEASLAKQEVFAEIVSRCSGNGARILADTNPDNPEHWLKKEYIDK 174

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVE-EDI 122
            + + +     +++    +++ R+ I  + P     +   KG  +   G ++   +    
Sbjct: 175 PNENVKAFHFELDDNTFLSKRYRENIKAATPSGMFYDRDIKGLWVSADGVVYQDFDSNKH 234

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
            I S D+P+      G+D+G+ H  +   +    D    Y+++ +  + +   + V   K
Sbjct: 235 YIQSKDLPKLSTFYCGVDWGYEHWGSIVVIGET-DDGTAYLIEEHAKQHEEIDYWVDIAK 293

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
              +      P      D    E +         +   E     +G      G+  +  R
Sbjct: 294 EIQERYGSRVP---FYCDSARPEHVD--------RFKREHIEAFNGDKARLTGVEAVARR 342

Query: 243 MRSGRWKV 250
            +  +  +
Sbjct: 343 FKKDKLFI 350


>gi|118445162|ref|YP_879274.1| PBSX family phage terminase large subunit [Clostridium novyi NT]
 gi|118135618|gb|ABK62662.1| phage terminase, large subunit, PBSX family [Clostridium novyi NT]
          Length = 434

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/278 (12%), Positives = 80/278 (28%), Gaps = 48/278 (17%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPED--VYFEG--LTRINATQGLVTLTLTPLKGRS 55
            K  +   +K +S + +  +  +E        + +     R       + L   P+   +
Sbjct: 109 FKGLD-DSEKIKSISDISDIVIEEATELTLLDFTQLNLRMRTKQKNQQIHLMFNPVNKVN 167

Query: 56  PIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGR 113
            + + +         +++ T    P+  +   K I      +    +   +GE      R
Sbjct: 168 WVYKTFFEQKYDGALIVKTTYKNNPYLPKDYVKEIKQLKETNYTLYKIYAEGEFSSLDKR 227

Query: 114 IFPIV---EEDIVINSLDIPEH--------------------------WVQIGGMDFGWH 144
           IF      + DI+    +  ++                               G+DFG+ 
Sbjct: 228 IFTNWQPLDFDILDIKYEKVKNKLKEMGIDDNILKYVSSPIFQKLLKERECYFGLDFGYT 287

Query: 145 -HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRS 203
             P A    + ++ +  I+V   +     T       +K  G              D   
Sbjct: 288 NDPSAFIAFMVDKKTKEIWVFDEFYLSGLTNEDIFKEIKYKGYSKEII------TADSSE 341

Query: 204 GEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
            + +  + +R G+           G + +  GI  +  
Sbjct: 342 PKSI-EELKRLGL---TRIKAAKKGKDSILNGIQYLQS 375


>gi|293572610|ref|ZP_06683581.1| phage terminase, large subunit, pbsx family [Enterococcus faecium
           E980]
 gi|291607307|gb|EFF36658.1| phage terminase, large subunit, pbsx family [Enterococcus faecium
           E980]
          Length = 414

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 90/248 (36%), Gaps = 16/248 (6%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
           G    +  T +  + +E     ++V+ E ++R + T   +     P      + + Y+  
Sbjct: 116 GVGAIRGMTAYGAYINEASLARQEVFAEIVSRCSGTGARILADTNPDNPEHWLKKEYIDN 175

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVE-EDI 122
           SS + Q     +++    +E+ R  I +S P     +   KG  +   G ++   +    
Sbjct: 176 SSKNIQSFHFELDDNTFLSERYRNNIKESTPSGMFYDRDIKGLWVSAEGVVYRDFDASKH 235

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
            I S D+P       G+D+G+ H  +   +    D    Y+++ +  + +   + V   K
Sbjct: 236 YIQSKDLPPLSNFYCGVDWGYEHWGSIVVIGET-DDGTAYLIEEHATQFEEIDYWVDVAK 294

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
              +      P      D    E ++        + + E     +      +G+ ++  R
Sbjct: 295 GIQERYGLRVP---FYCDSARPEHVA--------RFVREKINAKNAHKARLSGVEEVAKR 343

Query: 243 MRSGRWKV 250
            +  +  +
Sbjct: 344 FKQDKLFI 351


>gi|226305996|ref|YP_002765956.1| hypothetical protein RER_25090 [Rhodococcus erythropolis PR4]
 gi|226185113|dbj|BAH33217.1| hypothetical protein RER_25090 [Rhodococcus erythropolis PR4]
          Length = 402

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/247 (17%), Positives = 83/247 (33%), Gaps = 15/247 (6%)

Query: 7   GRDKWQSNTVHYVWFDEEPPEDVYFE-----GLTRINATQGLVTLTLTPLKGRSPIIEHY 61
             +  +      V  DE      + +         +   +G      TP   +S      
Sbjct: 105 NIETARGKKYSLVVLDELDSMRAFEKQWREIIRATLADYRGRALFMGTPKGYKSLYRLEK 164

Query: 62  LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
           LS ++++ +V   T  + P  + +E   +     + +       E     G I+     D
Sbjct: 165 LSKTNANYEVFHFTSFDNPFLSVEELDEMRGEMTVTQYAQEMLAEYHKMEGLIYEEFNRD 224

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
             I +L           +DFG++HPFAAG      D+  +++ +    R+ +    + A+
Sbjct: 225 QHIKALPFTPE-RWALSIDFGYNHPFAAGIFAIGSDN-SLHLDRMVYKRKLSDEQRMNAV 282

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
           +            D    D      +    R+ G+K+ P       G+  V  GI+    
Sbjct: 283 RDLIGDTKL----DFQIGDSEDPLAIDTLNRQLGLKIQP----VVKGAGSVLEGINKSKS 334

Query: 242 RMRSGRW 248
            +  GR 
Sbjct: 335 LLHQGRL 341


>gi|19746248|ref|NP_607384.1| putative terminase, large subunit [Streptococcus pyogenes MGAS8232]
 gi|19748434|gb|AAL97883.1| putative terminase, large subunit [Streptococcus pyogenes MGAS8232]
          Length = 431

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 78/248 (31%), Gaps = 30/248 (12%)

Query: 18  YVWFDE------EPPEDVYFEGLTRINATQ---GLVTLTLTPLKGRSPIIEHYLSASSS- 67
           + WF+E      E       E +   +        +T+T  P   R  +   +    +  
Sbjct: 134 WAWFEEAYQIETEDKFSTVVESIRGTSDVPDFFKQITVTFNPWSERHWLKRVFFDEETKR 193

Query: 68  -DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVI 124
            D      T       ++ +++R  D Y  + R AR    GE  +  G +F   E     
Sbjct: 194 ADTFSGTTTFRVNEWLDDVDKRRYEDLYKTNPRRARIVCDGEWGVAEGLVFDNFEVVDFD 253

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
               I        GMDFG+   P     +  +  +  +++   +  +       V  ++ 
Sbjct: 254 VEKTIQRVKETSVGMDFGFTQDPTTLICVAVDLANKELWLYNEHYQKAMLTDHIVKMIRD 313

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
                 +              ++L A+ + +G+  +        G   +  GI  M    
Sbjct: 314 KNLHRSYIAGDSAE-------KRLIAEIKSKGVSGI---VPSIKGKGSIMQGIQFMQG-- 361

Query: 244 RSGRWKVF 251
               +K++
Sbjct: 362 ----FKIY 365


>gi|330507947|ref|YP_004384375.1| phage terminase, large subunit, PBSx family [Methanosaeta concilii
           GP-6]
 gi|328928755|gb|AEB68557.1| phage terminase, large subunit, PBSx family [Methanosaeta concilii
           GP-6]
          Length = 422

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/276 (15%), Positives = 86/276 (31%), Gaps = 36/276 (13%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
                K +  ++   + DE    PE+     L+R++     + LT  P   R+ I  +++
Sbjct: 104 TSSYKKIEGESLLRAYVDEGTTIPENFTNMLLSRLSDKGACLYLTCNPETPRNYIYRNWI 163

Query: 63  SASSS-DRQVIRMTINETPHYNEQERKRIIDSYPL--HEREARTKGEPILGSGRIFP-IV 118
           +     + +V + T+++ P+   + ++ +   YP      +    G  +   GR+F    
Sbjct: 164 ARQDELNIKVWKFTLDDNPYLPLEYKRDLEKEYPKGTVFYDRFILGNWVAAEGRVFGLFA 223

Query: 119 EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGH----LVWNRDSDVIYVVKNYR------ 168
                              G D+G H+  A       LV  R     YV + Y       
Sbjct: 224 RGMHCEVPPATLRPKELRIGADYGTHNACAFVALEKYLVPGRAKPTWYVAREYYWDSVVE 283

Query: 169 CREQTPIFHVAALKSWG--------------KWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             ++T   +   +  +                    +  +        S      Q +R 
Sbjct: 284 HAQKTDADYSKDMAKFASEQWGYSSGQPGITYGDNTSKMYASTIEVDPSAASFILQLQRD 343

Query: 215 GMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
           G+             N V  GI  +   + +G   +
Sbjct: 344 GL------HKARAADNDVLGGIRKIASMIGNGDLII 373


>gi|309804260|ref|ZP_07698337.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           LactinV 11V1-d]
 gi|309808639|ref|ZP_07702531.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           LactinV 01V1-a]
 gi|309809485|ref|ZP_07703343.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           SPIN 2503V10-D]
 gi|308163663|gb|EFO65933.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           LactinV 11V1-d]
 gi|308168113|gb|EFO70239.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           LactinV 01V1-a]
 gi|308170157|gb|EFO72192.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           SPIN 2503V10-D]
          Length = 409

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/258 (15%), Positives = 92/258 (35%), Gaps = 21/258 (8%)

Query: 2   KAY---EQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSP 56
           KAY   E+GRD  +  T    + +E       V+ E   R +A +  +     P      
Sbjct: 108 KAYTGSERGRDSIRGMTAWGAYINEASLAKASVFSEIQKRCSAPEARIICDTNPDAPTHW 167

Query: 57  IIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGR 113
           + ++Y+  +      +    T ++ P  ++  ++++  S P     +    G    G G 
Sbjct: 168 LKKNYIDNTDPKAGIKTFFFTFDDNPTLDDDYKEKLKASTPSGVFYDRDILGLWCTGEGV 227

Query: 114 IFPIVEE-DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ 172
           ++   ++  + I+   +P       G+D+G+ H         +   +  Y++K +  + +
Sbjct: 228 VYRDFDQSTMTIDRDKLPTDLTYYVGVDWGYEHTGTLIVFADDSQGNT-YLIKEHAHKHR 286

Query: 173 TPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
              + V       +      P      D    + L+      G++           +  +
Sbjct: 287 FIDYWVDLAHDVQQKYGSTIP---FWCDSARPDNLNEFLT-HGIRAYN-------ANKAI 335

Query: 233 EAGISDMLDRMRSGRWKV 250
            +GI  +   M++  + V
Sbjct: 336 NSGIEAVGSLMKAKHFFV 353


>gi|229100170|ref|ZP_04231070.1| Phage terminase large subunit [Bacillus cereus Rock3-29]
 gi|228683212|gb|EEL37190.1| Phage terminase large subunit [Bacillus cereus Rock3-29]
          Length = 414

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/251 (16%), Positives = 82/251 (32%), Gaps = 16/251 (6%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T   ++FDE     +    +   R++ T   +     P        E +L
Sbjct: 107 ESSQDLIQGITAAGMFFDEVALMVQSFVNQATGRLSVTGSKMWFNCNPAGPYHWFKEKWL 166

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                   +  + ++++    +E+ ++R    Y         KGE    SG IF + +E 
Sbjct: 167 DQKKGKNLLHLKFSMDDNLSLDEKTKRRYHRMYSGVFYRRYIKGEWAAASGLIFDMFDEK 226

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVW---NRDSDVIYVVKNYRCREQTPIFHV 178
                    ++       D+G  +  A G         D +V Y +K Y    +      
Sbjct: 227 THKVESVDRKYVEYYVSCDYGTQNAMAYGLWGKCIEEGDKEVWYKIKEYHYSGRDTEKQK 286

Query: 179 AALKSWGKWLPWA--WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGI 236
              + +  +  +    P  G   D  +   ++   R                 N V+ GI
Sbjct: 287 TDQEYYEDYEEFVGDLPIKGTVIDPSAASFIAVLMRN--------KRKVYKARNNVKEGI 338

Query: 237 SDMLDRMRSGR 247
            ++   + +GR
Sbjct: 339 GNVGIALNTGR 349


>gi|227890170|ref|ZP_04007975.1| terminase large subunit [Lactobacillus johnsonii ATCC 33200]
 gi|227849265|gb|EEJ59351.1| terminase large subunit [Lactobacillus johnsonii ATCC 33200]
          Length = 423

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/248 (14%), Positives = 79/248 (31%), Gaps = 23/248 (9%)

Query: 7   GRDKWQSNT-VHYVWFDEEPPED--VYFEGLTRINATQGL---VTLTLTPLKGRSPIIEH 60
             +K +S   +  V  +E    +   Y +   R+   +     +     P+   +   + 
Sbjct: 119 DPEKIKSIKGLSDVVMEEASEFNHNDYTQLTLRLREPKHKQRQIFCMFNPVSKLNWTYQT 178

Query: 61  YLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRI 114
           +   S+        + R T  +    +    K I D    +    +  T GE       +
Sbjct: 179 WFDPSADYDKSRVSIHRSTYKDNKFLDADNIKTIEDLKRTNPAYYKIYTLGEFATLDKLV 238

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
           FP  E   +        +     G+D+G+ + P A  H+  +     +YV+  +  R   
Sbjct: 239 FPSFETRRLNPRDPELINLHDYFGLDYGFVNDPSAFMHIKLDLKRCKLYVMDEFVKRGLL 298

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                  +K  G      +  + +  D    + ++   RR G+           G + + 
Sbjct: 299 NNQLAKVIKDMG------FAKEVITADSAEKKSIAE-MRRDGIY---RIRPALKGPDSIV 348

Query: 234 AGISDMLD 241
            GI  +  
Sbjct: 349 QGIQFLQQ 356


>gi|66394878|ref|YP_239721.1| ORF008 [Staphylococcus phage 85]
 gi|148267321|ref|YP_001246264.1| PBSX family phage terminase large subunit [Staphylococcus aureus
           subsp. aureus JH9]
 gi|150393373|ref|YP_001316048.1| PBSX family phage terminase large subunit [Staphylococcus aureus
           subsp. aureus JH1]
 gi|189427164|ref|YP_001949840.1| putative terminase, large subunit [Staphylococcus phage phiMR25]
 gi|257793419|ref|ZP_05642398.1| phage terminase, large subunit [Staphylococcus aureus A9781]
 gi|258418133|ref|ZP_05682398.1| phage terminase [Staphylococcus aureus A9763]
 gi|258422108|ref|ZP_05685021.1| phage terminase large subunit [Staphylococcus aureus A9719]
 gi|258448907|ref|ZP_05697016.1| phage terminase [Staphylococcus aureus A6224]
 gi|258453887|ref|ZP_05701859.1| phage terminase large subunit [Staphylococcus aureus A5937]
 gi|282929085|ref|ZP_06336666.1| phage terminase large subunit [Staphylococcus aureus A10102]
 gi|295406591|ref|ZP_06816397.1| phage terminase large subunit [Staphylococcus aureus A8819]
 gi|297245317|ref|ZP_06929191.1| phage terminase large subunit [Staphylococcus aureus A8796]
 gi|62635807|gb|AAX90918.1| ORF008 [Staphylococcus phage 85]
 gi|147740390|gb|ABQ48688.1| phage terminase, large subunit, PBSX family [Staphylococcus aureus
           subsp. aureus JH9]
 gi|149945825|gb|ABR51761.1| phage terminase, large subunit, PBSX family [Staphylococcus aureus
           subsp. aureus JH1]
 gi|189339075|dbj|BAG48139.1| putative terminase, large subunit [Staphylococcus phage phiMR25]
 gi|257787391|gb|EEV25731.1| phage terminase, large subunit [Staphylococcus aureus A9781]
 gi|257838926|gb|EEV63405.1| phage terminase [Staphylococcus aureus A9763]
 gi|257841903|gb|EEV66339.1| phage terminase large subunit [Staphylococcus aureus A9719]
 gi|257857803|gb|EEV80695.1| phage terminase [Staphylococcus aureus A6224]
 gi|257863752|gb|EEV86508.1| phage terminase large subunit [Staphylococcus aureus A5937]
 gi|282589277|gb|EFB94371.1| phage terminase large subunit [Staphylococcus aureus A10102]
 gi|285816567|gb|ADC37054.1| Phage terminase, large subunit [Staphylococcus phage phiSaST5K]
 gi|294968736|gb|EFG44759.1| phage terminase large subunit [Staphylococcus aureus A8819]
 gi|297177988|gb|EFH37237.1| phage terminase large subunit [Staphylococcus aureus A8796]
 gi|315128310|gb|EFT84329.1| phage terminase, large subunit, PBSX family protein [Staphylococcus
           aureus subsp. aureus CGS03]
          Length = 431

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 84/259 (32%), Gaps = 28/259 (10%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDEEPPEDVYF------EGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E    + +       E +     +      +T+
Sbjct: 107 FRGLD-DPLKITSITVDTGILCWAWFEEAYQIETFAKFSTVVESIRGSYDSPEFFKQITV 165

Query: 47  TLTPLKGRSPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +    +   +      T       ++ + +R  D Y  + R AR  
Sbjct: 166 TFNPWSERHWLKPTFFDEETKLNNTFSDTTTYRVNEWLDKVDIERYEDLYIKNPRRARIV 225

Query: 104 -KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVI 161
             G+  +  G +F   + +      +         GMDFG+   P      V +  +  +
Sbjct: 226 CDGDWGVAEGLVFDNFKVEDFDWFEEFKRTQEITHGMDFGFSQDPTTVVSTVVDLKNKKL 285

Query: 162 YVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
           ++   +  +          L   G          G       G+++ ++ + +G+K +  
Sbjct: 286 FIYDEHYKKAMLTDDIKQMLIKKGLGDVDIAADYG-----AGGDRVISELKSKGIKGIR- 339

Query: 222 CATFDDGSNGVEAGISDML 240
                 G+N +  GI  + 
Sbjct: 340 --KALKGANTILPGIQFIQ 356


>gi|291556861|emb|CBL33978.1| Terminase-like family [Eubacterium siraeum V10Sc8a]
          Length = 487

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 54/297 (18%), Positives = 92/297 (30%), Gaps = 61/297 (20%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGR--- 54
             +++ R  +Q     +V FDE          Y     R       V +  T   G    
Sbjct: 110 MQHKKDRLNYQGKHYDFVGFDELTQFSFDEYSYMFSRNRPGGKGTRVYIRATANPGGPGH 169

Query: 55  SPIIEHYLSASSS----------------------DRQVIRMTINETPHY--NEQERKRI 90
           S + + +++A                          R  I  ++ +      N+ E    
Sbjct: 170 SWVKQRFITAGEPMKPIIEEHKVKKPDGAEIIIRKSRVFIPASVFDNKELLRNDPEYLAS 229

Query: 91  IDSYPLHEREARTKGEPILGSGRIFPIVEED----------IVINSLDIPEHWVQIGGMD 140
           +   P  ER+A   G+    +G++F    +D           VI   +IP HW  + G D
Sbjct: 230 LSMLPTAERKALLYGDWNSFTGQVFTEWRDDPEHYCDRRWTHVIAPFEIPRHWEIVRGFD 289

Query: 141 FGWHHPFAAGHLVWNRDSDVIYVVKNYRCR--------EQTPIFHVAALKSWGKWLP--- 189
           FG+  PF+ G    +     IY ++ Y              P      ++   +  P   
Sbjct: 290 FGYTRPFSVGWYAVDTKG-CIYRIREYYGCTDKANEGIRLEPSVIAENIRKIERDDPNIR 348

Query: 190 ---WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
                   D    DK  GE ++    R      P    +  G N   +G     +R+
Sbjct: 349 GRNVYGVADPSIFDKSRGESVADLMARS-----PNFIIWSPGDNARISGKMQYHNRL 400


>gi|119967835|ref|YP_950664.1| putative large terminase subunit [Staphylococcus phage PH15]
 gi|112790059|gb|ABI21779.1| putative large terminase subunit [Staphylococcus phage PH15]
          Length = 446

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/282 (13%), Positives = 81/282 (28%), Gaps = 53/282 (18%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFEG-------LTRINATQG--LVTLTLTP 50
            Q  ++ +S          +W +E        E        L              +  P
Sbjct: 112 AQNPERLKSLKDSRFPFSIMWIEELAEFKTEDEVTTITNSMLRGELDDGLFYKFFFSYNP 171

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y ++   D   V   T  + P  ++Q  +    +   +E+  R +    
Sbjct: 172 PKRKQSWVNKKYETSFQPDNTFVHHSTYLDNPFISKQFIQEAESAKERNEQRYRWEYMGE 231

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFG------------------------- 142
                + P     I     ++ + +  I   +DFG                         
Sbjct: 232 AIGSGVVPFNNLQIEKIPDELYKSFDNIRNAVDFGLTKTAPLHSDVYSKLGEHISGVRKK 291

Query: 143 --WHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHD 200
                P A     +++   +IY V  +   + +       LK  G      +  D +  D
Sbjct: 292 ACATDPLAFVRWHYDKKKRIIYAVDEHYGVQISNREFANWLKRRG------YQSDEIYAD 345

Query: 201 KRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
               + ++   +  G+K          G + VE G   + D 
Sbjct: 346 SAEPKSIAELKQEHGIK---RIKGVKKGPDSVEHGEQWLDDL 384


>gi|323340036|ref|ZP_08080302.1| prophage protein [Lactobacillus ruminis ATCC 25644]
 gi|323092542|gb|EFZ35148.1| prophage protein [Lactobacillus ruminis ATCC 25644]
          Length = 421

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/250 (13%), Positives = 78/250 (31%), Gaps = 22/250 (8%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPE--DVYFEGLTRINATQGL---VTLTLTPLKGR 54
            K  +   +K +S   +  V  +E      D Y +   R+   +     +     P+   
Sbjct: 113 FKGMD-DPEKIKSIKGLSDVVMEEASEFTLDDYTQLTLRLREPKHRQRQLFCMFNPVSKV 171

Query: 55  SPIIEHYLSASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILG 110
           +   + + +  +        V   T  +    +      I +    +    +        
Sbjct: 172 NWTYKQWFAPDAEYDPSRVAVHHSTYKDNRFLDADNIATIENLKITNPAYYKIYTLGEFA 231

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRC 169
           +         +      D    +  + G+DFG+   P    H+  +  S V+YV++ Y  
Sbjct: 232 TLDKLVFPTFEKRRLRADSLNKFPSLFGLDFGYTNDPSVFIHVKADVKSKVLYVLEEYVK 291

Query: 170 REQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGS 229
           +         A+KS G      +  + +  D    + ++   R      +      + G 
Sbjct: 292 KGMLNDEIAQAIKSLG------YAKEKITADAAEKKSIAEIKR----NGIYRIRPAEKGP 341

Query: 230 NGVEAGISDM 239
           N V  G++ +
Sbjct: 342 NSVVQGVNFL 351


>gi|167749269|ref|ZP_02421396.1| hypothetical protein EUBSIR_00220 [Eubacterium siraeum DSM 15702]
 gi|167657762|gb|EDS01892.1| hypothetical protein EUBSIR_00220 [Eubacterium siraeum DSM 15702]
          Length = 487

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 54/297 (18%), Positives = 92/297 (30%), Gaps = 61/297 (20%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGR--- 54
             +++ R  +Q     +V FDE          Y     R       V +  T   G    
Sbjct: 110 MQHKKDRLNYQGKHYDFVGFDELTQFSFDEYSYMFSRNRPGGKGTRVYIRATANPGGPGH 169

Query: 55  SPIIEHYLSASSS----------------------DRQVIRMTINETPHY--NEQERKRI 90
           S + + +++A                          R  I  ++ +      N+ E    
Sbjct: 170 SWVKQRFITAGEPMKPIIEEHKVKKPDGAEIIIRKSRVFIPASVFDNKELLRNDPEYLAS 229

Query: 91  IDSYPLHEREARTKGEPILGSGRIFPIVEED----------IVINSLDIPEHWVQIGGMD 140
           +   P  ER+A   G+    +G++F    +D           VI   +IP HW  + G D
Sbjct: 230 LSMLPTAERKALLYGDWNSFTGQVFTEWRDDPEHYCDRRWTHVIAPFEIPRHWEIVRGFD 289

Query: 141 FGWHHPFAAGHLVWNRDSDVIYVVKNYRCR--------EQTPIFHVAALKSWGKWLP--- 189
           FG+  PF+ G    +     IY ++ Y              P      ++   +  P   
Sbjct: 290 FGYTRPFSVGWYAVDTKG-CIYRIREYYGCTDKANEGIRLEPSVIAENIRKIERDDPNIR 348

Query: 190 ---WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
                   D    DK  GE ++    R      P    +  G N   +G     +R+
Sbjct: 349 GRNVYGVADPSIFDKSRGESVADLMARS-----PNFIIWSPGDNARISGKMQYHNRL 400


>gi|227498429|ref|ZP_03928575.1| phage terminase large subunit [Acidaminococcus sp. D21]
 gi|226903887|gb|EEH89805.1| phage terminase large subunit [Acidaminococcus sp. D21]
          Length = 418

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 79/236 (33%), Gaps = 24/236 (10%)

Query: 18  YVWFDEEPPEDVYF------EGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQV 71
            VW +E              + L R    Q  V  T  P K RS  +   +     DR V
Sbjct: 130 IVWLEELDQFSGMEEIRNLCQSLLR-GGPQYWVFCTYNPPKSRSSWVNEEILVDDPDRMV 188

Query: 72  IRMTINETP--HYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVINSL 127
            R T  + P     EQ  +        +E        GE + G+G       ED+ +   
Sbjct: 189 HRSTYLQVPQKWLGEQFLQEAEKLKERNEMAYRHEYLGE-VTGTGGAVFENVEDLPLTEE 247

Query: 128 DIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
            + +   ++ G+DFG+   P A   + ++   + +Y+      ++ T       +     
Sbjct: 248 ALGQFDHRLFGLDFGFAVDPLAFVAMHYDAKHEDLYIWGEIYEQKLTNPQAARKISQ--- 304

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                 P + ++ D    + +    R   M ++        G + VE GI  +   
Sbjct: 305 ---VILPGELVRCDSAEPKSIKE-MRSLDMNIIGA----PKGPDSVEYGIKWLQSL 352


>gi|322412526|gb|EFY03434.1| terminase large subunit [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 435

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 73/237 (30%), Gaps = 24/237 (10%)

Query: 18  YVWFDE------EPPEDVYFEGLTRINATQ---GLVTLTLTPLKGRSPIIEHYLSASSS- 67
           + WF+E      E       E +            +T+T  P   R  +   +    +  
Sbjct: 138 WAWFEEAYQIETEDKFSTVVESIRGTLDVPDFFKQITVTFNPWSERHWLKRVFFDEETKR 197

Query: 68  -DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVI 124
            D      T       ++ +++R  D Y  + R AR    GE  +  G +F   E     
Sbjct: 198 ADTFSGTTTFRVNEWLDDVDKRRYEDLYKTNPRRARIVCDGEWGVAEGLVFDNFEVVDFD 257

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
               I        GMDFG+   P     +  +  +  +++   +  +       V  ++ 
Sbjct: 258 VEKTIQRIKETSAGMDFGFTQDPTTLICVAVDLANKELWLYNEHYQKAMLTDHIVKMIRD 317

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                 +              ++L A+ + +G+  +        G   +  GI  M 
Sbjct: 318 KNLHRSYIAGDSAE-------KRLIAEIKSKGVSGI---VPSIKGKGSIMQGIQFMQ 364


>gi|303233959|ref|ZP_07320608.1| phage terminase, large subunit, PBSX family [Finegoldia magna
           BVS033A4]
 gi|302494884|gb|EFL54641.1| phage terminase, large subunit, PBSX family [Finegoldia magna
           BVS033A4]
          Length = 406

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/244 (12%), Positives = 80/244 (32%), Gaps = 17/244 (6%)

Query: 11  WQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            +  T    + +E     ++V+ E ++R +     V +   P      +++ Y+     +
Sbjct: 121 IRGMTSFGAYINEASLARKEVFAEIISRCSGDGARVLVDTNPDNPEHWLLKDYILNPDDN 180

Query: 69  RQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEE-DIVINS 126
               +  +++    +++  K I  S P     E    G+ + G G ++   ++       
Sbjct: 181 ILEHKFRLDDNTFLSDRYIKNIKASTPSGMFYERDIDGDWVSGDGVVYADFDKNKHYFEP 240

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
                +     G+D+G+ H  A   +    D    Y+++ Y    +   +     K    
Sbjct: 241 KTEKTYQCTFCGVDWGYEHYGAIVVIGKGYDG-KYYMLEEYAETLKEIDYWENIAK---- 295

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSG 246
            +   +       D    E +         + +       + S    AGI  +  + ++ 
Sbjct: 296 DIYKRYGDIPFYCDTARPEYI--------YRFINCGLDAKNASKERMAGIEFVAKQFKTD 347

Query: 247 RWKV 250
              +
Sbjct: 348 NLYI 351


>gi|228930635|ref|ZP_04093616.1| Phage terminase large subunit [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228829031|gb|EEM74687.1| Phage terminase large subunit [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 381

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/247 (16%), Positives = 77/247 (31%), Gaps = 11/247 (4%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T   ++FDE     +    +   R++ T   +     P        E +L
Sbjct: 75  ESSQDLIQGITAAGMFFDEVALMVQSFVNQATGRLSVTGSKMWFNCNPAGPYHWFKEKWL 134

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
                   +  + ++++    +E+ ++R    Y         KGE    SG IF + +E+
Sbjct: 135 DQKKEKNLLHLKFSMDDNLSLDEKTKRRYHRMYSGVFYRRYIKGEWAAASGLIFDMFDEN 194

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV--WNRDSDVIYVVKNYRCREQTPIFHVA 179
                    E+       D+G  +    G       +  +V Y VK YR   +       
Sbjct: 195 KHKVPTIQREYVEYFVSCDYGTQNAMVYGLWGKCIEKGEEVWYKVKEYRYSGRETEKQKT 254

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
                       +  D            S+        ++          N V+ GI ++
Sbjct: 255 --DQEYYEDFEGFVGDLPIRGTVVDPSASSFIAL----LVRNKRKVYKARNNVKEGIGNV 308

Query: 240 LDRMRSG 246
              + +G
Sbjct: 309 GVALNTG 315


>gi|152990214|ref|YP_001355936.1| phage terminase, large subunit [Nitratiruptor sp. SB155-2]
 gi|151422075|dbj|BAF69579.1| phage terminase, large subunit [Nitratiruptor sp. SB155-2]
          Length = 398

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/237 (12%), Positives = 70/237 (29%), Gaps = 17/237 (7%)

Query: 6   QGRDKWQSNTVHYVWFDEEPP--EDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           Q     +   V   W +E     E+ +   +  I      + ++  P     P  + ++ 
Sbjct: 107 QSIKSTEG--VDICWVEEAQTVSEESWQILIPTIRKPGSEIWVSFNPYFVEDPTYQRFVV 164

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIV 123
              S+  V ++T  + P++ +  R+ +               E    +     +  +   
Sbjct: 165 NPPSNAFVKKVTYKDNPYFPDVLREEMEYDKKTDYERYMHVWEGECITYSDAQVFRDKFA 224

Query: 124 INSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
           I+++D+        G D+G+   P     +      + +Y+ +       T     +   
Sbjct: 225 IDTIDVGNSKEVYYGADWGFAVDPTTLVRVWV--VGEYLYIDQEAYKVGCTLDDTPSL-- 280

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
               +         +     S  +       +G  + P           VE GI  M
Sbjct: 281 ----FDKIVGSRSHIIRADSSRPETINFLNSRGFTIKPA----PKWPGSVEDGIEFM 329


>gi|125974959|ref|YP_001038869.1| PBSX family phage terminase large subunit [Clostridium thermocellum
           ATCC 27405]
 gi|125715184|gb|ABN53676.1| phage terminase, large subunit, PBSX family [Clostridium
           thermocellum ATCC 27405]
          Length = 418

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/239 (17%), Positives = 75/239 (31%), Gaps = 24/239 (10%)

Query: 15  TVHYVWFDEEPPE------DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            V ++W++E           +  + L R    Q +V  T  P    +  +   +     D
Sbjct: 131 YVKFIWYEEVDEFLGMEEIRIINQSLMR-GGEQFVVFYTYNPPNRVNAWVNEEILIDRPD 189

Query: 69  RQVIRMTINETP--HYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
           R+V   T    P     EQ          ++E        GE + G+G       +   I
Sbjct: 190 RKVHHSTYLTVPRDWLGEQFFIEAEHLKKVNEKAYRHEYLGE-VTGTGGEVFTNVKARKI 248

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
           N  +I        G+DFG+   P A     +++    +Y+         +       +K 
Sbjct: 249 NDEEIKAFDRIKRGLDFGYAVDPAAYIVCHFDKTRRRLYIFHEIFQVGLSNRKLAELIKK 308

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
             K             D    + ++   R  G+ +         G + VE GI  + D 
Sbjct: 309 ENKSNKLV------VADSAEPKSIAE-LRGYGINIRGA----KKGPDSVEYGIKFLQDL 356


>gi|163932181|ref|YP_001642371.1| putative phage terminase large subunit B [Lactobacillus johnsonii
           prophage Lj771]
 gi|163562135|gb|ABY26991.1| putative phage terminase large subunit B [Lactobacillus johnsonii
           prophage Lj771]
          Length = 409

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/251 (15%), Positives = 89/251 (35%), Gaps = 18/251 (7%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           +G    +  T +  + +E      +V+ E + R +     +     P      +   Y+ 
Sbjct: 115 RGIGAIRGMTSYGAYINEASLATHEVFQEIVQRCSVGSARIICDTNPDIPTHWLKTDYID 174

Query: 64  ASSSDRQV--IRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFP-IVE 119
                 ++     TI++     +   + +  + P      R   G+ + G G ++     
Sbjct: 175 NHDPKARIKAFSFTIDDNTFLAKDYVEALKAATPRGMFYDRSILGQWVTGEGIVYQDFNA 234

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
             +VI+  +IP+      G+D+G+ HP     L  +   +  YV+K++  R +   + V 
Sbjct: 235 NTMVIDDKNIPDGLNYYCGVDWGFEHPNPILLLGDDNQGNT-YVIKDFTKRHKFISYWVD 293

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
             K                 D    + L+  ++  G+  +            +  GI  +
Sbjct: 294 IAKRLQTEYGRNL---IFYVDSARPDNLNE-FQSNGINAINANKN-------ILPGIEFV 342

Query: 240 LDRMRSGRWKV 250
             +MR G++ +
Sbjct: 343 AQKMRQGKFFI 353


>gi|257453067|ref|ZP_05618366.1| PBSX family phage terminase large subunit [Fusobacterium sp.
           3_1_5R]
 gi|317059604|ref|ZP_07924089.1| phage terminase [Fusobacterium sp. 3_1_5R]
 gi|313685280|gb|EFS22115.1| phage terminase [Fusobacterium sp. 3_1_5R]
          Length = 416

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/269 (13%), Positives = 81/269 (30%), Gaps = 35/269 (13%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQG--LVTLT 47
            + ++    K  S +V      + W +E      E   ++  E +  +        V + 
Sbjct: 109 FRGFD-DPMKITSISVTTGSLCWCWVEEAYEITDEAAFNMLDESIRGVVEEPLFKQVIIC 167

Query: 48  LTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KG 105
             P   R  + + +      +   I          ++ ++K   D    + R  +    G
Sbjct: 168 FNPWNERHWLKKRFFDVQDENILAITTNYMCNEWLDDSDKKLFEDMKKNNPRRYQVAGLG 227

Query: 106 EPILGSGRIFPIVEEDIVINSL--DIPEHWVQIGGMDFGWHHPFAAGHLVW-NRDSDVIY 162
              +  G ++    E         +  +    + G+DFG+ +  AA      + +   +Y
Sbjct: 228 NWGIVDGLVYENWHEQEFDWREILEKRKKAKAVFGLDFGFTNDPAAFFCAVLDLEQKELY 287

Query: 163 VVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPEC 222
           V   +             ++  G              D    + +    R  G+   P  
Sbjct: 288 VFDEFYKTHMHNSDIYREIERMGFRKEII------IADGVEAKSI-EHLRNLGL---PRV 337

Query: 223 ATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
                G + + AGI  + D      +K++
Sbjct: 338 KGSKKGRDSINAGIQFVQD------FKIY 360


>gi|257455568|ref|ZP_05620798.1| phage terminase, large subunit, pbsx family [Enhydrobacter
           aerosaccus SK60]
 gi|257447034|gb|EEV22047.1| phage terminase, large subunit, pbsx family [Enhydrobacter
           aerosaccus SK60]
          Length = 428

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/254 (15%), Positives = 74/254 (29%), Gaps = 25/254 (9%)

Query: 7   GRDKWQSNTVHYVWFDEEPPEDVYFE-GLTRI--NATQGLVTLTLTPLKGRSPIIEHYLS 63
               ++  T+   W +E      +    L          +V ++L P   +  +   Y++
Sbjct: 111 SIKSFEGATIT--WIEEAQTVSAFSLGILIPTVIRTPNPMVIMSLNPRLPQDAVYAQYIA 168

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEP-ILGSGRIFPIVEE 120
               D  V+++   + PH   +  +             E    G P  +  G I+    E
Sbjct: 169 VERDDTAVVQVNYTDNPHCPPELIRLAEQMRDEDFDNYEHIYLGRPKEIADGAIYKAEFE 228

Query: 121 DI----VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
            I     I ++    +       D G   P A            + V+  Y    +    
Sbjct: 229 AIRKSNRICNVPHDPNLPVYTSWDLGILDPTAIWFFQI--YGKEVRVIDYYEANNEPLAH 286

Query: 177 HVAALKSWGKWLPWAW-----PHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
           +   L    + L + +     PHD    D  SG          G +M            G
Sbjct: 287 YARILDEKREALGYRYEKHFAPHDIAARDLSSGVSREQTMANLGYRM------TKGARLG 340

Query: 232 VEAGISDMLDRMRS 245
           VE  I      +++
Sbjct: 341 VEDRIEATRQMLKN 354


>gi|94988455|ref|YP_596556.1| terminase large subunit [Streptococcus phage 9429.2]
 gi|94541963|gb|ABF32012.1| terminase large subunit [Streptococcus phage 9429.2]
          Length = 431

 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 77/248 (31%), Gaps = 30/248 (12%)

Query: 18  YVWFDE------EPPEDVYFEGLTRINATQ---GLVTLTLTPLKGRSPIIEHYLSASSS- 67
           + WF+E      E       E +            +T+T  P   R  +   +    +  
Sbjct: 134 WAWFEEAYQIETEDKFSTVVESIRGSLDAPDFFKQITVTFNPWSERHWLKRVFFDEETKR 193

Query: 68  -DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVI 124
            D      T       ++ +++R  D Y  + R AR    GE  +  G +F   E     
Sbjct: 194 ADTFSGTTTFRVNEWLDDVDKRRYEDLYKTNPRRARIVCDGEWGVAEGLVFDNFEVVDFD 253

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
               I        GMDFG+   P     +  +  +  +++   +  +       V  ++ 
Sbjct: 254 VEKTIQRVKETSAGMDFGFTQDPTTLICVAVDLANKELWLYNEHYQKAMLTDHIVKMIRD 313

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
                 +              ++L A+ + +G+  +        G   +  GI  M    
Sbjct: 314 KNLHRSYIAGDSAE-------KRLIAEIKSKGVSGI---VPSIKGKGSIMQGIQFMQG-- 361

Query: 244 RSGRWKVF 251
               +K++
Sbjct: 362 ----FKIY 365


>gi|15674984|ref|NP_269158.1| putative terminase, large subunit [Streptococcus phage 370.3]
 gi|13622131|gb|AAK33879.1| putative terminase, large subunit - phage associated [Streptococcus
           phage 370.3]
          Length = 429

 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 77/248 (31%), Gaps = 30/248 (12%)

Query: 18  YVWFDE------EPPEDVYFEGLTRINATQ---GLVTLTLTPLKGRSPIIEHYLSASSS- 67
           + WF+E      E       E +            +T+T  P   R  +   +    +  
Sbjct: 132 WAWFEEAYQIETEDKFSTVVESIRGSLDAPDFFKQITVTFNPWSERHWLKRVFFDEETKR 191

Query: 68  -DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVI 124
            D      T       ++ +++R  D Y  + R AR    GE  +  G +F   E     
Sbjct: 192 ADTFSGTTTFRVNEWLDDVDKRRYEDLYKTNPRRARIVCDGEWGVAEGLVFDNFEVVDFD 251

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
               I        GMDFG+   P     +  +  +  +++   +  +       V  ++ 
Sbjct: 252 VEKTIQRVKETSAGMDFGFTQDPTTLICVAVDLANKELWLYNEHYQKAMLTDHIVKMIRD 311

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
                 +              ++L A+ + +G+  +        G   +  GI  M    
Sbjct: 312 KNLHRSYIAGDSAE-------KRLIAEIKSKGVSGI---VPSIKGKGSIMQGIQFMQG-- 359

Query: 244 RSGRWKVF 251
               +K++
Sbjct: 360 ----FKIY 363


>gi|291529974|emb|CBK95559.1| Terminase-like family [Eubacterium siraeum 70/3]
          Length = 487

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 54/297 (18%), Positives = 92/297 (30%), Gaps = 61/297 (20%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGR--- 54
             +++ R  +Q     +V FDE          Y     R       V +  T   G    
Sbjct: 110 MQHKKDRLNYQGKHYDFVGFDELTQFSFDEYSYMFSRNRPGGKGTRVYIRATANPGGPGH 169

Query: 55  SPIIEHYLSASSS----------------------DRQVIRMTINETPHY--NEQERKRI 90
           S + + +++A                          R  I  ++ +      N+ E    
Sbjct: 170 SWVKQRFITAGEPMKPIIEEHKVKKPDGAEIIIRKSRVFIPASVFDNKELLRNDPEYLAS 229

Query: 91  IDSYPLHEREARTKGEPILGSGRIFPIVEED----------IVINSLDIPEHWVQIGGMD 140
           +   P  ER+A   G+    +G++F    +D           VI   +IP HW  + G D
Sbjct: 230 LSMLPTAERKALLYGDWNSFTGQVFTEWRDDPEHYCDRRWTHVIAPFEIPRHWEIVRGFD 289

Query: 141 FGWHHPFAAGHLVWNRDSDVIYVVKNYRCR--------EQTPIFHVAALKSWGKWLP--- 189
           FG+  PF+ G    +     IY ++ Y              P      ++   +  P   
Sbjct: 290 FGYTRPFSVGWYAVDTKG-CIYRIREYYGCTDKANEGIRLEPSAIAENIRKIERDDPNIR 348

Query: 190 ---WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
                   D    DK  GE ++    R      P    +  G N   +G     +R+
Sbjct: 349 GRNVYGVADPSIFDKSRGESVADLMARS-----PYFIIWSPGDNARISGKMQYHNRL 400


>gi|168185987|ref|ZP_02620622.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           C str. Eklund]
 gi|169296078|gb|EDS78211.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           C str. Eklund]
          Length = 412

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 26/237 (10%), Positives = 65/237 (27%), Gaps = 26/237 (10%)

Query: 19  VWFDEEPPED--VYFEGLTRIN---ATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVI- 72
           +W +E    +     +   R+         +TL+  P+     +   Y +    ++Q + 
Sbjct: 130 IWVEEATETEYKAVKQLDKRLRGRSDVTKRLTLSFNPILKDHWLYNEYFNIWEDNKQYVE 189

Query: 73  -------RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
                  + T  +     + +   + +    +  E  T G   +    IF   +     +
Sbjct: 190 KNNVSILKTTYKDNKFLTDDDIAALENETDPYYYEVYTLGNWGVLGAVIFKNWKVQDFSD 249

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG 185
                +++       F    PFA      ++    +Y+                 +K   
Sbjct: 250 IEKTFDNYRHGVDWGFA-DDPFAYIKSHLDKTRKRLYICDEIEVVGMLNEESAPLVKEKA 308

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                      +  D    + ++        K+     +   G   +E GI  +   
Sbjct: 309 G-------SSRVICDSAEPKSVAEFK-----KLRVNAKSAKKGPGSIEYGIKFLQGL 353


>gi|291548652|emb|CBL24914.1| phage terminase, large subunit, PBSX family [Ruminococcus torques
           L2-14]
          Length = 445

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 33/238 (13%), Positives = 78/238 (32%), Gaps = 24/238 (10%)

Query: 18  YVWFDE------EPPEDVYFEGLTRINATQGLVT----LTLTPLKGRSPIIEHYLSASSS 67
           ++W +E      E   ++  E +         +     LTL P      I + +   +  
Sbjct: 157 WMWIEEAYEISSEDDFNMLDESIRGAVPDGSGLFKQITLTLNPWNEHHWIKKRFFDNTDD 216

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEED-IVI 124
           +   +          ++ + K        + R  +    G+  +  G ++   EE    +
Sbjct: 217 ETLAMTTNYKCNEWLDKADLKVFETMKKQNPRRYKVAGLGDWGIVDGLVYENWEEKAFSV 276

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
           + +        + G+DFG+   P A    + ++ S  I+V         +       ++ 
Sbjct: 277 DEVKKIAGVKSVFGLDFGYTNDPSALFCGLIDQSSKTIWVFDEMYQPGMSNEAIAEQVQR 336

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
            G      +  + +  D    + +  + R  G+K +        G + +  GI  + D
Sbjct: 337 MG------YVKEKITADSAEPKSI-DRLRELGLKGIR---KARKGKDSINNGIDFIQD 384


>gi|82751447|ref|YP_417188.1| phage-associated terminase large subunit [Staphylococcus aureus
           RF122]
 gi|215401206|ref|YP_002332511.1| putative terminase large subunit [Staphylococcus phage
           phiSauS-IPLA88]
 gi|82656978|emb|CAI81415.1| phage-associated terminase large subunit [Staphylococcus aureus
           RF122]
 gi|215260433|gb|ACJ64564.1| gp36 [Staphylococcus phage phiSauS-IPLA88]
          Length = 429

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/270 (14%), Positives = 85/270 (31%), Gaps = 36/270 (13%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDEEPPEDVYF------EGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E    + +       E +     +      +T+
Sbjct: 107 FRGLD-DPLKITSITVDTGILCWAWFEEAYQIETFAKFSTVVESIRGSYDSPDFFKQITV 165

Query: 47  TLTPLKGRSPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +    +   +      T       ++ + +R  D Y  + R AR  
Sbjct: 166 TFNPWSERHWLKSTFFDEETKLNNTFSDTTTYRVNEWLDKVDIERYEDLYIKNPRRARIV 225

Query: 104 -KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVI 161
             G+  +  G +F   +                  GMDFG+   P    + V +  +  +
Sbjct: 226 CDGDWGVAEGLVFDNFKVTDFDWREKFKRTQEIAHGMDFGFTFDPTTLINTVVDLKNKEL 285

Query: 162 YVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
           ++   +  +       +  +K  G                   ++L  +  R+G+   P 
Sbjct: 286 WIYDEHSEKAMLTDDIINMIKRKGYQDAHIVADSAE-------KRLITEISRKGV---PN 335

Query: 222 CATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
                 G+N +  G+  +        +KV+
Sbjct: 336 IKPSVKGANTIMQGVQFIQG------FKVY 359


>gi|308172469|ref|YP_003919174.1| phage terminase, large subunit, pbsx family [Bacillus
           amyloliquefaciens DSM 7]
 gi|307605333|emb|CBI41704.1| phage terminase, large subunit, pbsx family [Bacillus
           amyloliquefaciens DSM 7]
          Length = 424

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 35/262 (13%), Positives = 80/262 (30%), Gaps = 30/262 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDEEPPEDVYFE------GLTRINATQGLVTLTL- 48
            +  +    K +S  +      ++W +E     +  E       + R     GL      
Sbjct: 110 FRGAD-DPAKIKSLKIAKFPVAFLWVEELAEFKLEEEISMIENSVLRAELPDGLFYAFYY 168

Query: 49  ---TPLKGRSPIIEHYLSASSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK 104
               P + +S + + Y S+    +  +   T  E P+ ++  ++        +  + R +
Sbjct: 169 SYNPPKRKQSWVNKKYESSFVPKNTYIHHSTYLENPYISKAFKEEAEIVKERNPLKYRWE 228

Query: 105 GEPILGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
                    + P     I    I    +        G+DFG+   P A     +++  + 
Sbjct: 229 YLGEALGSGVVPFDNLKIENGCITDEMVRSFDNIRQGVDFGYGPDPLAYVRWHYDKKRNS 288

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IY +     ++ +       ++S G              D    + +       G++   
Sbjct: 289 IYAIDELYDQKVSNRELAKWIRSKGYESQEI------TADSAEPKSIDELKIDHGIR--- 339

Query: 221 ECATFDDGSNGVEAGISDMLDR 242
                  G + V+ G   + D 
Sbjct: 340 RITGAKKGPDSVQYGEEWLDDL 361


>gi|313113988|ref|ZP_07799543.1| conserved domain protein [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310623690|gb|EFQ07090.1| conserved domain protein [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 486

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 50/306 (16%), Positives = 91/306 (29%), Gaps = 64/306 (20%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQGLVTLTLTPLKGR---SPI 57
            Q +  +Q     ++  DE          Y     R       V +  T   G      +
Sbjct: 112 TQDKYNYQGKAFDFIGVDELTHFTWEEYSYLMSRNRPTGPGTAVYMRATANPGGIGHGWV 171

Query: 58  IEHYLSASSSDRQ----------------------VIRMTINETPHYNEQE--RKRIIDS 93
              +++ +    +                       I  T+ +     E +      + S
Sbjct: 172 KARFITPAPPGTRMVQLVDVKKPDGSVEKLRRTRVFIPSTVFDNKKLLENDPGYLGTLAS 231

Query: 94  YPLHEREARTKGEPILGSGRIFPIVEED----------IVINSLDIPEHWVQIGGMDFGW 143
            P  E++A   G+    +G++F     D           VI    IP HW    G DFG+
Sbjct: 232 LPEAEKQALLYGDWDSFNGQVFTEWRNDPAHYEDQRWTHVIKPFRIPAHWRIWRGYDFGY 291

Query: 144 HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH-------VAALKSWGKWLP------W 190
             PF+ G    + +  +  + + Y C                  +K   +  P       
Sbjct: 292 AKPFSVGWYAADEEGRLYRIKELYGCTGVPNEGLKIDPVEQARRIKEAEENDPMLRGRQI 351

Query: 191 AWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM---RSGR 247
               D    ++  GE ++A   +      P    +  G +   AG   +  R+     GR
Sbjct: 352 TGVADPAIFNESQGESIAAMQEKH-----PNYIFWTPGDHTRLAGKMQLHYRLAFDGEGR 406

Query: 248 --WKVF 251
             ++VF
Sbjct: 407 PMFQVF 412


>gi|306827214|ref|ZP_07460502.1| PBSX family phage terminase [Streptococcus pyogenes ATCC 10782]
 gi|304430571|gb|EFM33592.1| PBSX family phage terminase [Streptococcus pyogenes ATCC 10782]
          Length = 435

 Score =  105 bits (261), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 36/248 (14%), Positives = 77/248 (31%), Gaps = 30/248 (12%)

Query: 18  YVWFDE------EPPEDVYFEGLTRINATQ---GLVTLTLTPLKGRSPIIEHYLSASSS- 67
           + WF+E      E       E +            +T+T  P   R  +   +    +  
Sbjct: 138 WAWFEEAYQIETEDKFSTVVESIRGTLDVPDFFKQITVTFNPWSERHWLKRVFFDEETKR 197

Query: 68  -DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVI 124
            D      T       ++ +++R  D Y  + R AR    G+  +  G +F   E     
Sbjct: 198 ADTFSGTTTFRVNEWLDDVDKRRYEDLYKTNPRRARIVCDGDWGVAEGLVFDNFEVVDFD 257

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
               I        GMDFG+   P     +  +  +  +++   +  +       V  ++ 
Sbjct: 258 VEKTIQRVKETSAGMDFGFTQDPTTLICVAVDLANKELWLYNEHYQKAMLTDHIVKMIRD 317

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
                 +              ++L A+ + +G+  +        G   +  G+  M    
Sbjct: 318 KNLHRSYIAGDSAE-------KRLIAEIKSKGVSGIVASL---KGKGSIMQGVQFMQG-- 365

Query: 244 RSGRWKVF 251
               +K++
Sbjct: 366 ----FKIY 369


>gi|226949723|ref|YP_002804814.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           A2 str. Kyoto]
 gi|226843947|gb|ACO86613.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           A2 str. Kyoto]
          Length = 412

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/237 (12%), Positives = 68/237 (28%), Gaps = 26/237 (10%)

Query: 19  VWFDEEPPED--VYFEGLTRINATQ---GLVTLTLTPLKGRSPIIEHYLSASSSDRQVI- 72
           +W +E    +     +   R+         +TL+  P+     + E Y +    D+Q + 
Sbjct: 130 IWVEEATETEYKAVKQLDKRLRGRSEVTKRLTLSFNPILKDHWLFEEYFNIWEDDKQYVE 189

Query: 73  -------RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
                  + T  +     + +   + +    +  E  TKG   +    IF   +     +
Sbjct: 190 KNNVSILKTTYKDNKFLTDDDIAALENESDPYYYEVYTKGNWGVLGAVIFKNWKVKDFSD 249

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG 185
                +++       F    PFA     +++    +Y+                 +K   
Sbjct: 250 IEKTFDNYRHGVDWGFA-DDPFAYIKSHYDKTRKRLYICDEIEVVGMLNEESAPLVKEKA 308

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                      +  D    + ++        K+     +   G   +E GI  +   
Sbjct: 309 G-------SSRVTCDSAEPKSVAEYK-----KLRVNAKSAKKGPGSIEYGIKFLQGL 353


>gi|218290759|ref|ZP_03494841.1| protein of unknown function DUF264 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239297|gb|EED06496.1| protein of unknown function DUF264 [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 422

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 83/248 (33%), Gaps = 14/248 (5%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPII 58
            ++ E   D  +   + ++  DE    P++ +   L    + +    + ++  KGR+   
Sbjct: 111 FRSTE-NFDALRGEGLDFLVVDEAAMVPKEAWEAALRPTLSDKAGRAIIVSTPKGRNWFY 169

Query: 59  EHY---LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIF 115
             +      +  + +  R      P+   +E +    + P        + E +  S  +F
Sbjct: 170 HVWARGQDPAFPEWESFRFPTLANPYIPPEEVEEARTTLPSDVFRQEYEAEFLEDSAGVF 229

Query: 116 PIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPI 175
             + + I     +       + G D   H  F+   ++   D +  +VVK  R  +    
Sbjct: 230 RGIRDCISGQEEEPQPGRRYVVGWDVAKHQDFSVLVVM---DLERAHVVKMDRFNQVD-- 284

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHD-KRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              A      K +   + +  L  D    G+ L  Q RR G++      +       +E 
Sbjct: 285 --YALQLERVKHICQRYNNARLLMDATGVGDPLLEQVRRMGIQAEGYSLSNTAKQQLIEH 342

Query: 235 GISDMLDR 242
               +  R
Sbjct: 343 LAMKIERR 350


>gi|328910568|gb|AEB62164.1| phage terminase, large subunit, pbsx family [Bacillus
           amyloliquefaciens LL3]
          Length = 373

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/262 (13%), Positives = 80/262 (30%), Gaps = 30/262 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDEEPPEDVYFE------GLTRINATQGLVTLTL- 48
            +  +    K +S  +      ++W +E     +  E       + R     GL      
Sbjct: 59  FRGAD-DPAKIKSLKIAKFPVAFLWVEELAEFKLEEEISMIENSVLRAELPDGLFYAFYY 117

Query: 49  ---TPLKGRSPIIEHYLSASSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK 104
               P + +S + + Y S+    +  +   T  E P+ ++  ++        +  + R +
Sbjct: 118 SYNPPKRKQSWVNKKYESSFVPKNTYIHHSTYLENPYISKAFKEEAEIVKERNPLKYRWE 177

Query: 105 GEPILGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
                    + P     I    I    +        G+DFG+   P A     +++  + 
Sbjct: 178 YLGEALGSGVVPFDNLKIENGCITDEMVRSFDNIRQGVDFGYGPDPLAYVRWHYDKKRNS 237

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IY +     ++ +       ++S G              D    + +       G++   
Sbjct: 238 IYAIDELYDQKVSNRELAKWIRSKGYESQEI------TADSAEPKSIDELKIDHGIR--- 288

Query: 221 ECATFDDGSNGVEAGISDMLDR 242
                  G + V+ G   + D 
Sbjct: 289 RITGAKKGPDSVQYGEEWLDDL 310


>gi|330004400|ref|ZP_08304921.1| phage terminase, large subunit, PBSX family [Klebsiella sp. MS
           92-3]
 gi|328536646|gb|EGF62969.1| phage terminase, large subunit, PBSX family [Klebsiella sp. MS
           92-3]
          Length = 418

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/255 (10%), Positives = 74/255 (29%), Gaps = 14/255 (5%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
            D  +   +++V  DE  +   D +++ L    ++     L +   KG S   + ++   
Sbjct: 110 PDTLRGVALNFVVLDEFQDMKPDTWYKVLRPTLSSTRGGALIIGTPKGFSEFHKLFMIGQ 169

Query: 66  SSD------RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE 119
           + +       +  +    ++P   + E +   +                  SGR++   +
Sbjct: 170 NPEMQAKGLWKSWQFVTADSPFVPDSEIEAAKNDMDPKSFAQEYLASFENMSGRVYYPFD 229

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
            ++ +  L          G DF      +    +  + +  ++ +               
Sbjct: 230 RNVHVRPLQFNPRLPIWVGQDFNIDPMSSVI--LQPQPNGEVWAIDEVVLFSSNTSEVCD 287

Query: 180 ALKSW----GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            L+         +       G       GE     ++ +G   +         ++ V A 
Sbjct: 288 ELERRYWRQKSQVTVFPDPAGAYRQHARGESDVDIFKEKGFMRVDHPKKHPPIADRVNAV 347

Query: 236 ISDMLDRMRSGRWKV 250
              +L      R  +
Sbjct: 348 NRLLLTASGDVRLYI 362


>gi|291334706|gb|ADD94352.1| hypothetical protein Ddes_0719 [uncultured phage
           MedDCM-OCT-S04-C890]
          Length = 311

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/247 (11%), Positives = 72/247 (29%), Gaps = 18/247 (7%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
             D  +   +     DE    D  ++ E +   ++  +G      TP    +   + Y  
Sbjct: 61  NSDGLRGIYLDGCVIDEYANIDGKLFAEIIRPALSDRKGYCVFIGTPAGMNNNFYDLYQH 120

Query: 64  -ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGS-----GRIFPI 117
              + D    +   ++T   + +E ++  +     +     + + I        G     
Sbjct: 121 ANGAEDWFNYKAKASDTKIVDPEELEKAKEVMGEKKYLQEFECDWIANIEGAIYGEEIAK 180

Query: 118 VEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH 177
           +E+   I  +            D G     +       +    + ++  +  R      +
Sbjct: 181 IEDKNQIARVPYDPTLPVSTAWDLGVADHSSIIFF--QQKGTGVQIIDYHEERGHGLPHY 238

Query: 178 VAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGI 236
           +  L+     +     PHD    +  +G+       + G++              VE GI
Sbjct: 239 IQMLEEKPYIYKDHFAPHDIDVQEFGNGKTRREIAYQLGVRFKVVPKLP------VEEGI 292

Query: 237 SDMLDRM 243
             +   +
Sbjct: 293 HAVTMLI 299


>gi|71903662|ref|YP_280465.1| terminase large subunit [Streptococcus pyogenes MGAS6180]
 gi|71802757|gb|AAX72110.1| terminase large subunit [Streptococcus pyogenes MGAS6180]
          Length = 437

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 83/270 (30%), Gaps = 36/270 (13%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 119 FRGLD-DELKITSITVDVGLLCWAWFEEAYQIETEDKFSTVVESIRGSLDAPDFFKQITV 177

Query: 47  TLTPLKGRSPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +    +   D      T       ++ +++R  D Y  + R AR  
Sbjct: 178 TFNPWSERHWLKRVFFDEETKRADTFSGTTTFRVNEWLDDVDKRRYEDLYKTNPRRARIV 237

Query: 104 -KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVI 161
             GE  +  G +F   E         I        GMDFG+   P     +  +  +  +
Sbjct: 238 CDGEWGVAEGLVFDNFEVVDFDVEKTIQRVKETSAGMDFGFTQDPTTLICVAVDLVNKEL 297

Query: 162 YVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
           ++   +  +       V  ++       +              ++L A+ + +G+  +  
Sbjct: 298 WLYNEHYQKAMLTDHIVKMIRDKNMHKSYIAADSAE-------KRLIAEIKSKGVSGIVA 350

Query: 222 CATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
                 G   +  G+  M        +K++
Sbjct: 351 SL---KGKGSIMQGVQFMQG------FKIY 371


>gi|281416362|ref|YP_003347496.1| terminase large subunit [Enterococcus phage phiFL1A]
 gi|270209192|gb|ACZ63738.1| terminase large subunit [Enterococcus phage phiFL1A]
 gi|270209254|gb|ACZ63799.1| terminase large subunit [Enterococcus phage phiFL1B]
 gi|270209324|gb|ACZ63868.1| terminase large subunit [Enterococcus phage phiFL1C]
          Length = 413

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/248 (16%), Positives = 89/248 (35%), Gaps = 16/248 (6%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
           G    +  T +  + +E     ++V+ E ++R +AT   +     P      + + Y+  
Sbjct: 116 GVGSIRGMTAYGAYINEASLAKQEVFAEIVSRCSATGARILADTNPDNPEHWLKKEYIDN 175

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVE-EDI 122
           SS   Q     +++    +E+ R  I  S P     +   KG  +   G ++   +    
Sbjct: 176 SSKSIQSFHFGLDDNTFLSERYRTNIKASTPSGMFYDRDIKGLWVSADGVVYKDFDANKH 235

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
            I+S D+P       G+D+G+ H  +   +    D    Y+V+ +  + +   + V   K
Sbjct: 236 YIDSSDLPPLAKYYCGVDWGYDHWGSIVVIGETEDG-TAYLVEEHASQYEEIDYWVGIAK 294

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                     P      D    E +S        + + E     +      +G+  +  R
Sbjct: 295 EIQARYGGRIP---FYCDSARPEHVS--------RFVREGLNAINAFKARLSGVESVAKR 343

Query: 243 MRSGRWKV 250
            ++ R  +
Sbjct: 344 FKTNRLYI 351


>gi|291336431|gb|ADD95986.1| hypothetical protein Ddes_0719 [uncultured organism
           MedDCM-OCT-S04-C1073]
          Length = 311

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/247 (11%), Positives = 72/247 (29%), Gaps = 18/247 (7%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
             D  +   +     DE    D  ++ E +   ++  +G      TP    +   + Y  
Sbjct: 61  NSDGLRGIYLDGCVIDEYANIDGKLFAEIIRPALSDRKGYCVFIGTPAGMNNNFYDLYQH 120

Query: 64  -ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGS-----GRIFPI 117
              + D    +   ++T   + +E ++  +     +     + + I        G     
Sbjct: 121 ANGAEDWFNYKAKASDTKIVDPEELEKAKEVMGEKKYLQEFECDWIANIEGAIYGEEIAK 180

Query: 118 VEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH 177
           +E+   I  +            D G     +       +    + ++  +  R      +
Sbjct: 181 IEDKNQIARVPYDPTLPVSTAWDLGVADHSSIIFF--QQKGTGVQIIDYHEERGHGLPHY 238

Query: 178 VAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGI 236
           +  L+     +     PHD    +  +G+       + G++              VE GI
Sbjct: 239 IQMLEEKPYIYKDHFAPHDIDVQEFGNGKTRREIAYQLGVRFKVVPKLP------VEEGI 292

Query: 237 SDMLDRM 243
             +   +
Sbjct: 293 HAVTMLI 299


>gi|293374297|ref|ZP_06620625.1| phage terminase, large subunit, PBSX family [Turicibacter sanguinis
           PC909]
 gi|292647130|gb|EFF65112.1| phage terminase, large subunit, PBSX family [Turicibacter sanguinis
           PC909]
          Length = 418

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/251 (16%), Positives = 83/251 (33%), Gaps = 28/251 (11%)

Query: 7   GRDKWQSNTVHYV---WFDE--EPPEDVYFEGLTRINA--TQGLVTLTLTPLKGRSPIIE 59
             +K    +++ V   + +E  E P+++  +   R+ A      +     P+     +  
Sbjct: 112 DEEKL--LSINGVTDFFIEEIFEVPQEIVDQIDLRLRAKAPYLQIYGCFNPISPHHWLHG 169

Query: 60  HYLSASSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIF--- 115
                    D    R    + P   +     +      +  + R   E   G+       
Sbjct: 170 FCEGDKQPADLFYDRSNYKDNPFLPQSYVDSLESLKTRNPNKYRIFAEGNWGTDLDGLVF 229

Query: 116 ----PIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                I   DI +N++   + W    GMD G   P A    ++N  +  +Y++K +  R 
Sbjct: 230 KHINFINSHDIDVNAMLKDKSWQVRCGMDIGELDPTAIAVSLFNERTQALYLIKEFYQRG 289

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
            T      A+ + G      +             Q+ +  + +G+   P       G+  
Sbjct: 290 ATLDEMYEAIINLGIQKQKIYVDSA-------SPQVISYLKSKGINAQPCI----KGAGS 338

Query: 232 VEAGISDMLDR 242
           VEA IS + + 
Sbjct: 339 VEARISYLQNL 349


>gi|221316961|ref|YP_002533105.1| putative terminase large subunit - phage associated [Bacillus
           cereus Q1]
 gi|221243293|gb|ACM16001.1| putative terminase large subunit - phage associated [Bacillus
           cereus Q1]
          Length = 425

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/261 (14%), Positives = 85/261 (32%), Gaps = 30/261 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDEEPPE------DVYFEGLTRINATQG---LVTL 46
            +  +    K +S  +        WF+E              + + R     G    +  
Sbjct: 109 FRGAD-DPAKIKSIKIAKYPVAIAWFEELAEFKLEEDVSTIEKSILRKELPNGLRYKMYY 167

Query: 47  TLTPL-KGRSPIIEHYLSASSS-DRQVIRMTINETPHYNEQERKRIIDSY--PLHEREAR 102
           +  P  + +S + + + +     +  V   T ++ PH ++Q  +   ++      + E  
Sbjct: 168 SYNPPKRKQSWVNKKFETQFKPKNTFVHHSTYHDNPHISKQFVEEAEETKRLKPQQYEHE 227

Query: 103 TKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPF-AAGHLVWNRDSDVI 161
            +G+P  GSG +         I   +I        G+D+G+ +   + G + +++    +
Sbjct: 228 YEGKP-TGSGVVPFSNLTFRRITDEEIKTFDNIRQGIDWGYGNDALSFGRMHYDKTRRKL 286

Query: 162 YVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
           Y+       + +       +K  G      W    +  D    + +       G+K    
Sbjct: 287 YIFGEIHGVKISNRSLAEKIKQLG------WDDVEIIADSSEPKSIDEMKNDHGIK---R 337

Query: 222 CATFDDGSNGVEAGISDMLDR 242
                 G   VE G   + D 
Sbjct: 338 IKGAVKGPGSVEYGEKWLDDL 358


>gi|307270085|ref|ZP_07551405.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX4248]
 gi|306513580|gb|EFM82192.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX4248]
          Length = 425

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/258 (14%), Positives = 76/258 (29%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L              +  P
Sbjct: 114 AQNPERIKSLKDSRFPFAIGWIEELGEFKTEDEVTTITNSLLRGELGDGLFYKFFFSYNP 173

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y S+   D   V   T  + P  + +  K +  +   +   AR + +  
Sbjct: 174 PKRRQSWVNKKYESSFQPDNTFVHHSTYKDNPFISREFLKEVEAARDRNPLRARWEYDGE 233

Query: 109 LGSGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P      E   I    +        G+DFG+   P A     +++  + IY V
Sbjct: 234 AIGSGVVPFSNLKVEKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAV 293

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        K+ G      +  D +  D    + ++      G   +     
Sbjct: 294 DEIYGVKISNREFAQKAKAKG------YQSDRIASDSAEPKSIAELNNEHG---MGHVFG 344

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 345 VKKGPDSVEYGEQWLDDL 362


>gi|257066327|ref|YP_003152583.1| phage terminase, large subunit, PBSX family [Anaerococcus prevotii
           DSM 20548]
 gi|256798207|gb|ACV28862.1| phage terminase, large subunit, PBSX family [Anaerococcus prevotii
           DSM 20548]
          Length = 412

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/249 (15%), Positives = 82/249 (32%), Gaps = 17/249 (6%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
           G  + +  T +  + +E     E V+ E  +R +     +     P      + + Y+  
Sbjct: 117 GLGRIRGMTSYGAYVNEASLANELVFDEIRSRCSGKGARIICDTNPDNPEHWLKKEYIDN 176

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPIVEED-I 122
            +      + TI +    +++  +  ID+ P     E    G  + G G ++   +    
Sbjct: 177 PTDRILSYKFTIFDNTFLDKRYLQSTIDTTPDGMFTERNIYGNWVSGEGVVYKGFDPKRH 236

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
            + SLD       I G+D+G+ H  +      + D    Y+++ +  + Q   F VA  K
Sbjct: 237 YVKSLDGIRFSSYIAGVDWGYGHYGSIVVFGISNDG-KYYMIEEHAEQYQEIDFWVAVAK 295

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                            D    E +         +   E          V  GI  +   
Sbjct: 296 DIANRYKGIV----FYCDSARVEHID--------RFSREGLVAYMADKAVIPGIEAVSIL 343

Query: 243 MRSGRWKVF 251
            ++ +  ++
Sbjct: 344 YKTDKLFIY 352


>gi|273809729|ref|YP_003344848.1| terminase large subunit [Streptococcus phage ALQ13.2]
 gi|224812481|gb|ACN64874.1| terminase large subunit [Streptococcus phage ALQ13.2]
          Length = 411

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/248 (13%), Positives = 82/248 (33%), Gaps = 17/248 (6%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G  + +  T    + +E     E V+ E ++R +     +     P      +   Y+ 
Sbjct: 115 SGLKRARGFTAFGAYVNEASLANEIVFKEIISRCSGEGARIVWDSNPDNPNHWLNRDYIG 174

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEEDI 122
            +          +++    +++  + I  + P     +    G   +  G I+   +  I
Sbjct: 175 KNDGKIIDFSFKLDDNTFLSKRYIESIKAATPKGKFYDRDILGRWTVAEGAIYADYDSKI 234

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
            +   ++P+     GG+D+G+ H  +   +    D +  Y+V     + +   + V   +
Sbjct: 235 HVVD-ELPDMKRYFGGIDWGYTHYGSIVVVGEGVDGN-YYLVDGVAAQFKEIDWWVEQTR 292

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                    + +     D    E ++        +   E     + +  V AGI  +   
Sbjct: 293 KLT----GIYGNIPFYADSARPEHVA--------RFESEGFDISNANKSVMAGIELIAKL 340

Query: 243 MRSGRWKV 250
            +  +  V
Sbjct: 341 FKEQKLYV 348


>gi|314938435|ref|ZP_07845725.1| phage terminase, large subunit, PBSX family [Enterococcus faecium
           TX0133a04]
 gi|314940850|ref|ZP_07847760.1| phage terminase, large subunit, PBSX family [Enterococcus faecium
           TX0133C]
 gi|314953782|ref|ZP_07856647.1| phage terminase, large subunit, PBSX family [Enterococcus faecium
           TX0133A]
 gi|314994570|ref|ZP_07859832.1| phage terminase, large subunit, PBSX family [Enterococcus faecium
           TX0133B]
 gi|314997239|ref|ZP_07862219.1| phage terminase, large subunit, PBSX family [Enterococcus faecium
           TX0133a01]
 gi|313588686|gb|EFR67531.1| phage terminase, large subunit, PBSX family [Enterococcus faecium
           TX0133a01]
 gi|313591038|gb|EFR69883.1| phage terminase, large subunit, PBSX family [Enterococcus faecium
           TX0133B]
 gi|313594222|gb|EFR73067.1| phage terminase, large subunit, PBSX family [Enterococcus faecium
           TX0133A]
 gi|313600298|gb|EFR79141.1| phage terminase, large subunit, PBSX family [Enterococcus faecium
           TX0133C]
 gi|313642244|gb|EFS06824.1| phage terminase, large subunit, PBSX family [Enterococcus faecium
           TX0133a04]
          Length = 434

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 76/258 (29%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L              +  P
Sbjct: 113 AQNPERIKSLKDSKFPFAIGWIEELAEFKTEDEVTTITNSLLRGELDDGLFYKFFYSYNP 172

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y ++   D   +   T  + P  +++  K +  +   + R A  + +  
Sbjct: 173 PKRKQSWVNKKYETSFQPDNTFIHHSTYRDNPFISKEFLKEVEATRASNPRRAEWEYDGK 232

Query: 109 LGSGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P      +   I    I        G+D+G+   P A     +++  + IY +
Sbjct: 233 AVGSGVVPFDNLQVKKGSITDEMISNFDNIRNGLDYGYATDPLAFVRWHYDKKKNGIYAI 292

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +       D    +  +      GMK +     
Sbjct: 293 DEIYGVKISNREFANKAKSKGYQNEEIFS------DSAEPKSNAELVNEHGMKGI---KG 343

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 344 VKKGPDSVEYGEQWLDDL 361


>gi|237746327|ref|ZP_04576807.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229377678|gb|EEO27769.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 489

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/288 (12%), Positives = 79/288 (27%), Gaps = 44/288 (15%)

Query: 3   AYEQGRDKWQSNTVHYVWFDEEPPE---DVYFEGLTRINATQGL----VTLTLTPLKGRS 55
           A E     +  +   ++ F+E         +   ++   ++       +  T  P     
Sbjct: 135 ATEDDYWNYHGHEYPWLGFEELTNWRNLSFFEAMMSTCRSSYPGMPRMIRATCNPFGVGH 194

Query: 56  PIIEHYLS------------ASSSDRQVIRMTINETPH---YNEQERKRIIDSYPLHERE 100
             ++                     R  I  +I E  H    +      +      + ++
Sbjct: 195 AAVKARYRIGEVSAGVIIHEPGQQPRVRIHSSIYENDHLLKNDPDYLPTLEAISDPNRKK 254

Query: 101 ARTKGEPILGSGRIFPIVEE--DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDS 158
           A   G+  +  G     V +    V     IP  W     MD+G+  P+A      N D 
Sbjct: 255 AWLNGDWDIHVGSFLEGVWDAAKHVTEPFAIPPSWTVWKAMDWGYAAPYAVYWFAMNPDG 314

Query: 159 DVIYVVKNYRCREQT--------PIFHVAALKSW-------GKWLPWAWPHDGLQHDKRS 203
             IY+ +      +                +K         G           +     +
Sbjct: 315 -CIYLWRELYGAGEKAGQGSREDAADVARKIKKMEERDERFGYDYRINLADPSIFSKNGT 373

Query: 204 GEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
              +   +R +G++         +       G  +++  +  G+ K+F
Sbjct: 374 DRSIGQIFRDEGIRWQEAW----NAKGSRVNGAQEIIRLLAEGKLKIF 417


>gi|212703351|ref|ZP_03311479.1| hypothetical protein DESPIG_01394 [Desulfovibrio piger ATCC 29098]
 gi|212673197|gb|EEB33680.1| hypothetical protein DESPIG_01394 [Desulfovibrio piger ATCC 29098]
          Length = 509

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/265 (10%), Positives = 67/265 (25%), Gaps = 35/265 (13%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
                +   +  +  DE    P +V+ + L   +   +G      TP    + + + +  
Sbjct: 117 NAQALRGLYLDDLVLDEPADIPREVWSQILRPALADRRGRALFCGTPKGCDNLLHDVWQL 176

Query: 64  A----SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE 119
           A    ++      R   ++T +  + E           E +   +          +   +
Sbjct: 177 AGSLGAAEGWSRFRFPASQTGYLPQAELDAARSGMSEAEYQQEFECSFAAAVRGAYYAAQ 236

Query: 120 EDIVI-----NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
            D          L +          D G     A              ++  Y    +  
Sbjct: 237 LDAADLAGRICPLPVSPDLPVHTAWDLGMDDATAIWFFQVEPSG-TWRMLDYYEASGEGL 295

Query: 175 IFHVAALKSWGK----------------WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKM 218
             + A L +  +                +     PHD    +  +G+       R G++ 
Sbjct: 296 AHYAAVLGAKARPEGTATTDGLAGRGFCYGRHLAPHDIRVRELGTGQSRLESAARLGIRF 355

Query: 219 LPECATFDDGSNGVEAGISDMLDRM 243
               +           GI  +   +
Sbjct: 356 DIAPSLPLA------DGIDAVRRAL 374


>gi|319891867|ref|YP_004148742.1| Phage terminase, large subunit [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161563|gb|ADV05106.1| Phage terminase, large subunit [Staphylococcus pseudintermedius
           HKU10-03]
          Length = 424

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/270 (13%), Positives = 87/270 (32%), Gaps = 37/270 (13%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDEEPPEDVYF------EGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E    + +       E +            +T+
Sbjct: 107 FRGLD-DPLKITSITVDVGILCWAWFEEAYQIENFDKFSTVVESIRGSLDEPEFFKQITV 165

Query: 47  TLTPLKGRSPIIEHYLSASS--SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +    +   +      T       ++ +  R  D Y  + R AR  
Sbjct: 166 TFNPWSERHWLKPTFFDEDTRLKNVYSNTTTFRVNEWLDKVDVDRYEDLYRTNPRRARIV 225

Query: 104 -KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVI 161
             GE  +  G ++     +         +   ++ G+D+G+   P A    V + D+ ++
Sbjct: 226 CDGEWGVAEGLVYDNFVVEDFDWFQIYKKTQFKVHGIDYGFTNDPTALVSAVVDLDNKIL 285

Query: 162 YVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
           ++   +  +          +             +  +    +  ++ A+ + +G+K    
Sbjct: 286 WLYDEHYEKGMLSDDIYKMIVKKD--------LETAEIKSENDMRMIAELKNKGVK---R 334

Query: 222 CATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
                 G + +  GI  +        +K++
Sbjct: 335 IVPAVKGPHSIMPGIQYVQG------FKIY 358


>gi|28377533|ref|NP_784425.1| prophage Lp1 protein 38 [Lactobacillus plantarum WCFS1]
 gi|28270365|emb|CAD63266.1| prophage Lp1 protein 38 [Lactobacillus plantarum WCFS1]
          Length = 428

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 79/235 (33%), Gaps = 23/235 (9%)

Query: 18  YVWFDEEPPEDVYFEGLTRINATQG-------LVTLTLTPLKGRSPIIEHYLSASSSDRQ 70
           ++W +E    + + +  T I + +G        VTLT  P      +   +      D  
Sbjct: 128 WLWVEEAYEIESFSKLQTVIESLRGNDPQVFYQVTLTFNPWNEHHWLKREFFDQPRDDTF 187

Query: 71  VIRMTINETPHYNEQERKRIIDSYPLHEREAR--TKGEPILGSGRIFPIVEEDIVINSLD 128
           V   T+      +++ ++R+   Y  + R A+    GE  +  G +F    E I  N++D
Sbjct: 188 VRTTTVRCNEFVSDEYKQRLYSLYQTNPRRAKTVVDGEWGVAEGLVFEDNIEQIEFNAMD 247

Query: 129 -IPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
            I E      G+D+G+   P A   +  +  +  ++V        QT       LK  G 
Sbjct: 248 KIQECGQTGFGLDYGFSNDPNAFVAVAVDVRNKQLWVYNEMYTYHQTTPHIAEWLKVNGY 307

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
                +                 Q    G+               VEAGI  +  
Sbjct: 308 ERARIYADSANSERTA-------QLNDLGI-----TNADSVVKTPVEAGIDQLWQ 350


>gi|209559980|ref|YP_002286452.1| Large terminase [Streptococcus pyogenes NZ131]
 gi|209541181|gb|ACI61757.1| Large terminase [Streptococcus pyogenes NZ131]
          Length = 429

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 83/270 (30%), Gaps = 36/270 (13%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 111 FRGLD-DELKITSITVDVGLLCWAWFEEAYQIETEDKFSTVVESIRGSLDAPDFFKQITV 169

Query: 47  TLTPLKGRSPIIEHYLSASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +    +   D      T       ++ +++R  D Y  + R AR  
Sbjct: 170 TFNPWSERHWLKRVFFDEETKRADTFSGTTTFRVNEWLDDVDKRRYEDLYKTNPRRARIV 229

Query: 104 -KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVI 161
             GE  +  G +F   E         I        GMDFG+   P     +  +  +  +
Sbjct: 230 CDGEWGVAEGLVFDNFEVVDFDVEKTIQRVKETSAGMDFGFTQDPTTLICVAVDLINKEL 289

Query: 162 YVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
           ++   +  +       V  ++       +              ++L A+ + +G+  +  
Sbjct: 290 WLYNEHYQKAMLTDHIVKMIRDKNMHKSYIAADSAE-------KRLIAEIKSKGVSGIVA 342

Query: 222 CATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
                 G   +  G+  M        +K++
Sbjct: 343 SL---KGKGSIMQGVQFMQG------FKIY 363


>gi|257885123|ref|ZP_05664776.1| terminase large subunit [Enterococcus faecium 1,231,501]
 gi|257820975|gb|EEV48109.1| terminase large subunit [Enterococcus faecium 1,231,501]
          Length = 432

 Score =  102 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 79/258 (30%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L              +  P
Sbjct: 111 AQNPERIKSLKDSKFPFAIGWIEELAEFKTEDEVTTITNSLLRGELDDGLFYKFFYSYNP 170

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y ++   D   +   T  + P  +++  K +  +   + R A  + +  
Sbjct: 171 PKRKQSWVNKKYETSFQPDNTFIHHSTYQDNPFISKEFLKEVEATRERNPRRAEWEYDGK 230

Query: 109 LGSGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P      +   I+   +        G+DFG+   P A     +++  + IY +
Sbjct: 231 AVGSGVVPFDNLQVKKGSISDEMVSNFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 290

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +       + + G W       D ++ D    + ++      G   +     
Sbjct: 291 DEIYGVKISNREFANKVHAKGYW------ADEIRADSAEPKSIAELNNEHG---MTRVFG 341

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 342 VKKGPDSVEYGEQWLDDL 359


>gi|256961403|ref|ZP_05565574.1| terminase large subunit [Enterococcus faecalis Merz96]
 gi|256951899|gb|EEU68531.1| terminase large subunit [Enterococcus faecalis Merz96]
          Length = 432

 Score =  102 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 72/258 (27%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 111 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 170

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 171 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 230

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I    +        G+DFG+   P A     +++  + IY +
Sbjct: 231 AIGSGVVPFDNLRVIKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 290

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +       L   G      + +D +  D    +  +      G+        
Sbjct: 291 DEIYGVKISNRELAKKLHEKG------YQNDEIFSDSAEPKSNAELVNEHGIN---HIKG 341

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 342 VKKGPDSVEYGEQWLDDL 359


>gi|293383713|ref|ZP_06629621.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           R712]
 gi|293387092|ref|ZP_06631657.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           S613]
 gi|312906241|ref|ZP_07765253.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           DAPTO 512]
 gi|312909587|ref|ZP_07768442.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           DAPTO 516]
 gi|291078949|gb|EFE16313.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           R712]
 gi|291083496|gb|EFE20459.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           S613]
 gi|310627887|gb|EFQ11170.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           DAPTO 512]
 gi|311290260|gb|EFQ68816.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           DAPTO 516]
          Length = 439

 Score =  102 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 72/258 (27%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 118 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 177

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 178 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 237

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I    +        G+DFG+   P A     +++  + IY +
Sbjct: 238 AIGSGVVPFDNLRVIKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 297

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +       L   G      + +D +  D    +  +      G+        
Sbjct: 298 DEIYGVKISNRELAKKLHEKG------YQNDEIFSDSAEPKSNAELVNEHGIN---HIKG 348

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 349 VKKGPDSVEYGEQWLDDL 366


>gi|321314299|ref|YP_004206586.1| PBSX family phage terminase large subunit [Bacillus subtilis BSn5]
 gi|320020573|gb|ADV95559.1| PBSX family phage terminase large subunit [Bacillus subtilis BSn5]
          Length = 402

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/259 (11%), Positives = 79/259 (30%), Gaps = 28/259 (10%)

Query: 7   GRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
              K +  T    + +E     +    E ++R +    +V +   P      +   Y+  
Sbjct: 105 SWKKARGFTSAGAFLNEATALHDSFVKEVISRCSYRGAMVMMDTNPENPMHTVKTDYIDK 164

Query: 65  SSS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFP 116
                     + +    ++ +    + +  + I+ S P     +    G  +   G I+ 
Sbjct: 165 DGQRLKNGRLNIRSFHFSLFDNNFLDPEYVESIVASTPSGMFTDRDIYGYWVAPEGVIYK 224

Query: 117 IVEEDIVI-----NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
              +D                     G+D+G+ HP +   +  + D    Y+++ +  + 
Sbjct: 225 DFNKDKHYISSKETENKQVNFTKYFAGVDWGYEHPGSIVVIGQD-DQGCFYLLEEHCKQH 283

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
           +   + V   K     +   + +     D    E +        ++   E     D    
Sbjct: 284 EEIDYWVKVAK----DIKERYGNINFYCDTARPEHI--------VRFRREKLRALDADKA 331

Query: 232 VEAGISDMLDRMRSGRWKV 250
           V +GI ++    +     +
Sbjct: 332 VVSGIEEVARLFKRDLLFI 350


>gi|23455873|ref|NP_695104.1| hypothetical protein O1205p26 [Streptococcus phage O1205]
 gi|2444105|gb|AAC79541.1| ORF26 [Streptococcus phage O1205]
          Length = 411

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/248 (14%), Positives = 82/248 (33%), Gaps = 17/248 (6%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G  + +  T    + +E     E V+ E ++R +     V     P      +   Y+ 
Sbjct: 115 SGLKRARGFTAFGAYVNEASLANELVFKEIISRCSGDGARVVWDSNPDNPNHWLNRDYIG 174

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEEDI 122
            +          +++    +++    I  + P     +    G   +  G I+   +  I
Sbjct: 175 KNDGKIIDFSFKLDDNTFLSKRYIDSIKAATPKGKFYDRDILGLWTVAEGAIYADYDSKI 234

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
            +   ++PE     GG+D+G+ H  +   +    D++  Y+V     + +   + V   +
Sbjct: 235 HVVD-ELPEMKRYFGGIDWGYTHYGSIVIVGEGVDNN-FYLVDGVAAQFKEIDWWVEQAR 292

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                    + +     D    E ++        +   E     + +  V AGI  +   
Sbjct: 293 KLT----GIYGNIPFYADSARPEHVA--------RFENEGFDIMNANKSVIAGIELIAKL 340

Query: 243 MRSGRWKV 250
            +  +  V
Sbjct: 341 FKEKKLYV 348


>gi|315173781|gb|EFU17798.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX1346]
          Length = 439

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 72/258 (27%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 118 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 177

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 178 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 237

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I    +        G+DFG+   P A     +++  + IY +
Sbjct: 238 AIGSGVVPFDNLRVIKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 297

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +       L   G      + +D +  D    +  +      G+        
Sbjct: 298 DEIYGVKISNRELAKKLHEKG------YQNDEIFSDSAEPKSNAELVNEHGIN---HIKG 348

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 349 VKKGPDSVEYGEQWLDDL 366


>gi|62327097|ref|YP_223885.1| putative large subunit terminase [Lactobacillus phage phiJL-1]
 gi|37930114|gb|AAP74512.1| putative large subunit terminase [Lactobacillus phage phiJL-1]
          Length = 440

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/245 (17%), Positives = 78/245 (31%), Gaps = 29/245 (11%)

Query: 20  WFDEEPP------EDVYFEGLTRINATQG--LVTLTLTPLKGRSPIIEHYLSASSSDRQV 71
           W +E          D   E +       G     +T  P   R  +   +    +     
Sbjct: 142 WCEEAYELKSLDAFDTVEESMRGELPPGGFYQTVITFNPWSDRHWLKHEFFDDKTKRNHS 201

Query: 72  --IRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVINSL 127
             I  T  +  H N      + +    +   AR    GE  +  G +F  + E    +  
Sbjct: 202 RAITTTYKDNDHLNADYVDSLKEMLVRNPNRARVAVLGEWGIAEGLVFDGLFEQRDFSYD 261

Query: 128 DIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL-KSWG 185
           +I  +  +  G+DFG+ H P A   +  ++D+ ++Y+   +  +          L K   
Sbjct: 262 EIA-NLPKSVGLDFGFKHDPTAGEFIAVDQDNRIVYIYDEFYKQHLLTNQIAQELAKHKA 320

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRS 245
             LP          D      +    ++  +   P       G + V  GI      M+S
Sbjct: 321 FGLPI-------TADSAEQRMIVELSQQHRV---PNIKPSGKGKDSVIQGIQY----MQS 366

Query: 246 GRWKV 250
            R+ V
Sbjct: 367 YRFVV 371


>gi|266625996|ref|ZP_06118931.1| phage terminase large subunit [Clostridium hathewayi DSM 13479]
 gi|288862104|gb|EFC94402.1| phage terminase large subunit [Clostridium hathewayi DSM 13479]
          Length = 270

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 59/170 (34%), Gaps = 8/170 (4%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T+  V+FDE    PE    +   R +           P         ++L
Sbjct: 102 ESSQDLIQGITLAGVFFDEVALMPESFVNQATGRCSVDGSKYWFNCNPDGPYHWFKLNWL 161

Query: 63  SASSSDRQVI-RMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +     ++   T+++    +E  ++R  + Y     +    G   +  G I+ +  ED
Sbjct: 162 DKAKEKNLLVLHFTMDDNLSLSEHIKERYRNMYTGVFFKRYILGLWAMAEGIIYDMFSED 221

Query: 122 IVINSLDIPEHW----VQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNY 167
             + ++           +   +D+G  +  A       RD    Y ++ Y
Sbjct: 222 RHVKTILEYARQLIDGGRYVSIDYGTQNATAFLLWNKGRDG-KWYCIREY 270


>gi|326790076|ref|YP_004307897.1| phage terminase, large subunit, PBSX family [Clostridium
           lentocellum DSM 5427]
 gi|326540840|gb|ADZ82699.1| phage terminase, large subunit, PBSX family [Clostridium
           lentocellum DSM 5427]
          Length = 412

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/236 (11%), Positives = 67/236 (28%), Gaps = 24/236 (10%)

Query: 21  FDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS----DRQVIRMTI 76
            DE    D       R       +     P+   + + +++          +  V++ T 
Sbjct: 133 LDEVSQLD----LRLRAKVDNLQMYFAFNPVSKDNFVYKYFHRDDPDTTPSNMFVLKTTF 188

Query: 77  NETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQI 136
            +     +     ++     +    +   E    +        E    +  +  +  +  
Sbjct: 189 KDNKFLPQSYIDSLMAMKDSNPIYYKIYVEGDFATLDKLIFAYEIKDFDWREKLKTGIAC 248

Query: 137 GGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHD 195
            GMDFG+   P A    V N D   I++      +        A +      +   +  +
Sbjct: 249 FGMDFGYTNDPAAFSAFVVNEDQREIWIFDEIYKKGLLNNQLAAEI------IYHGFQKE 302

Query: 196 GLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
            +  D +  + +     + G+           G   V  GI  +        +K++
Sbjct: 303 VITADCQDQQSIDELRTQYGIS---RIKRSWKGKGSVLQGIQYIQQ------FKIY 349


>gi|9635008|ref|NP_056675.1| gp411 [Streptococcus phage Sfi11]
 gi|7523569|gb|AAF63072.1|AF158600_28 gp411 [Streptococcus phage Sfi11]
          Length = 411

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/248 (14%), Positives = 82/248 (33%), Gaps = 17/248 (6%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G  + +  T    + +E     E V+ E ++R +     V     P      +   Y+ 
Sbjct: 115 SGLKRARGFTAFGAYVNEASLANEFVFKEIISRCSGDGARVVWDSNPDNPNHWLNRDYIG 174

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEEDI 122
            +          +++    +++    I    P     +    G   +  G I+   +  I
Sbjct: 175 KNDGKIIDFSFKLDDNTFLSKRYIDSIKAVTPKGKFYDRDILGHWTVAEGAIYADYDSKI 234

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
            +   ++PE     GG+D+G+ H  +   +    D++  Y+V   R + +   + V   +
Sbjct: 235 HVVD-ELPEMKRYFGGIDWGYTHYGSIVIVGEGVDNN-FYLVDGVRAQFKEIDWWVEQAR 292

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                    + +     D    E ++        +   E     + +  V AGI  +   
Sbjct: 293 KLT----GIYGNIPFYADSARPEHVA--------RFENEGFDISNANKSVIAGIELIAKL 340

Query: 243 MRSGRWKV 250
            +  +  V
Sbjct: 341 FKEQKLYV 348


>gi|149912967|ref|ZP_01901501.1| Phage terminase, large subunit, PBSX [Roseobacter sp. AzwK-3b]
 gi|149813373|gb|EDM73199.1| Phage terminase, large subunit, PBSX [Roseobacter sp. AzwK-3b]
          Length = 467

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 47/284 (16%), Positives = 84/284 (29%), Gaps = 45/284 (15%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDV---YFEGLTRINATQGLVTLTLTPLK---GRSP 56
           +  R K++    +Y+ FDE    P DV   Y     R         +  T      G+  
Sbjct: 119 DADRLKYRGRAWNYIGFDELTLWPTDVCYLYLFSRCRSTDPTLPRLIRATTNPDGPGQGW 178

Query: 57  IIEHYLSASS--------------------SDRQVIRMTINETPHYNEQERKRIIDSYPL 96
           ++E +                         S R  I   ++E PH +E   +  +   P 
Sbjct: 179 VMERWGINEDGQATRVPIDTVDAEMRRITTSYRTFIPARLSENPHLSETGYREALLQLPP 238

Query: 97  HEREARTKGEP--ILGSGRIFPIVEEDIVI----NSLDIPEHWVQIGGMDFGWHHPFAAG 150
            ER+A   G        G  +     ++       S+            D GW+   A  
Sbjct: 239 DERDALLMGLWRQGRVHGAYYANEMAEMRNRGGIRSVPYDPSEPVNTFWDLGWNDTTAIW 298

Query: 151 HLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWL---PWAWPHDGLQHDKRSGEQL 207
                + +     ++ Y    ++   +   L++ G  +       PHD      ++G+  
Sbjct: 299 F--HQQIAGEHRFIRAYENSGESLDHYATYLQNSGFNVMGGRHYLPHDAQNKSLQTGKSA 356

Query: 208 SAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
               +     +             V  GI+     M   R KVF
Sbjct: 357 LEILQEMLPNL---HFEVVPRIQNVLTGINQTRLAM---RGKVF 394


>gi|148257070|ref|YP_001241655.1| putative phage terminase large subunit [Bradyrhizobium sp. BTAi1]
 gi|146409243|gb|ABQ37749.1| putative phage Terminase large subunit [Bradyrhizobium sp. BTAi1]
          Length = 428

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 71/234 (30%), Gaps = 14/234 (5%)

Query: 7   GRDKWQSNTVHYVWFDEEPPEDVYFEGLTR--INATQGLVTLTLTPLKGRSPIIEHYLSA 64
                +   +   W DE     V    L R  I A +  +  +  P +    + +   S 
Sbjct: 110 SIKSLEGFRI--AWIDEAQTLSVRSLSLLRPTIRAPRSELWASWNPRRKSDAVDDFLRSR 167

Query: 65  SSSDRQVIRMTINETPHYNE--QERKRIIDSYPLHEREARTKGEPILGSGRIFPIV---- 118
                 V++    + P       E +R+  +      E   +G+ +      +       
Sbjct: 168 KPDGAVVVKANWRDNPWLPAVLDEERRLDLALYPDRYEHIWEGDYVRAFEGAYFADLLAQ 227

Query: 119 ---EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPI 175
              E  I   + D          +        A    +     + + V+  Y    Q   
Sbjct: 228 ARREGRIGKVAADPLLPLRAFIDIGGAGASADAFTIWIVQWVGNEVRVLDYYEAVGQVLA 287

Query: 176 FHVAALKSWGKWLPWAW-PHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
           FHV  L++ G      + PHDGL  +  +G++ +   R  G  + P       G
Sbjct: 288 FHVNWLRARGYQNAILYLPHDGLATNAVTGKRYADHLREAGFAVEPPVKNQGRG 341


>gi|16082806|ref|NP_395360.1| hypothetical protein YPMT1.24c [Yersinia pestis CO92]
 gi|31795361|ref|NP_857813.1| hypothetical protein Y1030 [Yersinia pestis KIM]
 gi|40787951|ref|NP_857660.2| hypothetical protein YPKMT021 [Yersinia pestis KIM]
 gi|45478613|ref|NP_995469.1| hypothetical protein YP_pMT025 [Yersinia pestis biovar Microtus
           str. 91001]
 gi|52788073|ref|YP_093901.1| hypothetical protein pG8786_021 [Yersinia pestis]
 gi|108793557|ref|YP_636707.1| hypothetical protein YPA_MT0025 [Yersinia pestis Antiqua]
 gi|108793757|ref|YP_636595.1| hypothetical protein YPN_MT0025 [Yersinia pestis Nepal516]
 gi|145597216|ref|YP_001154679.1| hypothetical protein YPDSF_4052 [Yersinia pestis Pestoides F]
 gi|149192775|ref|YP_001294006.1| hypothetical protein YPE_4292 [Yersinia pestis CA88-4125]
 gi|162417876|ref|YP_001604588.1| hypothetical protein YpAngola_0076 [Yersinia pestis Angola]
 gi|165939469|ref|ZP_02228016.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166214433|ref|ZP_02240468.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167402343|ref|ZP_02307808.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422791|ref|ZP_02314544.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167466683|ref|ZP_02331387.1| hypothetical protein YpesF_02065 [Yersinia pestis FV-1]
 gi|229896952|ref|ZP_04512111.1| hypothetical protein YPS_4795 [Yersinia pestis Pestoides A]
 gi|229897756|ref|ZP_04512911.1| hypothetical protein YPH_4790 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229900293|ref|ZP_04515428.1| hypothetical protein YPF_4819 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229904817|ref|ZP_04519927.1| hypothetical protein YP516_4657 [Yersinia pestis Nepal516]
 gi|270491004|ref|ZP_06208077.1| phage terminase, large subunit, PBSX family [Yersinia pestis KIM
           D27]
 gi|294502015|ref|YP_003565752.1| hypothetical protein YPZ3_pMT0023 [Yersinia pestis Z176003]
 gi|3883031|gb|AAC82691.1| unknown [Yersinia pestis KIM 10]
 gi|5834709|emb|CAB55206.1| hypothetical protein YPMT1.24c [Yersinia pestis CO92]
 gi|45357266|gb|AAS58660.1| hypothetical protein YP_pMT025 [Yersinia pestis biovar Microtus
           str. 91001]
 gi|52538002|emb|CAG27427.1| hypothetical protein [Yersinia pestis]
 gi|108777821|gb|ABG20339.1| hypothetical protein YPN_MT0025 [Yersinia pestis Nepal516]
 gi|108782104|gb|ABG16161.1| hypothetical protein YPA_MT0025 [Yersinia pestis Antiqua]
 gi|145212984|gb|ABP42389.1| hypothetical protein YPDSF_4052 [Yersinia pestis Pestoides F]
 gi|148872433|gb|ABR14922.1| hypothetical protein YPMT1.24c [Yersinia pestis CA88-4125]
 gi|162350848|gb|ABX84797.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165912657|gb|EDR31287.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166204381|gb|EDR48861.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166958284|gb|EDR55305.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167048235|gb|EDR59643.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|229678132|gb|EEO74238.1| hypothetical protein YP516_4657 [Yersinia pestis Nepal516]
 gi|229686652|gb|EEO78733.1| hypothetical protein YPF_4819 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229693337|gb|EEO83387.1| hypothetical protein YPH_4790 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229699988|gb|EEO88028.1| hypothetical protein YPS_4795 [Yersinia pestis Pestoides A]
 gi|262363909|gb|ACY60628.1| hypothetical protein YPD4_pMT0023 [Yersinia pestis D106004]
 gi|262364065|gb|ACY64401.1| hypothetical protein YPD8_pMT0023 [Yersinia pestis D182038]
 gi|270334985|gb|EFA45763.1| phage terminase, large subunit, PBSX family [Yersinia pestis KIM
           D27]
 gi|294352486|gb|ADE66542.1| hypothetical protein YPZ3_pMT0023 [Yersinia pestis Z176003]
 gi|320017547|gb|ADW01117.1| hypothetical protein YPC_4788 [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 418

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 32/254 (12%), Positives = 73/254 (28%), Gaps = 12/254 (4%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
            D  +   +H+V  DE  +   D +++ L    ++     L +   KG S   + +    
Sbjct: 110 PDTLRGVALHFVVLDEFQDMKPDTWYKVLRPTLSSTRGGALIIGTPKGFSEFHKLWTIGQ 169

Query: 66  SSD------RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE 119
           + D       +  +    ++P     E +   +                  SGR++   +
Sbjct: 170 NKDLQRKGQWKSWQFVTADSPFVPSAEIEAAKNDMDPKSFAQEYLASFENMSGRVYYPFD 229

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
            ++ +  L          G DF      +   L    + ++  V +       T      
Sbjct: 230 RNVHVKPLQFNPKLPIWVGQDFNIDPMSSVI-LQPQPNGELWAVDEVVLFSSNTAEVCDE 288

Query: 180 ALK---SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGI 236
             +    W   +       G       GE     ++ +G   +         ++ V A  
Sbjct: 289 LERRFWRWKSQVTIFPDPAGAYRQHARGESDVDIFKEKGFLRVDYPKKHPPIADRVNAVN 348

Query: 237 SDMLDRMRSGRWKV 250
             ++      R  +
Sbjct: 349 RMLMSASGETRLYI 362


>gi|310779844|ref|YP_003968176.1| phage terminase, large subunit, PBSX family [Ilyobacter polytropus
           DSM 2926]
 gi|309749167|gb|ADO83828.1| phage terminase, large subunit, PBSX family [Ilyobacter polytropus
           DSM 2926]
          Length = 422

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/247 (13%), Positives = 81/247 (32%), Gaps = 29/247 (11%)

Query: 18  YVWFDE------EPPEDVYFEGLTRINATQG--LVTLTLTPLKGRSPIIEHYLSASS-SD 68
           ++W +E      E   ++  E +   +       +TLT+ P   +  + + +  A +  D
Sbjct: 129 WMWLEECYEITNEDSFNMLDESIRGQSPGNLFKQITLTMNPWNEKHWVKKRFFDAENDPD 188

Query: 69  RQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVI-N 125
                         ++ + K   +    + R  +    GE  +  G ++   EE     +
Sbjct: 189 ILAKTTNYKCNEFLDKADLKVFENMKKNNPRRYQVAGLGEWGIVDGLVYENWEEKEFDTD 248

Query: 126 SLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +   +    I G+DFG+   P A    + + +   I+V      +          +   
Sbjct: 249 DISARKSVKSIFGLDFGYTNDPTALFCGLIDLEKKEIFVFDEIYKKALRNKMIYEEISKR 308

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
           G      +  + +  D    + +    R  G++          G + +  GI  +     
Sbjct: 309 G------YSKEKITADSAEPKSIDE-LRDLGLR---RIIGAAKGKDSINNGIQFIQG--- 355

Query: 245 SGRWKVF 251
              +K++
Sbjct: 356 ---FKIY 359


>gi|149915122|ref|ZP_01903650.1| Phage terminase, large subunit, PBSX [Roseobacter sp. AzwK-3b]
 gi|149810843|gb|EDM70682.1| Phage terminase, large subunit, PBSX [Roseobacter sp. AzwK-3b]
          Length = 467

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 47/284 (16%), Positives = 84/284 (29%), Gaps = 45/284 (15%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDV---YFEGLTRINATQGLVTLTLTPLK---GRSP 56
           +  R K++    +Y+ FDE    P DV   Y     R         +  T      G+  
Sbjct: 119 DADRLKYRGRAWNYIGFDELTLWPTDVCYLYLFSRCRSTDPTLPRLIRATTNPDGPGQGW 178

Query: 57  IIEHYLSASS--------------------SDRQVIRMTINETPHYNEQERKRIIDSYPL 96
           ++E +                         S R  I   ++E PH +E   +  +   P 
Sbjct: 179 VMERWGIKEDGQATRVPIDTVDAEMRRITTSYRTFIPARLSENPHLSETGYREALLQLPP 238

Query: 97  HEREARTKGEP--ILGSGRIFPIVEEDIVI----NSLDIPEHWVQIGGMDFGWHHPFAAG 150
            ER+A   G        G  +     ++       S+            D GW+   A  
Sbjct: 239 DERDALLMGLWRQGRVHGAYYANEMAEMRNRGGIRSVPYDPSEPVNTFWDLGWNDTTAIW 298

Query: 151 HLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWL---PWAWPHDGLQHDKRSGEQL 207
                + +     ++ Y    ++   +   L++ G  +       PHD      ++G+  
Sbjct: 299 F--HQQIAGEHRFIRAYENSGESLDHYATYLQNSGFNVMGGRHYLPHDAQNKSLQTGKSA 356

Query: 208 SAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
               +     +             V  GI+     M   R KVF
Sbjct: 357 LEILQEMLPNL---HFEVVPRIQNVLTGINQTRLAM---RGKVF 394


>gi|307286565|ref|ZP_07566657.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0109]
 gi|306502276|gb|EFM71557.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0109]
          Length = 439

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 72/258 (27%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 118 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 177

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 178 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 237

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I    +        G+DFG+   P A     +++  + IY +
Sbjct: 238 AIGSGVVPFDNLRVIKGCITEEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 297

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +       L   G      + +D +  D    +  +      G+        
Sbjct: 298 DEIYGVKISNRELAKKLHEKG------YQNDEIFSDSAEPKSNAELVNEHGIN---HIKG 348

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 349 VKKGPDSVEYGEQWLDDL 366


>gi|94990333|ref|YP_598433.1| terminase large subunit [Streptococcus phage 10270.2]
 gi|94994256|ref|YP_602354.1| Terminase large subunit [Streptococcus phage 10750.2]
 gi|94543841|gb|ABF33889.1| Terminase large subunit [Streptococcus phage 10270.2]
 gi|94547764|gb|ABF37810.1| Terminase large subunit [Streptococcus phage 10750.2]
          Length = 432

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 37/256 (14%), Positives = 75/256 (29%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQGLVTLTLT--- 49
            Q  ++ +S           W +E            +    L              T   
Sbjct: 119 AQNPERIKSLKDSRFPFAIGWIEELAEFKTEDEVKTITNSLLRGELGDGLFYKFFYTYNP 178

Query: 50  PLKGRSPIIEHYLSASSSDRQVIRM-TINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
           P + +S + + Y S        +   T  + P   ++       +    ER  R +    
Sbjct: 179 PKRKQSWVNKKYESQFQPSNTFVHASTYKDNPFIAKEFIAEAEATRERSERRYRWEYLGE 238

Query: 109 L-GSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             GSG +         I    + +      G+D+G+   P A     +++  + IY +  
Sbjct: 239 AIGSGVVPFDNLRFERITDEQVADFDNIRNGIDYGYATDPLAFVRWHYDKKKNGIYAIDE 298

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           Y  ++ +       L + G      +  D +  +    +  +      G+K         
Sbjct: 299 YYGQKISNRQLAKWLTTKG------YQSDEMFAESAEPKSNAELKNEFGIK---RIKGVK 349

Query: 227 DGSNGVEAGISDMLDR 242
            G + VE G   + D 
Sbjct: 350 KGPDSVEFGERWLDDL 365


>gi|18466735|ref|NP_569542.1| hypothetical protein HCM2.0070c [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16506051|emb|CAD09937.1| hypothetical protein [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
          Length = 418

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 32/254 (12%), Positives = 73/254 (28%), Gaps = 12/254 (4%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
            D  +   +H+V  DE  +   D +++ L    ++     L +   KG S   + +    
Sbjct: 110 PDTLRGVALHFVVLDEFQDMKPDTWYKVLRPTLSSTRGGALIIGTPKGFSEFHKLWTIGQ 169

Query: 66  SSD------RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE 119
           + D       +  +    ++P     E +   +                  SGR++   +
Sbjct: 170 NKDLQRKGQWKSWQFVTADSPFVPSAEIEAAKNDMDPKSFAQEYLASFENMSGRVYYPFD 229

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
            ++ +  L          G DF      +   L    + ++  V +       T      
Sbjct: 230 RNVHVKPLQFNPKLPIWVGQDFNIDPMSSVI-LQPQPNGELWAVDEVVLFSSNTAEVCDE 288

Query: 180 ALK---SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGI 236
             +    W   +       G       GE     ++ +G   +         ++ V A  
Sbjct: 289 LERRFWRWKSQVTIFPDPAGAYRQHARGESDVDIFKEKGFLRVDYPKKHPPIADRVNAVN 348

Query: 237 SDMLDRMRSGRWKV 250
             ++      R  +
Sbjct: 349 RMLMSASGETRLYI 362


>gi|291335056|gb|ADD94686.1| hypothetical protein [uncultured phage MedDCM-OCT-S08-C620]
          Length = 233

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/219 (11%), Positives = 62/219 (28%), Gaps = 15/219 (6%)

Query: 9   DKWQSNTVHYVWFDEEPPED------VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
            + +   +  V FDE    +           L R+ +         T  +G S   + + 
Sbjct: 9   QRLRGQNLCAVGFDEADTVNKRDAEQAMNMALARLRSGNVQQFYATTTPEGHSWAFDTFE 68

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI--LGSGRIFPIVEE 120
             +  D ++I+    + P+  +     ++++YP    +A   G                 
Sbjct: 69  KNAKEDTRLIKARTADNPYLPDGFIDSLLENYPPQLIQAYLNGNFCNLTTGQVYDKFNRN 128

Query: 121 DIVINSLDI-PEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
             V+ +     ++     G+DF   +  A   +      +   V+        T      
Sbjct: 129 THVLQNDPYVDDNEPLRIGIDFNIGNMNAVIGVAV---GNKFMVIDEIAKSHDT-DTIAK 184

Query: 180 ALKSWG--KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGM 216
            +K+      +       G      + +         G+
Sbjct: 185 EIKARYPFNKIYVYPDASGGNRSTNASKTDIQILESYGL 223


>gi|169346779|ref|ZP_02865730.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens C str. JGS1495]
 gi|169297061|gb|EDS79183.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens C str. JGS1495]
          Length = 402

 Score =  101 bits (252), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 39/251 (15%), Positives = 94/251 (37%), Gaps = 20/251 (7%)

Query: 7   GRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
              + +  T    + +E     E+V+ E   R +     + +   P +    +  +++  
Sbjct: 115 DLGRIRGMTAFGAYINEGTMANEEVFNEIKARCSGEGARILIDTNPDQPEHWLKVNFIDK 174

Query: 65  SSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPIVEEDI 122
           +     Q     +++    +E+ R+ I  S P     +   KG  +   G ++    +D+
Sbjct: 175 ADGKVIQAYHYELDDNTFLSERYRENIKASTPSGMFTDRDIKGLWVSAEGIVYKDFRKDV 234

Query: 123 VI---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
                + L          G+D+G+ H  +   +  + D D +Y++K Y  + +   + V 
Sbjct: 235 HYIQSSKLKGINFVKYFAGVDWGYEHFGSVVVIGQD-DKDNLYLLKEYSRQYEEIDYWVN 293

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
                GK +   + +     D    E ++  Y+++G++         +    V +GI  +
Sbjct: 294 V----GKEIKSKYGNITFFCDSARPEHVAR-YKKEGLR-------AKNADKAVLSGIESV 341

Query: 240 LDRMRSGRWKV 250
             R ++    V
Sbjct: 342 AKRFKTKTLFV 352


>gi|256960132|ref|ZP_05564303.1| phage terminase large subunit [Enterococcus faecalis Merz96]
 gi|256950628|gb|EEU67260.1| phage terminase large subunit [Enterococcus faecalis Merz96]
          Length = 342

 Score =  101 bits (252), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 53/172 (30%), Gaps = 6/172 (3%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T    +FDE    P+    +   R++           P          +L
Sbjct: 127 EASQDLVQGLTAAGFFFDEVALMPQSFVNQATARLSVDGAKSWFNCNPAGPHHWFKLEWL 186

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE-E 120
              +    + I  T+ + P  +E+   R    Y     +   +G  +L  G IF   + E
Sbjct: 187 DKLTEKHAIRIHFTMEDNPSLSERVINRYKRMYSGVFYDRYIRGLWVLSEGIIFDNFDAE 246

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ 172
            +V               +D+G  +          +  +  Y +  Y    +
Sbjct: 247 TMVKEPPKNAIASQYYVSIDYGTQNATVFLLWA--KYEENWYCIDEYYYSGR 296


>gi|295113782|emb|CBL32419.1| phage terminase, large subunit, PBSX family [Enterococcus sp. 7L76]
 gi|315035888|gb|EFT47820.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0027]
          Length = 425

 Score =  101 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 40/258 (15%), Positives = 75/258 (29%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFE------GLTRINATQG---LVTLTLTP 50
            Q  ++ +S           W +E        E       L R     G       +  P
Sbjct: 114 AQNPERIKSLKDSRFPFAIGWIEELGEFKTEDEVTTITNSLLRGELGNGLFYKFFFSYNP 173

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P  + +  K +  +   +   AR + +  
Sbjct: 174 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFISREFLKEVEAARDRNPLRARWEYDGE 233

Query: 109 LGSGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P      E   I    +        G+DFG+   P A     +++  + IY V
Sbjct: 234 AIGSGVVPFSNLKVEKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAV 293

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        K+ G      +  D +  D    + ++      GM        
Sbjct: 294 DEIYGVKVSNREFAQKAKAKG------YQSDRIASDSAEPKSIAELNNEHGMS---HVFG 344

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + V+ G   + D 
Sbjct: 345 VKKGPDSVQYGEEWLDDL 362


>gi|256956800|ref|ZP_05560971.1| terminase large subunit [Enterococcus faecalis DS5]
 gi|256947296|gb|EEU63928.1| terminase large subunit [Enterococcus faecalis DS5]
          Length = 424

 Score =  101 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 40/258 (15%), Positives = 75/258 (29%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFE------GLTRINATQG---LVTLTLTP 50
            Q  ++ +S           W +E        E       L R     G       +  P
Sbjct: 113 AQNPERIKSLKDSRFPFAIGWIEELGEFKTEDEVTTITNSLLRGELGNGLFYKFFFSYNP 172

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P  + +  K +  +   +   AR + +  
Sbjct: 173 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFISREFLKEVEAARDRNPLRARWEYDGE 232

Query: 109 LGSGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P      E   I    +        G+DFG+   P A     +++  + IY V
Sbjct: 233 AIGSGVVPFSNLKVEKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAV 292

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        K+ G      +  D +  D    + ++      GM        
Sbjct: 293 DEIYGVKVSNREFAQKAKAKG------YQSDRIASDSAEPKSIAELNNEHGMS---HVFG 343

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + V+ G   + D 
Sbjct: 344 VKKGPDSVQYGEEWLDDL 361


>gi|56808979|ref|ZP_00366686.1| COG1783: Phage terminase large subunit [Streptococcus pyogenes M49
           591]
 gi|71910836|ref|YP_282386.1| terminase large subunit [Streptococcus pyogenes MGAS5005]
 gi|71853618|gb|AAZ51641.1| terminase large subunit [Streptococcus pyogenes MGAS5005]
          Length = 424

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/256 (14%), Positives = 75/256 (29%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQGLVTLTLT--- 49
            Q  ++ +S           W +E            +    L              T   
Sbjct: 111 AQNPERIKSLKDSRFPFAIGWIEELAEFKTEDEVKTITNSLLRGELGDGLFYKFFYTYNP 170

Query: 50  PLKGRSPIIEHYLSASSSDRQVIRM-TINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
           P + +S + + Y S        +   T  + P   ++       +    ER  R +    
Sbjct: 171 PKRKQSWVNKKYESQFQPSNTFVHASTYKDNPFIAKEFIAEAEATRERSERRYRWEYLGE 230

Query: 109 L-GSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             GSG +         I    + +      G+D+G+   P A     +++  + IY +  
Sbjct: 231 AIGSGVVPFDNLRFERITDEQVADFDNIRNGIDYGYATDPLAFVRWHYDKKKNGIYAIDE 290

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           Y  ++ +       L + G      +  D +  +    +  +      G+K         
Sbjct: 291 YYGQKISNRQLAKWLTTKG------YQSDEMFAESAEPKSNAELKNEFGIK---RIKGVK 341

Query: 227 DGSNGVEAGISDMLDR 242
            G + VE G   + D 
Sbjct: 342 KGPDSVEFGERWLDDL 357


>gi|291334642|gb|ADD94290.1| protein of unknown function DUF264 [uncultured phage
           MedDCM-OCT-S04-C64]
          Length = 382

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 36/252 (14%), Positives = 77/252 (30%), Gaps = 21/252 (8%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
             D  +      V  DE  +    ++ E +      +    + +   KG +   + Y +A
Sbjct: 70  NPDHLRGLGFDGVVMDEYGQMSSRLWSEVVRPSLVDRKGWGVFIGTPKGYNSFYDLYEAA 129

Query: 65  SSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGS-----GRIFPIV 118
               D  V     +ET + ++ E           +     +            GR+    
Sbjct: 130 KKDSDWYVAIHRASETGYVSQDELDAAKKQMSEEQYNQEFECSWTAAIQGSYYGRLLEEA 189

Query: 119 EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
           +++  I+ ++     +     D G     A       R+   I ++  Y    +    +V
Sbjct: 190 QKEQRISKINHDPALLVETWWDLGISDSTAIWFA--QRNGAEIRLIDYYEATGEPLTHYV 247

Query: 179 AALKSWGKWLP-----WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
             L+   K          +PHD  Q    +G          G+++             VE
Sbjct: 248 NVLEEKAKAGKWKFGNHVFPHDVRQRSLDTGRTRIEALNSLGIEVTIAPLQK------VE 301

Query: 234 AGISDMLDRMRS 245
            GI  +  ++++
Sbjct: 302 DGIEAVRRQLKN 313


>gi|237748196|ref|ZP_04578676.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229379558|gb|EEO29649.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 474

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/288 (12%), Positives = 80/288 (27%), Gaps = 44/288 (15%)

Query: 3   AYEQGRDKWQSNTVHYVWFDEEPPE---DVYFEGLTRINATQGL----VTLTLTPLKGRS 55
           A E     +  +   ++ F+E         +   L+   ++       +  T  P     
Sbjct: 115 ATEDDYWNYHGHEYCWLGFEELTNWKDLSFFEAMLSTCRSSFPGMPRMIRATCNPFGVGH 174

Query: 56  PIIEHYL------------SASSSDRQVIRMTINETPH---YNEQERKRIIDSYPLHERE 100
             ++                     R  I  +I E  H    +      +      + ++
Sbjct: 175 GAVKARYKIGEVSAGTIIREEGQQARVRIHSSIYENEHLLKNDPNYLPTLEAISDPNRKK 234

Query: 101 ARTKGEPILGSGRIFPIVEE--DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDS 158
           A   G+  +  G     V +    +++   IP  W     MD+G+  P+A      + D 
Sbjct: 235 AWLLGDWDIHVGSFLEGVWDASKHIVDPFPIPSSWTVWKAMDWGYSAPYAVYWFAMDCDG 294

Query: 159 DVIYVVKNYRCRE--------QTPIFHVAALK-------SWGKWLPWAWPHDGLQHDKRS 203
             IY+ +              +        +K         G           +     +
Sbjct: 295 -CIYLWRELYGAGEKAGQGSREGAAEVARKIKRIEEHDNRLGYEYRLNLADPSIFSKNGT 353

Query: 204 GEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
              +   +R  G++ L       +       G  +++  +   + K+F
Sbjct: 354 DRSIGQIFRDNGVRWLEAW----NAKGSRVNGAQEIIRLLAEDKLKIF 397


>gi|78043214|ref|YP_360500.1| prophage LambdaCh01, PBSX family terminase large subunit
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|77995329|gb|ABB14228.1| prophage LambdaCh01, terminase, large subunit, PBSX family
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 420

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 41/258 (15%), Positives = 81/258 (31%), Gaps = 30/258 (11%)

Query: 1   LKAYEQGRDKWQSNT-----VHYVWFDEEPPED------VYFEGLTRINATQGLVTLTLT 49
            +  ++   K +S       + ++W++E    +      +  + L R    Q +V  T  
Sbjct: 110 FRGADK-PKKIRSTKVSKGYIKFIWYEEVDEFNGMEEIRIINQSLMR-GGEQFVVFYTYN 167

Query: 50  PLKGRSPIIEHYLSASSSDRQVIRMTINETP--HYNEQERKRIIDSYPLHE--REARTKG 105
           P    +  +   +     DR+V   T    P     EQ          ++E        G
Sbjct: 168 PPNRVNAWVNEEILIERPDRKVHHSTYLTVPREWLGEQFLIEAEHLKRINERAYRHEYLG 227

Query: 106 EPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVV 164
           E I G+G           I   +I        G+D+G+   P       ++R    +++ 
Sbjct: 228 E-ITGTGGEIFSNITIRKITDDEIKAFDRIRRGIDWGYAVDPVHYTVCHYDRTRRRLFIF 286

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                   +       +K   K       +  +  D    + ++   +  G+K+      
Sbjct: 287 YEIHQVGLSNRRLAELIKEENK------LNSPITADSAEPKSIAE-LKSYGLKVYGA--- 336

Query: 225 FDDGSNGVEAGISDMLDR 242
              G   VE GI  + D 
Sbjct: 337 -KKGPGSVEFGIKFLQDL 353


>gi|256617871|ref|ZP_05474717.1| phage terminase large subunit [Enterococcus faecalis ATCC 4200]
 gi|256597398|gb|EEU16574.1| phage terminase large subunit [Enterococcus faecalis ATCC 4200]
          Length = 342

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 53/172 (30%), Gaps = 6/172 (3%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T    +FDE    P+    +   R++           P          +L
Sbjct: 127 EASQDLVQGLTAAGFFFDEVALMPQSFVNQATARLSVDGAKSWFNCNPAGPHHWFKLEWL 186

Query: 63  SASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE-E 120
              +    + I  T+ + P  +E+   R    Y     +   +G  +L  G IF   + E
Sbjct: 187 DKLTEKHAIRIHFTMEDNPSLSERVINRYKRMYSGVFYDRYIRGLWVLSEGIIFDNFDAE 246

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ 172
            +V               +D+G  +          +  +  Y +  Y    +
Sbjct: 247 TMVKEPPKNAIASQYYVSIDYGTQNATVFLLWA--KYEENWYCIDEYYYSGR 296


>gi|66396200|ref|YP_240530.1| ORF009 [Staphylococcus phage 29]
 gi|62636617|gb|AAX91728.1| ORF009 [Staphylococcus phage 29]
          Length = 402

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 86/256 (33%), Gaps = 26/256 (10%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
             K +  T    + +E          E  +R +     + +   P     P+ + Y+  S
Sbjct: 109 WKKARGFTSAGAFLNEGTALHNMFIKEVFSRCSHKGARILIDTNPENPMHPVKKDYIDKS 168

Query: 66  SS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPI 117
                    + +  + T+ +    +E+  + II S P     +    G+ +   G ++  
Sbjct: 169 GQRLSNGRLNIKAFQFTLFDNTFLDEEYIESIIASTPTGMFTDRDIYGKWVSAEGVVYKD 228

Query: 118 VEEDIVI---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
            +E +           +   +  G+D+G+ H  +   +  + D +  YV++ +  R +  
Sbjct: 229 FKEKVHYITEEEFKTKQIKRKYAGVDWGYEHYGSIMVVAEDFDGNK-YVIEEHAHRHKEI 287

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              VA  K   K             D    E +  ++RR+ +K              V A
Sbjct: 288 DDWVAIAKGVIKRHGDIL----FYCDTARPEHI-ERFRREKIKARY-------ADKAVIA 335

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +    +  +  +
Sbjct: 336 GIEVISRLFKLNKIFI 351


>gi|323481151|gb|ADX80590.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           62]
          Length = 422

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 73/258 (28%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 111 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 170

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 171 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 230

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I             G+DFG+   P A     +++  + IY +
Sbjct: 231 AIGSGVVPFDNLRVIKGCITDEMAANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 290

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +  D +  D    + ++      G   +P    
Sbjct: 291 DEIYGVKISNRKFANKAKSKG------YISDRIAADSAEPKSIAELNSEHG---MPRVFG 341

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 342 VKKGPDSVEYGEEWLGDL 359


>gi|259501596|ref|ZP_05744498.1| phage terminase large subunit [Lactobacillus iners DSM 13335]
 gi|302191426|ref|ZP_07267680.1| Phage terminase large subunit, ATPase [Lactobacillus iners AB-1]
 gi|259166991|gb|EEW51486.1| phage terminase large subunit [Lactobacillus iners DSM 13335]
          Length = 406

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/248 (14%), Positives = 86/248 (34%), Gaps = 24/248 (9%)

Query: 11  WQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA--SS 66
            +  T +  + +E       V+ E   R +     +     P      +   Y+    S+
Sbjct: 120 IRGMTSYGAYINEASLSTHAVFQEIKQRCSKEGARIICDTNPDIPTHWLKTEYIDNVDSN 179

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REARTKGEPILGSGRIFPIVEEDIVIN 125
           +  +    TI++ P   +     +  S P     +   KG  + G G ++   +++  + 
Sbjct: 180 AGIKYFMFTIDDNPTLPKDYVVSLKASTPKGMFYDRAIKGLWVTGDGIVYRDFDKE-TMI 238

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH---VAALK 182
              +P++     G+D+G+ H  A      + D    Y+V+++  + Q   +       ++
Sbjct: 239 VDKVPQNLNYYVGVDWGFEHKNAILVFG-DDDKGNTYLVESHTGKHQYIDYWIKVAKDIQ 297

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                    W             +  + +++ G+K           +  + AGI  + + 
Sbjct: 298 KRYGRNINYWCDSAR-------PEHVSAFQKAGLKARN-------ANKSILAGIEKVSEL 343

Query: 243 MRSGRWKV 250
           M  G + +
Sbjct: 344 MTLGNFFI 351


>gi|257090295|ref|ZP_05584656.1| terminase large subunit [Enterococcus faecalis CH188]
 gi|256999107|gb|EEU85627.1| terminase large subunit [Enterococcus faecalis CH188]
          Length = 430

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 73/258 (28%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 119 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 178

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 179 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 238

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I             G+DFG+   P A     +++  + IY +
Sbjct: 239 AIGSGVVPFDNLRVIKGCITDEMAANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 298

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +  D +  D    + ++      G   +P    
Sbjct: 299 DEIYGVKISNREFANKAKSKG------YISDRIAADSAEPKSIAELNSEHG---MPRVFG 349

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 350 VKKGPDSVEYGEEWLGDL 367


>gi|312902795|ref|ZP_07761999.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0635]
 gi|310633849|gb|EFQ17132.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0635]
 gi|315149046|gb|EFT93062.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX4244]
 gi|315167459|gb|EFU11476.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX1341]
 gi|315576726|gb|EFU88917.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0630]
          Length = 429

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 73/258 (28%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 118 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 177

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 178 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 237

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I             G+DFG+   P A     +++  + IY +
Sbjct: 238 AIGSGVVPFDNLRVIKGCITDEMAANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 297

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +  D +  D    + ++      G   +P    
Sbjct: 298 DEIYGVKISNREFANKAKSKG------YISDRIAADSAEPKSIAELNSEHG---MPRVFG 348

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 349 VKKGPDSVEYGEEWLGDL 366


>gi|183603148|ref|ZP_02712947.2| phage terminase large subunit [Streptococcus pneumoniae SP195]
 gi|183572674|gb|EDT93202.1| phage terminase large subunit [Streptococcus pneumoniae SP195]
          Length = 434

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 76/260 (29%), Gaps = 30/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 118 FRGLD-DELKITSITVDVGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 176

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 177 TFNPWNERHWLKRVFFDEETSRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 236

Query: 104 -KGEPILGSGRIFPI-VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+     +D   + L          G+DFG+   P A    + N  +  
Sbjct: 237 CDGEWGVAEGLIYENVTVKDFDKDELLRDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 296

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV                 +K  G                     L  + R +    + 
Sbjct: 297 IYVFDEAYKVGLITKEVAKMIKDKGYHRSQIVADSAELR-------LIEELRSEH--GIT 347

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + + AG+S + 
Sbjct: 348 RIKESRKGKDSIMAGVSKLQ 367


>gi|148993445|ref|ZP_01822962.1| terminase large subunit [Streptococcus pneumoniae SP9-BS68]
 gi|147928000|gb|EDK79020.1| terminase large subunit [Streptococcus pneumoniae SP9-BS68]
          Length = 432

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 76/260 (29%), Gaps = 30/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 116 FRGLD-DELKITSITVDVGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 175 TFNPWNERHWLKRVFFDEETSRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 234

Query: 104 -KGEPILGSGRIFPI-VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+     +D   + L          G+DFG+   P A    + N  +  
Sbjct: 235 CDGEWGVAEGLIYENVTVKDFDKDELLRDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV                 +K  G                     L  + R +    + 
Sbjct: 295 IYVFDEAYKVGLITKEVAKMIKDKGYHRSQIVADSAELR-------LIEELRSEH--GIT 345

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + + AG+S + 
Sbjct: 346 RIKESRKGKDSIMAGVSKLQ 365


>gi|300860887|ref|ZP_07106974.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TUSoD Ef11]
 gi|295113272|emb|CBL31909.1| phage terminase, large subunit, PBSX family [Enterococcus sp. 7L76]
 gi|300849926|gb|EFK77676.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TUSoD Ef11]
          Length = 422

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 73/258 (28%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 111 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 170

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 171 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 230

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I             G+DFG+   P A     +++  + IY +
Sbjct: 231 AIGSGVVPFDNLRVIKGCITDEMAANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 290

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +  D +  D    + ++      G   +P    
Sbjct: 291 DEIYGVKISNREFANKAKSKG------YISDRIAADSAEPKSIAELNSEHG---MPRVFG 341

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 342 VKKGPDSVEYGEEWLGDL 359


>gi|229545399|ref|ZP_04434124.1| terminase large subunit G2p [Enterococcus faecalis TX1322]
 gi|229549646|ref|ZP_04438371.1| terminase large subunit G2p [Enterococcus faecalis ATCC 29200]
 gi|255972343|ref|ZP_05422929.1| terminase large subunit G2p [Enterococcus faecalis T1]
 gi|229305311|gb|EEN71307.1| terminase large subunit G2p [Enterococcus faecalis ATCC 29200]
 gi|229309506|gb|EEN75493.1| terminase large subunit G2p [Enterococcus faecalis TX1322]
 gi|255963361|gb|EET95837.1| terminase large subunit G2p [Enterococcus faecalis T1]
 gi|315028537|gb|EFT40469.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX4000]
          Length = 429

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 73/258 (28%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 118 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 177

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 178 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 237

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I             G+DFG+   P A     +++  + IY +
Sbjct: 238 AIGSGVVPFDNLRVIKGCITDEMAANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 297

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +  D +  D    + ++      G   +P    
Sbjct: 298 DEIYGVKISNREFANKAKSKG------YISDRIAADSAEPKSIAELNSEHG---MPRVFG 348

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 349 VKKGPDSVEYGEEWLGDL 366


>gi|166012063|ref|ZP_02232961.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|167427125|ref|ZP_02318878.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|2996304|gb|AAC13184.1| P-loop protein [Yersinia pestis KIM 10]
 gi|165988997|gb|EDR41298.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|167053876|gb|EDR63708.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
          Length = 402

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/254 (12%), Positives = 73/254 (28%), Gaps = 12/254 (4%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
            D  +   +H+V  DE  +   D +++ L    ++     L +   KG S   + +    
Sbjct: 94  PDTLRGVALHFVVLDEFQDMKPDTWYKVLRPTLSSTRGGALIIGTPKGFSEFHKLWTIGQ 153

Query: 66  SSD------RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE 119
           + D       +  +    ++P     E +   +                  SGR++   +
Sbjct: 154 NKDLQRKGQWKSWQFVTADSPFVPSAEIEAAKNDMDPKSFAQEYLASFENMSGRVYYPFD 213

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
            ++ +  L          G DF      +   L    + ++  V +       T      
Sbjct: 214 RNVHVKPLQFNPKLPIWVGQDFNIDPMSSVI-LQPQPNGELWAVDEVVLFSSNTAEVCDE 272

Query: 180 ALK---SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGI 236
             +    W   +       G       GE     ++ +G   +         ++ V A  
Sbjct: 273 LERRFWRWKSQVTIFPDPAGAYRQHARGESDVDIFKEKGFLRVDYPKKHPPIADRVNAVN 332

Query: 237 SDMLDRMRSGRWKV 250
             ++      R  +
Sbjct: 333 RMLMSASGETRLYI 346


>gi|321157214|emb|CBW39198.1| Phage terminase large subunit [Streptococcus phage 8140]
          Length = 432

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 76/260 (29%), Gaps = 30/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 116 FRGLD-DELKITSITVDVGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 175 TFNPWNERHWLKRVFFDEETSRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 234

Query: 104 -KGEPILGSGRIFPI-VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+     +D   + L          G+DFG+   P A    + N  +  
Sbjct: 235 CDGEWGVAEGLIYENVTVKDFDKDELLRDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV                 +K  G           +  D      +       G+    
Sbjct: 295 IYVFDEAYKVGLITKEVAKMIKDKGYHR------SQIIADSAESRLIEELRSEHGIS--- 345

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + + AG+S + 
Sbjct: 346 RIKESRKGKDSIMAGVSKLQ 365


>gi|307295867|ref|ZP_07575699.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0411]
 gi|306496198|gb|EFM65777.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0411]
 gi|315169423|gb|EFU13440.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX1342]
          Length = 429

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 73/258 (28%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 118 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 177

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 178 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 237

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I             G+DFG+   P A     +++  + IY +
Sbjct: 238 AIGSGVVPFDNLRVIKGCITDEMAANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 297

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +  D +  D    + ++      G   +P    
Sbjct: 298 DEIYGVKISNREFANKAKSKG------YISDRIAADSAEPKSIAELNSEHG---MPRVFG 348

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 349 VKKGPDSVEYGEEWLGDL 366


>gi|225573563|ref|ZP_03782318.1| hypothetical protein RUMHYD_01756 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039082|gb|EEG49328.1| hypothetical protein RUMHYD_01756 [Blautia hydrogenotrophica DSM
           10507]
          Length = 395

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/251 (16%), Positives = 88/251 (35%), Gaps = 25/251 (9%)

Query: 10  KWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K + +++ YV+ DE  +  E+V+    +R++         L P      + E     S  
Sbjct: 108 KLRGSSIKYVYGDEVADWNEEVFEMLKSRLDKPYSCFDGALNPQGPNHWLKE--FLDSDF 165

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPL-HEREARTKGEPILGSGRIFPIVEED--IVI 124
           D    + TI + P  +++  + +   Y      +    GE  L  G ++P+   +  +V 
Sbjct: 166 DIYCQKYTIFDNPFLDKKFVENLCKEYEGSVYYKRYILGEWALAEGLVYPMFSREKNVVG 225

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE-----QTPIFHVA 179
             ++          +D+G  +PFA G    + D     ++K                + +
Sbjct: 226 GEVEYKRGHQYYVSIDYGTVNPFAVGIF--DFDGRSSTMIKELHYSGRDRDRLDNEGYYS 283

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
            L++    LP  +          S        ++ G  +          +N V  GI ++
Sbjct: 284 KLETLIGDLPIEYIVV-----DPSAAGFIETIKKYGKYI------VKGANNDVLNGIQEV 332

Query: 240 LDRMRSGRWKV 250
              +  G  K+
Sbjct: 333 TKYLNYGILKI 343


>gi|17426268|ref|NP_510934.1| similar to phage O1205 ORF26 ( putative large subunit terminase)
           [Staphylococcus phage phiETA]
 gi|8918455|dbj|BAA97626.1| unnamed protein product [Staphylococcus phage phiETA]
          Length = 405

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 86/256 (33%), Gaps = 26/256 (10%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
             K +  T    + +E          E  +R +     + +   P     P+ + Y+  S
Sbjct: 112 WKKARGFTSAGAFLNEGTALHNMFIKEVFSRCSYKGARILIDTNPENPMHPVKKDYIDKS 171

Query: 66  SS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPI 117
                    + +  + T+ +    +E+  + II S P     +    G+ +   G ++  
Sbjct: 172 GQRLSNGRLNIKAFQFTLFDNTFLDEEYIESIIASTPTGMFTDRDIYGKWVSAEGVVYKD 231

Query: 118 VEEDIVI---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
            +E +           +   +  G+D+G+ H  +   +  + D +  YV++ +  R +  
Sbjct: 232 FKEKVHYIKEEEFKTKQIKRKYAGVDWGYEHYGSIMVVAEDFDGNK-YVIEEHAHRHKEI 290

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              VA  K   K             D    E +  ++RR+ +K              V A
Sbjct: 291 DDWVAIAKGVIKRHGDIL----FYCDTARPEHI-ERFRREKIKARY-------ADKAVIA 338

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +    +  +  +
Sbjct: 339 GIEVISRLFKLNKIFI 354


>gi|256964712|ref|ZP_05568883.1| terminase large subunit G2p [Enterococcus faecalis HIP11704]
 gi|256955208|gb|EEU71840.1| terminase large subunit G2p [Enterococcus faecalis HIP11704]
          Length = 430

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 73/258 (28%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 119 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 178

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 179 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 238

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I             G+DFG+   P A     +++  + IY +
Sbjct: 239 AIGSGVVPFDNLRVIKGCITDEMAANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 298

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +  D +  D    + ++      G   +P    
Sbjct: 299 DEIYGVKISNREFANKAKSKG------YISDRIAADSAEPKSIAELNSEHG---MPRVFG 349

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 350 VKKGPDSVEYGEEWLGDL 367


>gi|307272791|ref|ZP_07554038.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0855]
 gi|307275955|ref|ZP_07557088.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX2134]
 gi|306507285|gb|EFM76422.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX2134]
 gi|306510405|gb|EFM79428.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0855]
          Length = 429

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 73/258 (28%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 118 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 177

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 178 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 237

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I             G+DFG+   P A     +++  + IY +
Sbjct: 238 AIGSGVVPFDNLRVIKGCITDEMAANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 297

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +  D +  D    + ++      G   +P    
Sbjct: 298 DEIYGVKISNREFANKAKSKG------YISDRIAADSAEPKSIAELNSEHG---MPRVFG 348

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 349 VKKGPDSVEYGEEWLGDL 366


>gi|149004553|ref|ZP_01829252.1| terminase large subunit [Streptococcus pneumoniae SP14-BS69]
 gi|147757556|gb|EDK64580.1| terminase large subunit [Streptococcus pneumoniae SP14-BS69]
          Length = 420

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 76/260 (29%), Gaps = 30/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 116 FRGLD-DELKITSITVDVGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 175 TFNPWNERHWLKRVFFDEETSRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 234

Query: 104 -KGEPILGSGRIFPI-VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+     +D   + L          G+DFG+   P A    + N  +  
Sbjct: 235 CDGEWGVAEGLIYENVTVKDFDKDELLRDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV                 +K  G           +  D      +       G+    
Sbjct: 295 IYVFDEAYKVGLITKEVAKMIKDKGYHR------SQIIADSAESRLIEELRSEHGIS--- 345

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + + AG+S + 
Sbjct: 346 RIKESRKGKDSIMAGVSKLQ 365


>gi|332072381|gb|EGI82864.1| phage terminase large subunit [Streptococcus pneumoniae GA17570]
          Length = 344

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 76/260 (29%), Gaps = 30/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 28  FRGLD-DELKITSITVDVGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 86

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 87  TFNPWNERHWLKRVFFDEETSRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 146

Query: 104 -KGEPILGSGRIFPI-VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+     +D   + L          G+DFG+   P A    + N  +  
Sbjct: 147 CDGEWGVAEGLIYENVTVKDFDKDELLRDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 206

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV                 +K  G                     L  + R +    + 
Sbjct: 207 IYVFDEAYKVGLITKEVAKMIKDKGYHRSQIVADSAELR-------LIEELRSEH--GIT 257

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + + AG+S + 
Sbjct: 258 RIKESRKGKDSIMAGVSKLQ 277


>gi|66396276|ref|YP_240605.1| ORF009 [Staphylococcus phage 52A]
 gi|62636692|gb|AAX91803.1| ORF009 [Staphylococcus phage 52A]
 gi|116235547|gb|ABJ88882.1| phage terminase large subunit [Staphylococcus phage 80]
          Length = 402

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 86/256 (33%), Gaps = 26/256 (10%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
             K +  T    + +E          E  +R +     + +   P     P+ + Y+  S
Sbjct: 109 WKKARGFTSAGAFLNEGTALHNMFIKEVFSRCSHKGARILIDTNPENPMHPVKKDYIDKS 168

Query: 66  SS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPI 117
                    + +  + T+ +    +E+  + II S P     +    G+ +   G ++  
Sbjct: 169 GQRLSNGRLNIKAFQFTLFDNTFLDEEYIESIIASTPTGMFTDRDIYGKWVSAEGVVYKD 228

Query: 118 VEEDIVI---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
            +E +           +   +  G+D+G+ H  +   +  + D +  YV++ +  R +  
Sbjct: 229 FKEKVHYITEEEFKTKQIKRKYAGVDWGYEHYGSIMVVAEDFDGNK-YVIEEHAHRHKEI 287

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              VA  K   K             D    E +  ++RR+ +K              V A
Sbjct: 288 DDWVAIAKGVIKRHGDIL----FYCDTARPEHI-ERFRREKIKARY-------ADKAVIA 335

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +    +  +  +
Sbjct: 336 GIEVISRLFKLNKISI 351


>gi|304379029|ref|ZP_07361778.1| PBSX family phage terminase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|269939875|emb|CBI48246.1| phage terminase [Staphylococcus aureus subsp. aureus TW20]
 gi|304342405|gb|EFM08295.1| PBSX family phage terminase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
          Length = 402

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 86/256 (33%), Gaps = 26/256 (10%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
             K +  T    + +E          E  +R +     + +   P     P+ + Y+  S
Sbjct: 109 WKKARGFTSAGAFLNEGTALHNMFIKEVFSRCSYKGARILIDTNPENPMHPVKKDYIDKS 168

Query: 66  SS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPI 117
                    + +  + T+ +    +E+  + II S P     +    G+ +   G ++  
Sbjct: 169 GQRLSNGRLNIKAFQFTLFDNTFLDEEYIESIIASTPTGMFTDRDIYGKWVSAEGVVYKD 228

Query: 118 VEEDIVI---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
            +E +           +   +  G+D+G+ H  +   +  + D +  YV++ +  R +  
Sbjct: 229 FKEKVHYITEEEFKTKQIKRKYAGVDWGYEHYGSIMVVAEDFDGNK-YVIEEHAHRHKEI 287

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              VA  K   K             D    E +  ++RR+ +K              V A
Sbjct: 288 DDWVAIAKGVIKRHGDIL----FYCDTARPEHI-ERFRREKIKARY-------ADKAVIA 335

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +    +  +  +
Sbjct: 336 GIEVISRLFKLNKIFI 351


>gi|66396122|ref|YP_240453.1| ORF009 [Staphylococcus phage 55]
 gi|162290148|ref|YP_001604131.1| putative large terminase subunit [Staphylococcus phage phiMR11]
 gi|62636540|gb|AAX91651.1| ORF009 [Staphylococcus phage 55]
 gi|161958578|dbj|BAF95133.1| putative large terminase subunit [Staphylococcus phage phiMR11]
          Length = 403

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 86/256 (33%), Gaps = 26/256 (10%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
             K +  T    + +E          E  +R +     + +   P     P+ + Y+  S
Sbjct: 110 WKKARGFTSAGAFLNEGTALHNMFIKEVFSRCSYKGARILIDTNPENPMHPVKKDYIDKS 169

Query: 66  SS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPI 117
                    + +  + T+ +    +E+  + II S P     +    G+ +   G ++  
Sbjct: 170 GQRLSNGRLNIKAFQFTLFDNTFLDEEYIESIIASTPTGMFTDRDIYGKWVSAEGVVYKD 229

Query: 118 VEEDIVI---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
            +E +           +   +  G+D+G+ H  +   +  + D +  YV++ +  R +  
Sbjct: 230 FKEKVHYIKEEEFKTKQIKRKYAGVDWGYEHYGSIMVVAEDFDGNK-YVIEEHAHRHKEI 288

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              VA  K   K             D    E +  ++RR+ +K              V A
Sbjct: 289 DDWVAIAKGVIKRHGDIL----FYCDTARPEHI-ERFRREKIKARY-------ADKAVIA 336

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +    +  +  +
Sbjct: 337 GIEVISRLFKLNKIFI 352


>gi|251783038|ref|YP_002997341.1| terminase large subunit [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242391668|dbj|BAH82127.1| terminase large subunit [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 424

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/256 (13%), Positives = 74/256 (28%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQGLVTLTLT--- 49
            Q  ++ +S           W +E            +    L              T   
Sbjct: 111 AQNPERIKSLKDSRFPFAIGWIEELAEFKTEDEVKTITNSLLRGELGDGLFYKFFYTYNP 170

Query: 50  PLKGRSPIIEHYLSASSSDRQVIRM-TINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
           P + +S + + Y S        +   T  + P   ++       +    ER  R +    
Sbjct: 171 PKRKQSWVNKKYESQFQPKNTFVHASTYKDNPFIAKEFIAEAEATRERSERRYRWEYLGE 230

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P           ++   +  I   +DFG+   P A     +++  + IY +  
Sbjct: 231 AIGSGVVPFDNLRFETIPDELYRSFDNIRNAVDFGYATDPLAFVRWHYDKKHNGIYAIDE 290

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
              ++ +       LK        ++ +D +  D    + ++      G+K         
Sbjct: 291 LYGQKISNRQLANWLKDK------SYSNDEIFADAAEPKSIAELRNEFGIK---HIRGAK 341

Query: 227 DGSNGVEAGISDMLDR 242
            G + VE G   + D 
Sbjct: 342 KGPDSVEFGERWLDDL 357


>gi|296276230|ref|ZP_06858737.1| PBSX family phage terminase large subunit [Staphylococcus aureus
           subsp. aureus MR1]
          Length = 402

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 86/256 (33%), Gaps = 26/256 (10%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
             K +  T    + +E          E  +R +     + +   P     P+ + Y+  S
Sbjct: 109 WKKARGFTSAGAFLNEGTALHNMFIKEVFSRCSYKGARILIDTNPENPMHPVKKDYIDKS 168

Query: 66  SS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPI 117
                    + +  + T+ +    +E+  + II S P     +    G+ +   G ++  
Sbjct: 169 GQRLSNGRLNIKAFQFTLFDNTFLDEEYIESIIASTPTGMFTDRDIYGKWVSAEGVVYKD 228

Query: 118 VEEDIVI---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
            +E +           +   +  G+D+G+ H  +   +  + D +  YV++ +  R +  
Sbjct: 229 FKEKVHYITEEEFKAKQIKRKYAGVDWGYEHYGSIMVVAEDFDGNK-YVIEEHAHRHKEI 287

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              VA  K   K             D    E +  ++RR+ +K              V A
Sbjct: 288 DDWVAIAKGVIKRHGDIL----FYCDTARPEHI-ERFRREKIKARY-------ADKAVIA 335

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +    +  +  +
Sbjct: 336 GIEVISRLFKLNKIFI 351


>gi|149012736|ref|ZP_01833712.1| terminase large subunit [Streptococcus pneumoniae SP19-BS75]
 gi|147763336|gb|EDK70274.1| terminase large subunit [Streptococcus pneumoniae SP19-BS75]
          Length = 432

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 76/260 (29%), Gaps = 30/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 116 FRGLD-DELKITSITVDVGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 175 TFNPWNERHWLKRVFFDEETRRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 234

Query: 104 -KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQ-IGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+  V          + +   +   G+DFG+   P A    + N  +  
Sbjct: 235 CDGEWGVAEGLIYENVTVKDFNKDELLQDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV                 +K  G           +  D      +       G+    
Sbjct: 295 IYVFDEAYKVGLITKEVAKMIKDKGYHR------SQIIADSAESRLIEELRSEHGIS--- 345

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + + AG+S + 
Sbjct: 346 RIKESRKGKDSIMAGVSKLQ 365


>gi|256619492|ref|ZP_05476338.1| terminase large subunit G2p [Enterococcus faecalis ATCC 4200]
 gi|256599019|gb|EEU18195.1| terminase large subunit G2p [Enterococcus faecalis ATCC 4200]
          Length = 429

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 73/258 (28%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 118 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 177

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 178 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQVFIEEVNATRAKNPKRAEWEYDGK 237

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I             G+DFG+   P A     +++  + IY +
Sbjct: 238 AIGSGVVPFDNLRVIKGCITDEMAANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 297

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +  D +  D    + ++      G   +P    
Sbjct: 298 DEIYGVKISNREFANKAKSKG------YISDRIAADSAEPKSIAELNSEHG---MPRVFG 348

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 349 VKKGPDSVEYGEEWLGDL 366


>gi|307280628|ref|ZP_07561676.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0860]
 gi|306503994|gb|EFM73211.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0860]
          Length = 425

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/258 (15%), Positives = 78/258 (30%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFE------GLTRINATQG---LVTLTLTP 50
            Q  ++ +S           W +E        E       L R     G       +  P
Sbjct: 114 AQNPERIKSLKDSRFPFAIGWIEELGEFKTEDEVTTITNSLLRGELGNGLFYKFFFSYNP 173

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y S+   D   V   T  + P  + +  K +  +   +   AR + +  
Sbjct: 174 PKRRQSWVNKKYESSFQPDNTFVHHSTYKDNPFISREFLKEVEAARDRNLLRARWEYDGE 233

Query: 109 LGSGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P      E   I    +        G+DFG+   P A     +++  + IY V
Sbjct: 234 AIGSGVVPFSNLKVEKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAV 293

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        K+ G      +  D +  D    + ++      G   +     
Sbjct: 294 DEIYGVKISNREFAQKAKAKG------YQSDRIASDSAEPKSIAELNNEHG---MGHVFG 344

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + V+ G   + D 
Sbjct: 345 VKKGPDSVQYGEEWLDDL 362


>gi|225855376|ref|YP_002736888.1| phage terminase, large subunit, pbsx family [Streptococcus
           pneumoniae JJA]
 gi|225724280|gb|ACO20133.1| phage terminase, large subunit, pbsx family [Streptococcus
           pneumoniae JJA]
          Length = 432

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 76/260 (29%), Gaps = 30/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 116 FRGLD-DELKITSITVDIGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 175 TFNPWNERHWLKRVFFDEETRRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 234

Query: 104 -KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQ-IGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+  V          + +   +   G+DFG+   P A    + N  +  
Sbjct: 235 CDGEWGVAEGLIYENVTVKDFNKDELLQDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV                 +K  G           +  D      +       G+    
Sbjct: 295 IYVFDEAYKVGLITKEVAKMIKDKGYHR------SQIIADSAESRLIEELRSEHGIS--- 345

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + + AG+S + 
Sbjct: 346 RIKESRKGKDSIMAGVSKLQ 365


>gi|149021996|ref|ZP_01835958.1| terminase large subunit [Streptococcus pneumoniae SP23-BS72]
 gi|147929840|gb|EDK80829.1| terminase large subunit [Streptococcus pneumoniae SP23-BS72]
          Length = 432

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 76/260 (29%), Gaps = 30/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 116 FRGLD-DELKITSITVDIGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 175 TFNPWNERHWLKRVFFDEETRRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 234

Query: 104 -KGEPILGSGRIFPI-VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+     +D   + L          G+DFG+   P A    + N  +  
Sbjct: 235 CDGEWGVAEGLIYENVTVKDFNKDELLRDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV                 +K  G           +  D      +       G+    
Sbjct: 295 IYVFDEAYKVGLITKEVAKMIKDKGYHR------SQIIADSAESRLIEELRSEHGIS--- 345

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + + AG+S + 
Sbjct: 346 RIKESRKGKDSIMAGVSKLQ 365


>gi|321157006|emb|CBW38994.1| Phage terminase large subunit [Streptococcus phage 040922]
          Length = 432

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/261 (18%), Positives = 76/261 (29%), Gaps = 32/261 (12%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 116 FRGLD-DELKITSITVDVGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 175 TFNPWNERHWLKRVFFDEETRRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 234

Query: 104 -KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQ-IGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+  V          + +   +   G+DFG+   P A    + N  +  
Sbjct: 235 CDGEWGVAEGLIYENVTVKDFNKDELLQDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYR-RQGMKML 219
           IYV                 +K  G                     L  + R   G+   
Sbjct: 295 IYVFDEAYKVGLITKEVAKMIKDKGYHRSQIIADSAELR-------LIEELRSEHGIS-- 345

Query: 220 PECATFDDGSNGVEAGISDML 240
                   G + + AG+S + 
Sbjct: 346 -RIKESRKGKDSIMAGVSKLQ 365


>gi|327197586|ref|YP_004301277.1| gp2 [Brochothrix phage NF5]
 gi|296245409|gb|ADH03023.1| gp2 [Brochothrix phage NF5]
          Length = 425

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/258 (14%), Positives = 80/258 (31%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFE------GLTRINATQG---LVTLTLTP 50
            Q  ++ +S           W +E        E       L R     G       +  P
Sbjct: 111 AQNPERIKSLKDSKFPFAIGWIEELAEFKNEEEVTTITNSLLRGELGNGLFYKFFYSYNP 170

Query: 51  L-KGRSPIIEHYLS-ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y +     +  V   T  + P   ++  K +  +   + R A  + +  
Sbjct: 171 PKRKQSWVNKKYETSFQPENTFVHHSTYKDNPFIAKEFLKEVEAARERNPRRAEWEYDGK 230

Query: 109 LGSGRIFPIVEEDIV---INSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +V   I              +DFG+   P A     +++  + IY +
Sbjct: 231 AIGSGVVPFDNLKVVAGSITDDMTANFDNVRNAVDFGYATDPLAFVRWHYDKKHNCIYAI 290

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
           + Y  ++ +        +S G      +  D +  D    + ++   +      +P    
Sbjct: 291 EEYFGQKISNRQFAKWAQSKG------YQSDEIYADSAEPKSIAELRQEH---SMPRVIG 341

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 342 VKKGPDSVEYGEEWLDDL 359


>gi|315144732|gb|EFT88748.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX2141]
          Length = 425

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/258 (15%), Positives = 75/258 (29%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFE------GLTRINATQG---LVTLTLTP 50
            Q  ++ +S           W +E        E       L R     G       +  P
Sbjct: 114 AQNPERIKSLKDSRFPFAIGWIEELGEFKTEDEVTTITNSLLRGELGNGLFYKFFFSYNP 173

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P  + +  K +  +   +   AR + +  
Sbjct: 174 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFISREFLKEVEAARDRNLLRARWEYDGE 233

Query: 109 LGSGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P      E   I    +        G+DFG+   P A     +++  + IY V
Sbjct: 234 AIGSGVVPFSNLKVEKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAV 293

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        K+ G      +  D +  D    + ++      GM        
Sbjct: 294 DEIYGVKISNREFAQKAKAKG------YQSDRIASDSAEPKSIAELNNEHGMS---HVFG 344

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + V+ G   + D 
Sbjct: 345 VKKGPDSVQYGEEWLDDL 362


>gi|321156947|emb|CBW38936.1| Phage terminase large subunit [Streptococcus phage V22]
          Length = 432

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 76/260 (29%), Gaps = 30/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 116 FRGLD-DELKITSITVDIGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 175 TFNPWNERHWLKRVFFDEETSRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 234

Query: 104 -KGEPILGSGRIFPI-VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+     +D   + L          G+DFG+   P A    + N  +  
Sbjct: 235 CDGEWGVAEGLIYENVTVKDFDKDELLRDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV                 +K  G           +  D      +       G+    
Sbjct: 295 IYVFDEAYKVGLITKEVAKMIKDKGYHR------SQIIADSAESRLIEELRSEHGIS--- 345

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + + AG+S + 
Sbjct: 346 RIKESRKGKDSIMAGVSKLQ 365


>gi|239909154|ref|YP_002955896.1| hypothetical protein DMR_45190 [Desulfovibrio magneticus RS-1]
 gi|239799021|dbj|BAH78010.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 488

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/288 (13%), Positives = 75/288 (26%), Gaps = 56/288 (19%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPEDV--YFEGLTRIN----------ATQGLVTLTLTPLK 52
           E    ++Q   +H +  DE        Y     R+                +     P  
Sbjct: 123 ESDVFRYQGVEIHLLCIDELTSFTELQYDYLRGRLRCALDVPPALRHKIPGIVCASNPGG 182

Query: 53  GRSPI-IEHYLSASSSD-------------RQVIRMTINETPHYNEQE--RKRIIDSYPL 96
                    ++  +                R  I   +++      ++      +D+ P 
Sbjct: 183 VGHGFAKARFVDFAPPGVCRRAPAAEGGMLRCHIPGRLSDNAILMARDPGYAARLDALPE 242

Query: 97  HEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNR 156
             R A   G+  +  G+ F       VI    +P         D+G+  PF+ G    + 
Sbjct: 243 PYRTAYRDGDWDVFMGQAFAFQRRLHVIPPRPVPGDAPLYMTFDWGYGAPFSVGWWWVDA 302

Query: 157 DSDVIYVVKNYRCR--------EQTPIFHVAALKSWGKWL------------PWAWPHDG 196
           D   +Y +  +             T     A +    + L            P  +    
Sbjct: 303 DG-RLYRLGEWYGASGAANQGLRLTDPQIAAGILEREQALGLGGRRITRLCGPDCFAKKP 361

Query: 197 LQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
                  G   +  +   G+ + P       G    +  I    +R+R
Sbjct: 362 DYRGGGQGPSTAEVFAGAGVFLSP-------GDPSRKNKIRQFHERLR 402


>gi|270209588|gb|ACZ64128.1| terminase [Enterococcus phage phiFL3B]
          Length = 427

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 75/258 (29%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 111 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 170

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 171 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 230

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I    +        G+DFG+   P A     +++  + IY +
Sbjct: 231 AIGSGVVPFDNLRVIKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 290

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +       +K+ G      +  D +  D    + ++       +K   +   
Sbjct: 291 DEIYGVKISNRELAKKVKAKG------YEADRIGADSAEPKSIAELINEHSIK---KLYG 341

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 342 VKKGPDSVEYGEGWLDDL 359


>gi|42526667|ref|NP_971765.1| phage terminase, large subunit, putative [Treponema denticola ATCC
           35405]
 gi|41816860|gb|AAS11646.1| phage terminase, large subunit, putative [Treponema denticola ATCC
           35405]
          Length = 417

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 88/273 (32%), Gaps = 40/273 (14%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPEDV---YFEGLTRINA-TQGLVTLTLTPLKGR---SPI 57
           +     +Q +   ++ FDE         +   ++R  +       +  T   G      +
Sbjct: 67  DDDVSNYQGHQYTWIGFDELGNYSSDYCWRYMMSRCRSAKGIPCYMRGTGNPGGVGHGWL 126

Query: 58  IEHYLSASSSD----------RQVIRMTINETPHY--NEQERKRIIDSYPLHEREARTKG 105
            + ++   + +          R  I   +++  +   N++  ++ +   P +  EA  KG
Sbjct: 127 KKRFIDNQNPNTIYTDEDGNTRCFIPSRLDDNDYLIKNDKGYEKRLRLLPKYLYEALRKG 186

Query: 106 EPILGSGRIFPIV-EEDIVINSLDIPEH-WVQIGGMDFGWHHPFAAGHLVWNRDSDVIYV 163
              + +G  F     E  VI  + +    W +   MD+G+  PF+ G    +RD   +  
Sbjct: 187 NWDIIAGSAFEEFSRESHVIKPIALDPGVWFKFCSMDWGYSRPFSIGWWAVSRDG-RMIR 245

Query: 164 VKNYRCRE---------QTPIFHVAALKSW--GKWLPWAWPHDGLQHDKRSGEQLSAQYR 212
            +     E         ++         +    + +        +      G  ++ ++ 
Sbjct: 246 YRELYGCENGEANKGVRRSASSIAKEAYALSIAEGVNTMVADPAVWGKTDDGPTIADKFE 305

Query: 213 RQGMKMLPECATFDDGSNGVEAGISDMLDRMRS 245
            +G K++          N    G       ++S
Sbjct: 306 VEGWKLI-------KADNDRINGKMQFHQLLKS 331


>gi|307290093|ref|ZP_07570017.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0411]
 gi|306498935|gb|EFM68429.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0411]
          Length = 434

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 75/258 (29%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 118 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 177

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 178 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 237

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I    +        G+DFG+   P A     +++  + IY +
Sbjct: 238 AIGSGVVPFDNLRVIKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 297

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +       +K+ G      +  D +  D    + ++       +K   +   
Sbjct: 298 DEIYGVKISNRELAKKVKAKG------YEADRIGADSAEPKSIAELINEHSIK---KLYG 348

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 349 VKKGPDSVEYGEGWLDDL 366


>gi|221142412|ref|ZP_03566905.1| PBSX family phage terminase large subunit [Staphylococcus aureus
           subsp. aureus str. JKD6009]
 gi|302751711|gb|ADL65888.1| phage terminase, large subunit [Staphylococcus aureus subsp. aureus
           str. JKD6008]
          Length = 402

 Score = 99.9 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 86/256 (33%), Gaps = 26/256 (10%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
             K +  T    + +E          E  +R +     + +   P     P+ + Y+  S
Sbjct: 109 WKKARGFTSAGAFLNEGTALHNMFIKEVFSRCSYKGARILIDTNPENPMHPVKKDYIDKS 168

Query: 66  SS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPI 117
                    + +  + T+ +    +E+  + II S P     +    G+ +   G ++  
Sbjct: 169 GQRLSNGRLNIKAFQFTLFDNTFLDEEYIESIIASTPTGMFTDRDIYGKWVSAEGVVYKD 228

Query: 118 VEEDIVI---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
            +E +           +   +  G+D+G+ H  +   +  + D +  YV++ +  R +  
Sbjct: 229 FKEKVHYITEEEFKTKQIKRKYAGVDWGYEHYGSIMVVAEDFDGNK-YVIEEHAHRHKEI 287

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              VA  K   K             D    E +  ++RR+ +K              V A
Sbjct: 288 DDWVAIAKGVIKRHGDIL----FYCDTARPEHI-ERFRREKIKARY-------ADKAVIA 335

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +    +  +  +
Sbjct: 336 GIEVISRLFKLNKISI 351


>gi|229080901|ref|ZP_04213416.1| Phage terminase, large subunit, pbsx [Bacillus cereus Rock4-2]
 gi|228702397|gb|EEL54868.1| Phage terminase, large subunit, pbsx [Bacillus cereus Rock4-2]
          Length = 385

 Score = 99.9 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 88/248 (35%), Gaps = 20/248 (8%)

Query: 9   DKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
           D  +  T +  + +E     +DV+ E  +R +     + +   P      +   Y+    
Sbjct: 94  DTIRGMTAYGAYVNEGSLANKDVFDEIKSRCSGEGARILVDTNPDHPEHWLKVDYIDKDD 153

Query: 67  S-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVEEDIVI 124
           +   +  +  +++    NE+ R+RI  S P      R  KG      G ++    +D+  
Sbjct: 154 NVTIKAFQYELDDNTFLNERYRERIKASTPEGMFYDRNIKGLWCSADGVVYKDFNKDVHY 213

Query: 125 ---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
                L   +      G+D+G+ H  +   +  + D + +Y+++ Y  + +   + V   
Sbjct: 214 IEETDLKDIKFTKYFAGVDWGYGHFGSIVVIGED-DEENLYLLEEYAKQHEEIDYWVGVA 272

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
           K   +     +       D    E +         +   E     +    V +GI  +  
Sbjct: 273 KDVKERYGNIF----FYCDSARPEHIK--------RFKREGLRARNADKSVLSGIEMVAK 320

Query: 242 RMRSGRWK 249
            +++  +K
Sbjct: 321 YIKTESFK 328


>gi|117924988|ref|YP_865605.1| hypothetical protein Mmc1_1690 [Magnetococcus sp. MC-1]
 gi|117608744|gb|ABK44199.1| protein of unknown function DUF264 [Magnetococcus sp. MC-1]
          Length = 445

 Score = 99.9 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/276 (12%), Positives = 76/276 (27%), Gaps = 45/276 (16%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED---VYFEGLTRINATQG----LVTLTLTPLKGRSPIIE 59
              ++Q +   ++ +DE         Y   +  + +  G     +  +  P       ++
Sbjct: 87  DAARYQGHQYTWIGWDELTNWPDDVAYKMLMACLRSAHGIKHKRIRASGNPGGAGHQWVK 146

Query: 60  HYLSASSS-------------DRQVIRMTINETPH---YNEQERKRIIDSYPLHEREART 103
                 +               R  I  ++ +       +    +R+ D        A  
Sbjct: 147 RRFIDPAPAGYQLLQDELSRHPRIFIPSSVRDNAILTENDPDYVERLKDVGSKELVRAWL 206

Query: 104 KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDS----- 158
           +G+  +  G  F      +VI    +P HW +    D+G   PF+ G    +        
Sbjct: 207 EGDWNIIMGAFFDRWSSKMVIKPRALPSHWTRFRAFDWGSARPFSVGWWAVSDGELEGLP 266

Query: 159 -DVIYVVKNYRCR--------EQTPIFHVAALKSWGKWLPWAWPH--DGLQHDKRSGEQL 207
            + +   + +           +         + +             D     K  G  +
Sbjct: 267 KNALVRYREWYGSNGNPNVGLKMDAESVARGILAKEAKDETIHYSVADPAIFAKDGGPSI 326

Query: 208 SAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
             +  R+G++  P        +     G   M  RM
Sbjct: 327 GERMAREGVRFKPAD------NRSRVGGWDQMRQRM 356


>gi|227534164|ref|ZP_03964213.1| large subunit terminase [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|227188204|gb|EEI68271.1| large subunit terminase [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
          Length = 432

 Score = 99.9 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/238 (15%), Positives = 72/238 (30%), Gaps = 26/238 (10%)

Query: 19  VWFDEEPP------EDVYFEGLTRINATQGLVT---LTLTPLKGRSPIIEHYLSA--SSS 67
            W++E              E +              +T  P   +  +   +      + 
Sbjct: 131 AWWEEAYELKSLDAFKTVEETMRGEIDDPDGYYQSIITFNPWSDQHWLKREFFDQDTKNP 190

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P+ ++     + D    +   AR    G+  +  G +F  + E    +
Sbjct: 191 RSKSFTTTYEDNPYLDDDYIASLKDMVKRNPNRARVAVYGDWGIAEGLVFDGLFEQRDFS 250

Query: 126 SLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL-KS 183
             DI     +  G+DFG+ H P A   +  ++ + V+Y+   +  +          L   
Sbjct: 251 MEDIAA-LPKAVGLDFGFKHDPTAGEFMAIDQQNRVVYIYDEFYKQGLLTGQIAKELASH 309

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
               LP          D+ +   +       G+   P       G + V  GI  M  
Sbjct: 310 KAYGLPIM-------ADQAAANLIGELTMAHGV---PNIRAAGKGKDSVSQGIQYMQS 357


>gi|145589311|ref|YP_001155908.1| hypothetical protein Pnuc_1128 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047717|gb|ABP34344.1| protein of unknown function DUF264 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 444

 Score = 99.5 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 78/281 (27%), Gaps = 44/281 (15%)

Query: 10  KWQSNTVHYVWFDEEPPE---DVYFE--GLTRINATQGLVTL--TLTPLKGRSP-IIEHY 61
            +  +   ++ F+E         Y       R +       +  T  P       + E +
Sbjct: 113 NYHGHEYPWLGFEELTNWRNLSFYEAMHSTCRSSHPGMPRMVRATCNPFGVGHASVKERF 172

Query: 62  LSASSS-----------DRQVIRMTINETPH---YNEQERKRIIDSYPLHEREARTKGEP 107
              +              R  I  TI E  H    +      +      + R A  +G+ 
Sbjct: 173 QIGAIPAGQIIRQEGALPRVRIHSTIYENTHLLKNDPNYLMSLESLSDPNRRRAWLEGDW 232

Query: 108 ILGSGRIFPIVEE--DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVK 165
            +  G     V +    V+    IP  W     MD+G+  P+A      + D  V Y+ +
Sbjct: 233 DIHVGSFLEGVWQPSKHVVEPFAIPPTWKVWRSMDWGYARPYAVYWFALSNDG-VYYLWR 291

Query: 166 NYRCRE--------QTPIFHVAALK-------SWGKWLPWAWPHDGLQHDKRSGEQLSAQ 210
                         +        +K         G           +     +   +   
Sbjct: 292 ELYGYGDKENTGTREDATVVAEKIKKIEIHDQRLGYEYRMNLADPSIFSKIGAERSIGQI 351

Query: 211 YRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
           +R +G+K         + S     G  +++  +   R K+F
Sbjct: 352 FRDKGVKWTEAY----NASRSRVNGAQEIIRLLAEDRLKIF 388


>gi|327409392|ref|YP_004301534.1| gp2 [Brochothrix phage BL3]
 gi|296245468|gb|ADH03081.1| gp2 [Brochothrix phage BL3]
          Length = 524

 Score = 99.5 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/261 (13%), Positives = 79/261 (30%), Gaps = 27/261 (10%)

Query: 1   LKAYEQGRDKWQSNTV-----HYVWFDEEPPED------VYFEGLTRINATQGLVTLTLT 49
            +  +    K +S  +       +W +E           V  + + R     GL      
Sbjct: 111 FRGAD-DPGKIKSIKIAKFPLTILWIEELAEFKLEEEIGVIEKSVLRAKLPPGLSYYFFN 169

Query: 50  ----PLKGRSPIIEHYLSA--SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART 103
               P + +S + + Y +    + + +V   T  + PH +++  +     Y  + ++A  
Sbjct: 170 SYNPPKRKQSWVNKKYETKVALAPNTRVHHTTYKDNPHISDEFIEEAEHMYQTNPQKAAW 229

Query: 104 KGEPILGSGRIFPIVEED-IVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVI 161
           +         + P        I + +         G+DFG+   P A     +++   + 
Sbjct: 230 EYGGEPIGNGVVPFNNLVFRTITNDEFKSFSNIRQGLDFGYATDPVAGVQWHYDKTRRIA 289

Query: 162 YVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
           Y ++     + +     A  K+ G +            D      ++             
Sbjct: 290 YAMREVYGVKMSNRSLAANAKACGFF------SSLTIADSEDPRTINELQSEHSWPSRYL 343

Query: 222 CATFDDGSNGVEAGISDMLDR 242
                 G N VE G   + D 
Sbjct: 344 I-GAKKGPNSVEHGERWLDDL 363


>gi|315650013|ref|ZP_07903093.1| PBSX family prophage LambdaCh01 protein [Eubacterium saburreum DSM
           3986]
 gi|315487783|gb|EFU78086.1| PBSX family prophage LambdaCh01 protein [Eubacterium saburreum DSM
           3986]
          Length = 425

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 74/237 (31%), Gaps = 24/237 (10%)

Query: 18  YVWFDE------EPPEDVYFEGLTRINATQGLVT----LTLTPLKGRSPIIEHYLSASSS 67
           ++W +E      E   ++  E +         +     +TL P      I + +      
Sbjct: 134 WMWLEEAYEISNENDFNMLDESIRGAIPKDVKLFKQITITLNPWNEHHWIKKRFFDTPDD 193

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEED-IVI 124
           +   +          ++ + K        + R  +    GE  +  G ++   EE    I
Sbjct: 194 EVLAMTTNYLCNEWLDKADLKVFESMKKNNPRRYQVAGLGEWGIVEGLVYENWEEKAFDI 253

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
             +        + G+DFG+   P A    + +  S  I+V      +  +       +  
Sbjct: 254 GEVKKISTIQSVFGLDFGYTNDPSALFCGLVDTKSKTIWVFDEMYKKGMSNEAIADEVTK 313

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
            G      +  + ++ D    + +  + R  G++          G + +  GI  + 
Sbjct: 314 MG------YAKERIRADSAEKKSI-DRLRHLGLQ---RVTPAIKGPDSIRNGIDFIQ 360


>gi|306830667|ref|ZP_07463832.1| PBSX family phage terminase [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|304427175|gb|EFM30282.1| PBSX family phage terminase [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
          Length = 416

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/248 (13%), Positives = 81/248 (32%), Gaps = 17/248 (6%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G  + +  T    + +E     E V+ E ++R +     +     P      +   Y+ 
Sbjct: 117 SGLKRARGFTAFGAYVNEASLANEVVFKEIISRCSGDGARIVWDSNPDNPNHWLRRDYIG 176

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEEDI 122
            ++         +++    + +    I  + P     +    G+  +  G I+   + +I
Sbjct: 177 KNNGKIIDFSFKLDDNTFLSPRYIASIKAATPSGKFYDRDIDGKWTVAEGAIYSDYDANI 236

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
                ++P       G+DFG+ H  +   +    D    Y+V     R +   +     K
Sbjct: 237 -HEVDELPRMVRYFAGVDFGYDHLGSIVIVGETSDG-KQYLVDGIAERYRVISWWTDRAK 294

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
            +       + +     D    E ++  ++  G+          + +  V AGI  +  R
Sbjct: 295 EFKAK----YGNIAFWCDSARPEHVA-HFQSAGL-------DAMNANKNVIAGIETVAKR 342

Query: 243 MRSGRWKV 250
            +     +
Sbjct: 343 FKENTLFI 350


>gi|303255666|ref|ZP_07341713.1| terminase large subunit [Streptococcus pneumoniae BS455]
 gi|302597338|gb|EFL64437.1| terminase large subunit [Streptococcus pneumoniae BS455]
          Length = 432

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 47/261 (18%), Positives = 76/261 (29%), Gaps = 32/261 (12%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 116 FRGLD-DELKITSITVDVGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +E + KR  D Y  + R AR  
Sbjct: 175 TFNPWNERHWLKRVFFDEETRRADTFATTTTYKCNEWLDEVDIKRYEDLYHTNPRRARIV 234

Query: 104 -KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQ-IGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+  V          + +   +   G+DFG+   P A    + N  +  
Sbjct: 235 CDGEWGVAEGLIYENVTVKDFNKDELLQDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYR-RQGMKML 219
           IYV                 +K  G                     L  + R   G+   
Sbjct: 295 IYVFDEAYKVGLITKEVAKMIKDKGYHRSQIIADSAELR-------LIEELRSEHGIS-- 345

Query: 220 PECATFDDGSNGVEAGISDML 240
                   G + + AG+S + 
Sbjct: 346 -RIKESRKGKDSIMAGVSKLQ 365


>gi|148266781|ref|YP_001245724.1| PBSX family phage terminase large subunit [Staphylococcus aureus
           subsp. aureus JH9]
 gi|150392825|ref|YP_001315500.1| PBSX family phage terminase large subunit [Staphylococcus aureus
           subsp. aureus JH1]
 gi|258445244|ref|ZP_05693438.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A6300]
 gi|147739850|gb|ABQ48148.1| phage terminase, large subunit, PBSX family [Staphylococcus aureus
           subsp. aureus JH9]
 gi|149945277|gb|ABR51213.1| phage terminase, large subunit, PBSX family [Staphylococcus aureus
           subsp. aureus JH1]
 gi|257855958|gb|EEV78879.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A6300]
          Length = 402

 Score = 99.1 bits (245), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 39/256 (15%), Positives = 85/256 (33%), Gaps = 26/256 (10%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
             K +  T    + +E          E  +R +     + +   P     P+ + Y+  S
Sbjct: 109 WKKARGFTSAGAFLNEGTALHNMFIKEVFSRCSYKGARILIDTNPENPMHPVKKDYIDKS 168

Query: 66  SS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPI 117
                    + +  + T+ +    +E   + II S P     +    G+ +   G ++  
Sbjct: 169 GQRLSNGRLNIKAFQFTLFDNTFLDEGYIESIIASTPTGMFTDRDIYGKWVSAEGVVYKD 228

Query: 118 VEEDIVI---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
            +E +           +   +  G+D+G+ H  +   +  + D +  YV++ +  R +  
Sbjct: 229 FKEKVHYITEEEFKTKQIKRKYAGVDWGYEHYGSIMVVAEDFDGNK-YVIEEHAHRHKEI 287

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              VA  K   K             D    E +  ++RR+ +K              V A
Sbjct: 288 DDWVAIAKGVIKRHGDIL----FYCDTARPEHI-ERFRREKIKARY-------ADKAVIA 335

Query: 235 GISDMLDRMRSGRWKV 250
           GI  +    +  +  +
Sbjct: 336 GIEVISRLFKLNKIFI 351


>gi|229182174|ref|ZP_04309457.1| hypothetical protein bcere0005_54880 [Bacillus cereus 172560W]
 gi|228601276|gb|EEK58814.1| hypothetical protein bcere0005_54880 [Bacillus cereus 172560W]
          Length = 377

 Score = 99.1 bits (245), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 38/261 (14%), Positives = 87/261 (33%), Gaps = 30/261 (11%)

Query: 1   LKAYEQGRDKWQSNTV-----HYVWFDEEPPE------DVYFEGLTRINATQG---LVTL 46
            +  +    K +S  +        WF+E              + + R     G    +  
Sbjct: 61  FRGAD-DPAKIKSIKIAKYPVTIAWFEELAEFKLEEDVSTIEKSILRKELQNGLRYKMYY 119

Query: 47  TLTPL-KGRSPIIEHYLSASSS-DRQVIRMTINETPHYNEQERKRIIDSY--PLHEREAR 102
           +  P  + +S + + + +     +  V   T ++ PH ++Q  +   ++      + E  
Sbjct: 120 SYNPPKRKQSWVNKKFETQFKPKNTFVHHSTYHDNPHISKQFVEEAEETKRLKPRQYEHE 179

Query: 103 TKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPF-AAGHLVWNRDSDVI 161
            +G+P  GSG +     +   I   +I        G+D+G+ +   + G + +++    +
Sbjct: 180 YEGKP-TGSGVVPFSNLKFRRITDEEIKSFDNIRQGIDWGYGNDALSFGRMHYDKTRRKL 238

Query: 162 YVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
           Y+       + +       +K  G      W    +  D    + +       G+K   +
Sbjct: 239 YIFGEIHGVKISNRSLAEKIKQLG------WDDVEIIADSSEPKSIDEMKNDHGIK---K 289

Query: 222 CATFDDGSNGVEAGISDMLDR 242
                 G   VE G   + D 
Sbjct: 290 IKGAVKGPGSVEYGEKWLDDL 310


>gi|66396341|ref|YP_240671.1| ORF008 [Staphylococcus phage 88]
 gi|66396415|ref|YP_240743.1| ORF009 [Staphylococcus phage 92]
 gi|62636756|gb|AAX91867.1| ORF008 [Staphylococcus phage 88]
 gi|62636829|gb|AAX91940.1| ORF009 [Staphylococcus phage 92]
          Length = 421

 Score = 99.1 bits (245), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/256 (14%), Positives = 78/256 (30%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L              +  P
Sbjct: 113 AQNPERLKSLKDSRFPFSIAWIEELAEFKTEDEVTTITNSLLRGELDEGLFYKFFFSYNP 172

Query: 51  L-KGRSPIIEHYLS-ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y S   + +  V   T    P  ++Q  +    +   +E+  R +    
Sbjct: 173 PKRKQSWVNKKYESSFQADNTYVHHSTYLNNPFISKQFIQEAESAKKRNEQRYRWEYMGE 232

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I        + +  I   +DFG+   P A     +++   VIY +  
Sbjct: 233 AIGSGVVPFNNLRIEEIPQRQYDTFDNIRNAVDFGYATDPLAFVRWHYDKKKRVIYAMDE 292

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           Y   + +       LK  G      +  D +  D    + ++   +      + +     
Sbjct: 293 YYGVQISNREFANWLKKKG------YQSDEIFADSAEPKSIAELKQEH---GIKKIKGVK 343

Query: 227 DGSNGVEAGISDMLDR 242
            G++ VE G   + D 
Sbjct: 344 KGADSVEFGEQWLDDL 359


>gi|328553958|gb|AEB24450.1| PBSX family phage terminase large subunit [Bacillus
           amyloliquefaciens TA208]
          Length = 401

 Score = 99.1 bits (245), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/259 (12%), Positives = 83/259 (32%), Gaps = 28/259 (10%)

Query: 7   GRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
              K +  T    + +E     +    E ++R +    +V +   P      +   Y+  
Sbjct: 105 SWKKARGFTSAGAFLNEATALHDSFVKEVISRCSYKGAVVMMDTNPENPMHTVKTDYIDK 164

Query: 65  SSS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFP 116
                     + +    ++ +    + +  + I+ S P     +    G  +   G I+ 
Sbjct: 165 DGQKLKSGRLNIRSFHFSLFDNNFLDPEYVESIVASTPSGMFTDRDINGYWVASEGVIYR 224

Query: 117 IVEEDIVINSLDIPEHWV-----QIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
              +DI   S +  E+          G+D+G+ HP +   +  + D    Y+++ +  + 
Sbjct: 225 DFNKDIHYISSEELENRRVNFKKYFAGVDWGYEHPGSIVVIGQD-DQGCFYLLEEHAKQH 283

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
           +   + V   K     +   + +     D    E +         +   E     +    
Sbjct: 284 EEIDYWVKVAK----GVKERYGNINFYCDSARPEHVQ--------RFRREKLRALNADKA 331

Query: 232 VEAGISDMLDRMRSGRWKV 250
           + +GI ++    +     V
Sbjct: 332 IISGIEEVARLFKRNELFV 350


>gi|294782215|ref|ZP_06747541.1| phage-associated terminase large subunit [Fusobacterium sp.
           1_1_41FAA]
 gi|294480856|gb|EFG28631.1| phage-associated terminase large subunit [Fusobacterium sp.
           1_1_41FAA]
          Length = 278

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/214 (12%), Positives = 64/214 (29%), Gaps = 21/214 (9%)

Query: 43  LVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR 102
            + ++  P   R  +   +      +   +          ++ ++K   D    + R  +
Sbjct: 17  QIIISFNPWNERHWLKGRFFDKVDDNILALTTNYQCNEWLDDADKKLFEDMKKNNPRRYQ 76

Query: 103 T--KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIG--GMDFGWH-HPFAAGHLVWNRD 157
               G   +  G ++   +E        + +        G+DFG+   P A    + +++
Sbjct: 77  VAGLGNWGIVDGLVYENWQELEFDWREILNKRQKAKAVFGLDFGYTNDPAAFFCGILDQE 136

Query: 158 SDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMK 217
              IYV      +          ++  G              D    + +    +  G+ 
Sbjct: 137 QKEIYVFDEIYQKGMQNTAIYNNIEKLGFKKEII------VADSAEPKSI-DHLKGLGLY 189

Query: 218 MLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
                     G + + AGI  + D      +K+F
Sbjct: 190 ---RIKASKKGKDSINAGIQFIQD------FKIF 214


>gi|331269396|ref|YP_004395888.1| phage terminase, large subunit, PBSX family [Clostridium botulinum
           BKT015925]
 gi|329125946|gb|AEB75891.1| phage terminase, large subunit, PBSX family [Clostridium botulinum
           BKT015925]
          Length = 419

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/238 (13%), Positives = 76/238 (31%), Gaps = 22/238 (9%)

Query: 15  TVHYVWFDEEPPEDVY------FEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            + Y+W++E    + Y       + L R    +  V  +  P + +       +  +  D
Sbjct: 134 YIKYIWYEEVDEFEGYDKIRNINQSLMR-GGPKFCVFYSFNPPESQRNWANMEVLQTRKD 192

Query: 69  RQVIRMTINETP--HYNEQERKRIIDSYPLHEREARTKGEP-ILGSGRIFPIVEEDIVIN 125
           + V        P     EQ          ++  +        + G+G           + 
Sbjct: 193 KLVHHSNYLSVPKEWLGEQFILEAEHIKKVNPTKYEHDYLGAVTGTGGEVFTNVTIRKMT 252

Query: 126 SLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
             +I        G+DFG+   P       +++    +Y+         +    V  +K  
Sbjct: 253 DEEIANFDRVHRGLDFGYASDPLHYTVNHYDKTRRRLYIFYEIHKAGMSNSSAVETIKQE 312

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
            K       ++ +  D      ++  +++ G+K++        G + VE G+  + D 
Sbjct: 313 NK------SNNRIVADSAEPRTIAE-FKKLGLKIIGA----KKGPDSVEHGVKFLQDL 359


>gi|307289456|ref|ZP_07569407.1| phage terminase large subunit [Enterococcus faecalis TX0109]
 gi|306499587|gb|EFM68953.1| phage terminase large subunit [Enterococcus faecalis TX0109]
          Length = 319

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/258 (15%), Positives = 78/258 (30%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPEDVYFE------GLTRINATQG---LVTLTLTP 50
            Q  ++ +S           W +E        E       L R     G       +  P
Sbjct: 26  AQNPERIKSLKDSRFPFAIGWIEELGEFKTEDEVTTITNSLLRGELGNGLFYKFFFSYNP 85

Query: 51  L-KGRSPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y S+   D   V   T  + P  + +  K +  +   +   AR + +  
Sbjct: 86  PKRRQSWVNKKYESSFQPDNTFVHHSTYKDNPFISREFLKEVEAARDRNPLRARWEYDGE 145

Query: 109 LGSGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P      E   I    +        G+DFG+   P A     +++  + IY V
Sbjct: 146 AIGSGVVPFSNLKVEKGCITDEMVANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAV 205

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        K+ G      +  D +  D    + ++      GM        
Sbjct: 206 DEIYGVKISNREFAQKAKAKG------YQSDRVASDSAEPKSIAELNNEHGMS---HVFG 256

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + V+ G   + D 
Sbjct: 257 VKKGPDSVQYGEEWLDDL 274


>gi|196042482|ref|ZP_03109723.1| phage terminase, large subunit, PBSX family [Bacillus cereus
           NVH0597-99]
 gi|196026639|gb|EDX65305.1| phage terminase, large subunit, PBSX family [Bacillus cereus
           NVH0597-99]
          Length = 409

 Score = 98.7 bits (244), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 38/252 (15%), Positives = 95/252 (37%), Gaps = 26/252 (10%)

Query: 9   DKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
           D  +  T +  + +E     +DV+ E  +R +     + +   P      +   Y+    
Sbjct: 118 DTIRGMTAYGAYVNEGSLANKDVFDEIKSRCSGEGARILVDTNPDHPEHWLKVDYIDKDD 177

Query: 67  S-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVEEDIVI 124
           +   +  +  +++    N++ R+RI  S P      R  KG      G ++    +D+  
Sbjct: 178 NVTIKAFQYELDDNTFLNDRYRERIKASTPTGMFYDRNIKGLWCSADGVVYKDFNKDVHY 237

Query: 125 ---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH---V 178
                L   +      G+D+G+ H  +   +  + D + +Y+++ +  + +   +     
Sbjct: 238 IEETDLKDIKFTKYFAGVDWGYEHFGSIVVIGED-DEENLYLLEEHAKQHEEIDYWVGVA 296

Query: 179 AALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
             +K     + +       +H KR        ++++G++              V +GI  
Sbjct: 297 KGVKERYGNIFFYCDTARPEHIKR--------FKKEGIRARN-------ADKSVLSGIEI 341

Query: 239 MLDRMRSGRWKV 250
           +   ++S ++KV
Sbjct: 342 VAKHIKSFKFKV 353


>gi|257079391|ref|ZP_05573752.1| terminase large subunit [Enterococcus faecalis JH1]
 gi|256987421|gb|EEU74723.1| terminase large subunit [Enterococcus faecalis JH1]
          Length = 430

 Score = 98.7 bits (244), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 35/258 (13%), Positives = 72/258 (27%), Gaps = 29/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L    A         +  P
Sbjct: 119 AQNPERIKSLKDSRFPFAIAWIEELAEFKTEDDVKTITNSLLRGELADGLFYKFFYSYNP 178

Query: 51  LKGRSPI--IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
            K R      ++  S    +  V   T  + P   +   + +  +   + + A  + +  
Sbjct: 179 PKRRQSWVNKKYESSFQPENTFVHHSTYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGK 238

Query: 109 LGSGRIFPIVEEDI---VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     +    I             G+DFG+   P A     +++  + IY +
Sbjct: 239 AIGSGVVPFDNLRVIKGCITDEMAANFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAI 298

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +        KS G      +  D +  D    + ++      GM        
Sbjct: 299 DEIYGVKISNREFANKAKSKG------YISDRIAADSAEPKSIAELNNEHGMS---HVFG 349

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + V+ G   + D 
Sbjct: 350 VKKGPDSVQYGEEWLDDL 367


>gi|119357402|ref|YP_912046.1| hypothetical protein Cpha266_1601 [Chlorobium phaeobacteroides DSM
           266]
 gi|119354751|gb|ABL65622.1| protein of unknown function DUF264 [Chlorobium phaeobacteroides DSM
           266]
          Length = 414

 Score = 98.7 bits (244), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 38/252 (15%), Positives = 76/252 (30%), Gaps = 17/252 (6%)

Query: 8   RDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGL---VTLTLTPLKGRSPIIEHYL 62
            D  +   +     DE     ++V+   L+R+   +     + LT TP +          
Sbjct: 110 PDSLKGPNIGSAGIDEPFIQQKEVFDITLSRVRHPRAKHREIFLTGTPEQLNWGHEVSQN 169

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI-LGSGRIFPIVEED 121
                D  ++     +  H   Q    +  +Y  ++R A   G  + L  GR++   +  
Sbjct: 170 DEGRYDLGLVVGRTADNVHLPGQFVSMLERAYDENQRAAYMNGLFVNLTVGRVYSYFDRS 229

Query: 122 IVI---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
           + +              + G+DF   H  A    VW    D ++       R  T     
Sbjct: 230 VHMGGAGLGGDGADGEVVAGIDFNVDHLTAVVLRVW---GDRVHCFDEMVLRGSTTYELA 286

Query: 179 AALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
             L      +       G      + +      + +G ++             V+  +  
Sbjct: 287 DRLYERFPGIRVFPDPSGGARRTSAPKTDVRILQDKGFRVEMRPKQPP-----VKDRVHA 341

Query: 239 MLDRMRSGRWKV 250
           +   +R GR  V
Sbjct: 342 VQKLLREGRLSV 353


>gi|167770494|ref|ZP_02442547.1| hypothetical protein ANACOL_01839 [Anaerotruncus colihominis DSM
           17241]
 gi|167667089|gb|EDS11219.1| hypothetical protein ANACOL_01839 [Anaerotruncus colihominis DSM
           17241]
          Length = 418

 Score = 98.7 bits (244), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 67/238 (28%), Gaps = 22/238 (9%)

Query: 15  TVHYVWFDEEPPEDVYFEGLTRI-----NATQGLVTLTLTPLKGRSPIIEHYLSASSSDR 69
              Y+WF+E    D   E          ++ +  V  +  P K     I + +     D+
Sbjct: 126 YFKYIWFEEADQYDDMEEIRKVTQSVIRSSGKPKVFYSYNPPKSVQSWINNEILIPRKDQ 185

Query: 70  QVIRMTINETP--HYNEQERKRIIDSYP--LHEREARTKGEPILGSGRIFPIVEEDIVIN 125
            V   T  + P     +Q                     GE + G+G           I 
Sbjct: 186 IVHHSTYLDVPKAWLGDQFLTEAEHLKNVKPDAYRHEYLGE-VTGTGGEVFDNIRLEEIT 244

Query: 126 SLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
              I        G D+G+   P A   L +++    +Y+         +       ++  
Sbjct: 245 EEQIFRFDNIRQGNDWGYAADPAAWARLYYDKTRRCVYLFGEIYSTGLSNRRLCEEVRKR 304

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                  W +     D    + +    +  G+ M         G   +E GI  + D 
Sbjct: 305 ------RWEYPASTADSAEPKSIDEC-QSYGVPMRAA----VKGPGSIETGIKFLQDL 351


>gi|240140465|ref|YP_002964944.1| Phage terminase, large subunit, PBSX [Methylobacterium extorquens
           AM1]
 gi|240010441|gb|ACS41667.1| Phage terminase, large subunit, PBSX [Methylobacterium extorquens
           AM1]
          Length = 422

 Score = 98.7 bits (244), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/237 (13%), Positives = 73/237 (30%), Gaps = 15/237 (6%)

Query: 16  VHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +   W +E        + + +  I      + +T  P     P  + ++    +D +V+R
Sbjct: 112 IDVCWVEEAQTVSNASWSKLIPTIRKDGSEIWVTFNPELDTDPTYQRFVVNPPADAKVVR 171

Query: 74  MTINETPHYNEQERKRI--IDSYPLHEREARTKG-EPILGSGRIFPIVEEDIVINSLDIP 130
           +  ++ P + E  R+    + +          +G       G ++     +         
Sbjct: 172 LNWSDNPWFPEVLRREKDELAARDPDAYLNVWEGATRQTLDGAVYAKEMREAAAEGRIGR 231

Query: 131 EHWVQIGGMDFGWHHPFAAGHLVW--NRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWL 188
             + +   +   W   +A    +W          V+      ++     V  L+S G   
Sbjct: 232 VQYDRTKPVHTAWDLGWADCTSIWFAQAVGGEFRVIDFLEVSQRAIPDIVKTLQSKGYVY 291

Query: 189 PWAW-PHDGLQHD-KRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
              + PHD      + +G  ++   R  G  ++ +          V  GI+      
Sbjct: 292 GNDYLPHDADSSTLQGNGRTIAQMMRSLGRNVIVQPRR------DVIEGINAARTLF 342


>gi|257451768|ref|ZP_05617067.1| putative phage terminase large subunit [Fusobacterium sp. 3_1_5R]
          Length = 435

 Score = 98.3 bits (243), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 71/237 (29%), Gaps = 24/237 (10%)

Query: 16  VHYVWFDEEPPE------DVYFEGLTRINATQGLVT---LTLTPLKGRSPI--IEHYLSA 64
           + Y W +E          ++  + + R   +  L     L+  P K R      ++ +  
Sbjct: 138 IAYFWIEEAAEFLTEEEIEIVIKSVLRGKISDNLKYKGFLSYNPPKQRHHWINKKYGVIQ 197

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
                 +      + P+ +E+      +           +       G + P     I  
Sbjct: 198 KQETSFIHHSCYTDNPYLSEEFILEAEEKKKKDPVGYDWEYLGEPVGGGVVPFPRLHIGK 257

Query: 125 NSLDIPEHWVQIG-GMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
               +         G+D+G+   P A     ++R    IY +  +   +++      A+K
Sbjct: 258 IPDLLIRTLDTFRNGVDWGYAVDPVAFVRWGYDRMRKRIYAISEFYGVQKSNEVLAKAIK 317

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
              K             D    + ++   R  G++      +   G   VE+G   +
Sbjct: 318 KQIKRNETV------TCDSAEPKSVAE-LRSYGIRA----YSAKKGKGSVESGEKWL 363


>gi|299067126|emb|CBJ38322.1| putative phage terminase large subunit [Ralstonia solanacearum
           CMR15]
          Length = 467

 Score = 98.3 bits (243), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 38/312 (12%), Positives = 79/312 (25%), Gaps = 67/312 (21%)

Query: 3   AYEQGRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQG-----------LVTLTLT 49
            YE+   K+Q   +H +  DE       +Y     R                  +     
Sbjct: 107 QYEKDVIKYQGAQIHVLLIDELTHFTEKIYRYLRGRCRLGGLKIPERYRGLFPRIVCGSN 166

Query: 50  PLKGRSPIIE--------------HYLSASSSDRQVIRMTINETPHY---NEQERKRIID 92
           P       ++                       RQ I   +++ P     +      +  
Sbjct: 167 PGGVGHNWVKASFIDIAPPKAITQMPPKEGGKRRQYIPARLDDNPSMAESDPDYADTLEG 226

Query: 93  SYPLHEREARTKGEPILGSGRIFP--IVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAG 150
                   A   G+  + +G +F         V+    IP  W    G D+G   PF+  
Sbjct: 227 LGNPELVRAMKDGDWDIVAGGMFDDLWHRSTHVLAPFAIPSSWRIDRGFDWGSSKPFSVV 286

Query: 151 HLV--------------WNRDSDVIYVVKNYR--------CREQTPIFHVAALKSWGKWL 188
                             +     I+ +  +           +   +     +    K +
Sbjct: 287 WFAESDGTAATMLDGSQRHFPRGSIFAIAEWYGWNGKPNEGCKMLAVDIAREIVKREKEM 346

Query: 189 PWAWPH---DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRS 245
           P+       D    D ++G  ++    ++ +K      +          G   +   ++ 
Sbjct: 347 PYQVRPGPADTSIFDTQNGMCIADDMLKERVKWSKADKS----PGSRRNGWEMIRKLLKQ 402

Query: 246 GR------WKVF 251
            R      + VF
Sbjct: 403 ARDRELPGFYVF 414


>gi|261495269|ref|ZP_05991723.1| bacteriophage terminase large subunit [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261309094|gb|EEY10343.1| bacteriophage terminase large subunit [Mannheimia haemolytica
           serotype A2 str. OVINE]
          Length = 406

 Score = 98.3 bits (243), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 73/239 (30%), Gaps = 20/239 (8%)

Query: 18  YVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE     E  + + +  +      + +T  P    S     +      +  +I M+
Sbjct: 124 IAWIDEAETVSETAWRKLIPTVRENNSEIWVTWNPENRGSATDTRFRQNPPENSCIIEMS 183

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
             + P +    EQER                +G  +  S        +   +  +  P+ 
Sbjct: 184 YQDNPWFPDVLEQERLNDKQRLDDATYRWIWEGAYLEAS-EAQIFRGKYQEMEFVPNPDF 242

Query: 133 WVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
                G+DFG+   P AA        +  +Y+                 +    K +P  
Sbjct: 243 DGPYYGLDFGFAQDPTAAVKCWVF--NGDLYIEFEAGKVGLELDDTADFI---AKGVPQI 297

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
             H  ++ D    E +S   +R G+   P     D     VE GI  +      G+  +
Sbjct: 298 ADH-VVRADSARPESIS-YLKRHGL---PRIIGVDKWKGSVEDGIEHIKSY---GKVFI 348


>gi|149915264|ref|ZP_01903792.1| Phage terminase, large subunit, PBSX [Roseobacter sp. AzwK-3b]
 gi|149810985|gb|EDM70824.1| Phage terminase, large subunit, PBSX [Roseobacter sp. AzwK-3b]
          Length = 468

 Score = 98.3 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/284 (15%), Positives = 82/284 (28%), Gaps = 45/284 (15%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDV---YFEGLTRINATQGLVTLTLTPL---KGRSP 56
           +  R K++    +Y+ FDE    P DV   Y     R         +  T      G+  
Sbjct: 120 DADRLKYRGRAWNYIGFDELTLWPTDVCYLYLFSRCRSTDQTLPRYIRATTNPDGPGQLW 179

Query: 57  IIEHYLSASSS--------------------DRQVIRMTINETPHYNEQERKRIIDSYPL 96
           +++ +                           R  I   ++E PH +E   +  +     
Sbjct: 180 VMKRWGIQEDGSATRIPVDVEDKEKGVTTTFHRTFIPARLSENPHLSETGYREALLQLAP 239

Query: 97  HEREARTKGEP--ILGSGRIFPIVEEDIVI----NSLDIPEHWVQIGGMDFGWHHPFAAG 150
            ER+A   G        G  +     ++       S+            D GW+   A  
Sbjct: 240 DERDALLMGLWRQGRVHGAYYANEMAEMRNRGGIRSVPYDPSEPVNTFWDLGWNDTTAIW 299

Query: 151 HLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWL---PWAWPHDGLQHDKRSGEQL 207
                + +     ++ Y    ++   +   L++ G  L       PHD      ++G+  
Sbjct: 300 F--HQQIAGEHRFIRAYENSGESLDHYATYLQNSGFNLMGGRHYLPHDARNKSLQTGKSA 357

Query: 208 SAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
               +     +             +  GI+     M   R KVF
Sbjct: 358 LEILQEMLPNL---NFEVVPRIQNILTGINQTRLAM---RGKVF 395


>gi|149915036|ref|ZP_01903565.1| Phage terminase, large subunit, PBSX [Roseobacter sp. AzwK-3b]
 gi|149811224|gb|EDM71061.1| Phage terminase, large subunit, PBSX [Roseobacter sp. AzwK-3b]
          Length = 468

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/284 (15%), Positives = 82/284 (28%), Gaps = 45/284 (15%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDV---YFEGLTRINATQGLVTLTLTPL---KGRSP 56
           +  R K++    +Y+ FDE    P DV   Y     R         +  T      G+  
Sbjct: 120 DADRLKYRGRAWNYIGFDELTLWPTDVCYLYLFSRCRSTDQTLPRYIRATTNPDGPGQLW 179

Query: 57  IIEHYLSASSS--------------------DRQVIRMTINETPHYNEQERKRIIDSYPL 96
           +++ +                           R  I   ++E PH +E   +  +     
Sbjct: 180 VMKRWGIQEDGSATRIPVDVEDKEKGVTTTFHRTFIPARLSENPHLSETGYREALLQLAP 239

Query: 97  HEREARTKGEP--ILGSGRIFPIVEEDIVI----NSLDIPEHWVQIGGMDFGWHHPFAAG 150
            ER+A   G        G  +     ++       S+            D GW+   A  
Sbjct: 240 DERDALLMGLWRQGRVHGAYYANEMAEMRNRGGIRSVPYDPSEPVNTFWDLGWNDTTAIW 299

Query: 151 HLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWL---PWAWPHDGLQHDKRSGEQL 207
                + +     ++ Y    ++   +   L++ G  L       PHD      ++G+  
Sbjct: 300 F--HQQIAGEHRFIRAYENSGESLDHYATYLQNSGFNLMGGRHYLPHDARNKSLQTGKSA 357

Query: 208 SAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
               +     +             +  GI+     M   R KVF
Sbjct: 358 LEILQEMLPNL---NFEVVPRIQNILTGINQTRLAM---RGKVF 395


>gi|66395973|ref|YP_240307.1| ORF008 [Staphylococcus phage ROSA]
 gi|62636393|gb|AAX91504.1| ORF008 [Staphylococcus phage ROSA]
          Length = 421

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/256 (13%), Positives = 75/256 (29%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L              +  P
Sbjct: 113 AQNPERLKSLKDSRFPFSIAWIEELAEFKTEDEVTTITNSLLRGELDEGLFYKFFFSYNP 172

Query: 51  L-KGRSPIIEHYLS-ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y S   + +  V   T    P  ++Q  +    +   +E+  R +    
Sbjct: 173 PKRKQSWVNKKYESSFQADNTFVHHSTYLNNPFISKQFIQEAESAKKRNEQRYRWEYMGE 232

Query: 109 LGSGRIFPIVEEDIVINSL-DIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I                 +DFG+   P A     +++   VIY +  
Sbjct: 233 AIGSGVVPFNNLRIEEIPQGQYDTFDNIRNAVDFGYATDPLAFVRWHYDKKKRVIYAMDE 292

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           +   + +       LK  G      +  D +  D    + ++   +      + +     
Sbjct: 293 HYGVQISNREFANWLKKKG------YQSDEIFADSAEPKSIAELKQEH---GIKKVKAVK 343

Query: 227 DGSNGVEAGISDMLDR 242
            G++ VE G   + D 
Sbjct: 344 KGADSVEYGEQWLDDL 359


>gi|316933861|ref|YP_004108843.1| bacteriophage terminase large subunit-like protein
           [Rhodopseudomonas palustris DX-1]
 gi|315601575|gb|ADU44110.1| bacteriophage terminase large subunit-like protein
           [Rhodopseudomonas palustris DX-1]
          Length = 504

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/298 (15%), Positives = 80/298 (26%), Gaps = 60/298 (20%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQG-----------LVTLTLTPL 51
           E+ R K+Q   +H +  DE       +Y     R+                 +     P 
Sbjct: 118 ERHRFKYQGAEIHVLLIDELTHFTEVIYRFLRNRVRMVGITLPAQYVGKFPRIICGANPG 177

Query: 52  KGRSPIIEHYLSASSSD--------------RQVIRMTINETPHYNEQE---RKRIIDSY 94
                 ++                       RQ I   + + P   EQ+     R+    
Sbjct: 178 HIGHQFVKATFIDGVKPLAIYRAANDEGGMLRQYIPARLEDNPSMAEQDPGYEARLCGLG 237

Query: 95  PLHEREARTKGEPILGSGRIFPIVEED-IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV 153
                 A   G+  +  G  F   +    VI    IP+ W++    D+G   PF+ G   
Sbjct: 238 SEALVRAMRDGDWDIIEGAFFDCFDRKRHVIKPFTIPKRWLRFRAGDWGSAKPFSFGWYC 297

Query: 154 WNRD-----------SDVIYVVKNYRCR--------------EQTPIFHVAALKSWGKWL 188
              D              +   + +                 + +       ++      
Sbjct: 298 VVEDDFLTPCGRLLPRGCLIRYREWYGVKTDAQGKFKPNVGLKMSNDAMGRGVRLRDYDD 357

Query: 189 PWAWPH-DGLQHDKRSGEQLSAQYRR--QGMKMLPECATFDDGSNGVEAGISDMLDRM 243
             A+   D        G  ++ Q +   +G    P   T   G   +  G S M DRM
Sbjct: 358 RIAYGKLDPACFANDGGPSIAEQMQAGGKGASFTPADNTRVAGRGAI-GGWSQMRDRM 414


>gi|66396048|ref|YP_240381.1| ORF008 [Staphylococcus phage 71]
 gi|62636467|gb|AAX91578.1| ORF008 [Staphylococcus phage 71]
          Length = 421

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/256 (13%), Positives = 75/256 (29%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L              +  P
Sbjct: 113 AQNPERLKSLKDSRFPFSVAWIEELAEFKTEDEVTTITNSLLRGELDEGLFYKFFFSYNP 172

Query: 51  L-KGRSPIIEHYLS-ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y S   + +  V   T    P  ++Q  +    +   +E+  R +    
Sbjct: 173 PKRKQSWVNKKYESSFQADNTFVHHSTYLNNPFISKQFIQEAESAKKRNEQRYRWEYMGE 232

Query: 109 LGSGRIFPIVEEDIVINSL-DIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I                 +DFG+   P A     +++   VIY +  
Sbjct: 233 AIGSGVVPFNNLRIEEIPQGQYDTFDNIRNAVDFGYATDPLAFVRWHYDKKKRVIYAMDE 292

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           +   + +       LK  G      +  D +  D    + ++   +      + +     
Sbjct: 293 HYGVQISNREFANWLKKKG------YQSDEIFADSAEPKSIAELKQEH---GIKKVKAVK 343

Query: 227 DGSNGVEAGISDMLDR 242
            G++ VE G   + D 
Sbjct: 344 KGADSVEYGEQWLDDL 359


>gi|157265379|ref|YP_001467938.1| terminase large subunit [Thermus phage P23-45]
 gi|156905274|gb|ABU96918.1| terminase large subunit [Thermus phage P23-45]
          Length = 485

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/276 (16%), Positives = 89/276 (32%), Gaps = 37/276 (13%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIE 59
           K+ ++  D  +  T+ +V  DE    P  V+ E +    + +    L ++  KG +   E
Sbjct: 130 KSADR-PDNLRGATLDFVILDEAAMIPFSVWSEAIEPTLSVRDGWALIISTPKGLNWFYE 188

Query: 60  HYLS----------------ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART 103
            +L                  +  D +       +      +         P  E     
Sbjct: 189 FFLMGWRGGLKEGIPNSGVNQTHPDFESFHAASWDVWPERREWYMERRLYIPDLEFRQEY 248

Query: 104 KGEPILGSGRIFPIVEEDIVINS---------LDIPEHWVQIGGMDFGWHHPFAAGHLVW 154
             E +  S  +F  ++  I++            D     +   G DFG +  ++    V 
Sbjct: 249 GAEFVSHSNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSV-FSVL 307

Query: 155 NRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
           + D+  I  ++  R    T    VA LK+  +    A+           G+ ++ +   Q
Sbjct: 308 DLDTGAIVCLE--RMNGATWSDQVARLKALSEDYGHAYVVADTW---GVGDAIAEELDAQ 362

Query: 215 GMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
           G+   P            E  IS++   M  G+  V
Sbjct: 363 GINYTPLPVKSSSVK---EQLISNLALLMEKGQVAV 395


>gi|317058325|ref|ZP_07922810.1| conserved hypothetical protein [Fusobacterium sp. 3_1_5R]
 gi|313684001|gb|EFS20836.1| conserved hypothetical protein [Fusobacterium sp. 3_1_5R]
          Length = 423

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 71/237 (29%), Gaps = 24/237 (10%)

Query: 16  VHYVWFDEEPPE------DVYFEGLTRINATQGLVT---LTLTPLKGRSPI--IEHYLSA 64
           + Y W +E          ++  + + R   +  L     L+  P K R      ++ +  
Sbjct: 126 IAYFWIEEAAEFLTEEEIEIVIKSVLRGKISDNLKYKGFLSYNPPKQRHHWINKKYGVIQ 185

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
                 +      + P+ +E+      +           +       G + P     I  
Sbjct: 186 KQETSFIHHSCYTDNPYLSEEFILEAEEKKKKDPVGYDWEYLGEPVGGGVVPFPRLHIGK 245

Query: 125 NSLDIPEHWVQIG-GMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
               +         G+D+G+   P A     ++R    IY +  +   +++      A+K
Sbjct: 246 IPDLLIRTLDTFRNGVDWGYAVDPVAFVRWGYDRMRKRIYAISEFYGVQKSNEVLAKAIK 305

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
              K             D    + ++   R  G++      +   G   VE+G   +
Sbjct: 306 KQIKRNETV------TCDSAEPKSVAE-LRSYGIRA----YSAKKGKGSVESGEKWL 351


>gi|253731492|ref|ZP_04865657.1| pbsx family phage terminase, large subunit [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253724735|gb|EES93464.1| pbsx family phage terminase, large subunit [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
          Length = 407

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/253 (13%), Positives = 83/253 (32%), Gaps = 21/253 (8%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G    +  T    + +E     E+V+ E  +R + T   + +   P      +++ Y+ 
Sbjct: 116 SGIGAIRGMTSFGAYINEASLAHEEVFDEIKSRCSGTGARILVDTNPDHPEHWLLKDYIE 175

Query: 64  ASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVE- 119
            +         +  +++    N++ ++ I  S P      R   G  + G G ++   + 
Sbjct: 176 NTDPKAGILSHQFKLDDNNFLNDRYKESIKASTPSGMFYERNINGMWVSGDGVVYADFDL 235

Query: 120 --EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH 177
               I  + LD         G+D+G+ H  +   +    D +  Y ++ +  + +     
Sbjct: 236 NENTIKADELDDIPIKEYFAGVDWGYEHYGSIVLIGRGIDGN-FYFIEEHAHQFKFIDDW 294

Query: 178 VAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
           V   K     +   + +     D    E ++                  +      +G+ 
Sbjct: 295 VVIAK----DIVSRYGNINFYCDTARPEYITE--------FRRHRLRAINADKSKLSGVE 342

Query: 238 DMLDRMRSGRWKV 250
           ++    +  +  V
Sbjct: 343 EVAKLFKQNKLLV 355


>gi|157265496|ref|YP_001468054.1| phage terminase large subunit [Thermus phage P74-26]
 gi|156905391|gb|ABU97034.1| phage terminase large subunit [Thermus phage P74-26]
          Length = 485

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/276 (16%), Positives = 89/276 (32%), Gaps = 37/276 (13%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIE 59
           K+ ++  D  +  T+ +V  DE    P  V+ E +    + +    L ++  KG +   E
Sbjct: 130 KSADR-PDNLRGATLDFVILDEAAMIPFSVWSEAIEPTLSVRDGWALIISTPKGLNWFYE 188

Query: 60  HYLS----------------ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART 103
            +L                  +  D +       +      +         P  E     
Sbjct: 189 FFLMGWRGGLKEGIPNSGINQTHPDFESFHAASWDVWPERREWYMERRLYIPDLEFRQEY 248

Query: 104 KGEPILGSGRIFPIVEEDIVINS---------LDIPEHWVQIGGMDFGWHHPFAAGHLVW 154
             E +  S  +F  ++  I++            D     +   G DFG +  ++    V 
Sbjct: 249 GAEFVSHSNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSV-FSVL 307

Query: 155 NRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
           + D+  I  ++  R    T    VA LK+  +    A+           G+ ++ +   Q
Sbjct: 308 DLDTGAIVCLE--RMNGATWSDQVARLKALSEDYGHAYVVADTW---GVGDAIAEELDAQ 362

Query: 215 GMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
           G+   P            E  IS++   M  G+  V
Sbjct: 363 GINYTPLPVKSSSVK---EQLISNLALLMEKGQVAV 395


>gi|307128279|ref|YP_003880310.1| phage terminase large subunit [Streptococcus pneumoniae 670-6B]
 gi|306485341|gb|ADM92210.1| phage terminase, large subunit, pbsx family [Streptococcus
           pneumoniae 670-6B]
 gi|321157268|emb|CBW39251.1| Phage terminase large subunit [Streptococcus phage 2167]
          Length = 432

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 75/260 (28%), Gaps = 30/260 (11%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQ---GLVTL 46
            +  +    K  S TV      + WF+E      E       E +            +T+
Sbjct: 116 FRGLD-DELKITSITVDIGSLCWAWFEEAYQIETEDKFSTVVESIRGSLDVPDFFKQITV 174

Query: 47  TLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART- 103
           T  P   R  +   +       +D      T       +  + KR  D Y  + R AR  
Sbjct: 175 TFNPWNERHWLKRVFFDEETRRADTFATTTTYKCNEWLDGVDIKRYEDLYHTNPRRARIV 234

Query: 104 -KGEPILGSGRIFPI-VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDV 160
             GE  +  G I+     +D   + L          G+DFG+   P A    + N  +  
Sbjct: 235 CDGEWGVAEGLIYENVTVKDFDKDELLRDSANKLCIGLDFGFTHDPTALCCSLINDTTKE 294

Query: 161 IYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLP 220
           IYV                 +K  G           +  D      +       G+    
Sbjct: 295 IYVFDEAYKVGLITKEVAKMIKDKGYHR------SQIIADSAESRLIEELRSEHGIS--- 345

Query: 221 ECATFDDGSNGVEAGISDML 240
                  G + + AG+S + 
Sbjct: 346 RIKESRKGKDSIMAGVSKLQ 365


>gi|289167314|ref|YP_003445583.1| terminase large subunit [Streptococcus mitis B6]
 gi|288906881|emb|CBJ21715.1| terminase large subunit [Streptococcus mitis B6]
          Length = 418

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/256 (13%), Positives = 70/256 (27%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L              +  P
Sbjct: 111 AQDPERIKSLKDSRFPFAIGWIEELAEFKTEDEVKTITNSLLRGELDDGLFYKFFYSYNP 170

Query: 51  L-KGRSPIIEHYLS-ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y S     +  V   T  + P+ ++   +    +    E+  R +    
Sbjct: 171 PKRKQSWVNKKYESVIQPPNTHVHHSTYLDNPYISQAFIEEAEATRERSEKRYRWEYLGE 230

Query: 109 L-GSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKN 166
             GSG           I   +I        G DFG+   P A     +++   VIY +  
Sbjct: 231 AIGSGVAPFENLVFRKITDEEIARFDNIRQGNDFGYANDPLAFVRWHYDKKKRVIYAIDE 290

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
               + +       ++  G              D    + +     +     +P      
Sbjct: 291 IYGVKISNRELAERIREKGYQSQMI------TCDSAEPKSIDELKLQL---NIPLVQGAK 341

Query: 227 DGSNGVEAGISDMLDR 242
            G +  E G   + D 
Sbjct: 342 KGPDSREYGERWLDDL 357


>gi|255103025|ref|ZP_05332002.1| phage terminase, large subunit, pbsx family protein [Clostridium
           difficile QCD-63q42]
          Length = 413

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/237 (12%), Positives = 66/237 (27%), Gaps = 26/237 (10%)

Query: 19  VWFDEEPPED--VYFEGLTRINATQG---LVTLTLTPLKGRSPIIEHYL--------SAS 65
           +W +E    D     +   R+         +TL+  P+     +   Y            
Sbjct: 130 IWVEEATETDYKAVKQLDKRLRGKSKVVKRLTLSFNPILKDHWLYTEYFDIWEDDKQYVE 189

Query: 66  SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +  +++ T  +     E + K + +    +  E  T G   +    IF     +   +
Sbjct: 190 KDNVSILKTTYKDNKFLAEDDIKALENESDKYYYEVYTLGNWGVLGAVIFKNWRVEDFSD 249

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG 185
                +++       F    PFA     ++R    +Y+                 +    
Sbjct: 250 IESTFDNFRHGIDWGFA-DDPFAYVKSHYDRMRRKLYICDEIEAVGLLNREAAPLVSKKA 308

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                    D +  D  S + ++         +     +   G+  +E GI  +   
Sbjct: 309 NG-------DLVICDNASPKDVAEF-----SDLRINAVSARKGAGSIEYGIKFLQGL 353


>gi|257463372|ref|ZP_05627768.1| putative phage terminase large subunit [Fusobacterium sp. D12]
          Length = 435

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 71/237 (29%), Gaps = 24/237 (10%)

Query: 16  VHYVWFDEEPPE------DVYFEGLTRINATQGLVT---LTLTPLKGRSPI--IEHYLSA 64
           + Y W +E          ++  + + R   +  L     L+  P K R      ++ +  
Sbjct: 138 IAYFWIEEAAEFLTEEEIEIVIKSVLRGKISDNLKYKGFLSYNPPKQRHHWINKKYGVIQ 197

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
                 +      + P+ +E+      +           +       G + P     I  
Sbjct: 198 KQETSFIHHSCYTDNPYLSEEFILEAEEKKKKDPVGYDWEYLGEPVGGGVVPFPRLHIGK 257

Query: 125 NSLDIPEHWVQIG-GMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
               +         G+D+G+   P A     ++R    IY +  +   +++      A+K
Sbjct: 258 IPDSLIRTLDTFRNGVDWGYAVDPVAFVRWGYDRMRKRIYAISEFYGVQKSNEVLAKAIK 317

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
              K             D    + ++   R  G++      +   G   VE+G   +
Sbjct: 318 KQIKRNETV------TCDSAEPKSVAD-LRSYGIRA----YSAKKGKGSVESGEKWL 363


>gi|149914795|ref|ZP_01903325.1| Phage terminase, large subunit, PBSX [Roseobacter sp. AzwK-3b]
 gi|149811588|gb|EDM71423.1| Phage terminase, large subunit, PBSX [Roseobacter sp. AzwK-3b]
          Length = 467

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/284 (15%), Positives = 83/284 (29%), Gaps = 45/284 (15%)

Query: 5   EQGRDKWQSNTVHYVWFDE--EPPEDV---YFEGLTRINATQGLVTLTLTPL---KGRSP 56
           +  R K++    +Y+ FDE    P DV   Y     R         +  T      G+  
Sbjct: 119 DADRLKYRGRAWNYIGFDELTLWPTDVCYLYLFSRCRSTDPTLPRLIRATTNPDGPGQGW 178

Query: 57  IIEHYLSASS--------------------SDRQVIRMTINETPHYNEQERKRIIDSYPL 96
           ++E +                         S R  I   ++E PH +E   +  +     
Sbjct: 179 VMERWGIKEDGQATRVPIDTVDAEMRRITTSYRTFIPARLSENPHLSETGYREALLQLAP 238

Query: 97  HEREARTKGEP--ILGSGRIFPIVEEDIVI----NSLDIPEHWVQIGGMDFGWHHPFAAG 150
            ER+A   G        G  +     ++       S+            D GW+   A  
Sbjct: 239 DERDALLMGLWRQGRVHGAYYANEMAEMRNRGGIRSVPYDPSEPVNSFWDLGWNDTTAIW 298

Query: 151 HLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWL---PWAWPHDGLQHDKRSGEQL 207
                + +     ++ Y    ++   +   L++ G  +       PHD      ++G+  
Sbjct: 299 F--HQQIAGEHRFIRAYENSGESLDHYATYLQNSGFNVMGGRHFLPHDAQNKSLQTGKSA 356

Query: 208 SAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
               +     +             +  GI+     M   R KVF
Sbjct: 357 LELLQEMLPNL---HFEVVPRIQNILIGINQTRLAM---RGKVF 394


>gi|229187826|ref|ZP_04314951.1| Phage terminase, large subunit, pbsx [Bacillus cereus BGSC 6E1]
 gi|228595661|gb|EEK53356.1| Phage terminase, large subunit, pbsx [Bacillus cereus BGSC 6E1]
          Length = 404

 Score = 97.5 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 91/248 (36%), Gaps = 20/248 (8%)

Query: 9   DKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
           D  +  T +  + +E     +DV+ E  +R +     + +   P      +   Y+    
Sbjct: 116 DTIRGMTAYGAYVNEGSLANKDVFDEIKSRCSGEGARILVDTNPDHPEHWLKVDYIDKDD 175

Query: 67  S-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVEEDIVI 124
           S   +  +  +++    N++ R+RI  S P      R  KG      G ++    +D+  
Sbjct: 176 SVTIKAFQYELDDNTFLNDRYRERIKASTPTGMFYDRNIKGLWCSADGVVYKDFNKDVHY 235

Query: 125 ---NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
                L   +      G+D+G+ H  +   +  + D + +Y+++ +  + +   + V   
Sbjct: 236 IEETDLKDIKFTKYFAGVDWGYEHFGSIVVIGED-DEENLYLLEEHAKQHEEIDYWVGVA 294

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
           K     +   + +     D    E +         +   E     +    V +GI ++  
Sbjct: 295 K----DVKSRYGNIFFYCDTARPEHIK--------RFKKEGIKARNADKSVLSGIEEVAK 342

Query: 242 RMRSGRWK 249
            ++S ++K
Sbjct: 343 HIKSFKFK 350


>gi|116629265|ref|YP_814437.1| Phage terminase large subunit [Lactobacillus gasseri ATCC 33323]
 gi|116629325|ref|YP_814497.1| Phage terminase large subunit, ATPase [Lactobacillus gasseri ATCC
           33323]
 gi|116094847|gb|ABJ59999.1| Phage terminase large subunit [Lactobacillus gasseri ATCC 33323]
 gi|116094907|gb|ABJ60059.1| Phage terminase large subunit, ATPase [Lactobacillus gasseri ATCC
           33323]
          Length = 414

 Score = 97.5 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/252 (13%), Positives = 83/252 (32%), Gaps = 19/252 (7%)

Query: 6   QGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           +G    +  T +    DE     + V+ E + R +     + +T  P    + I   Y+ 
Sbjct: 122 RGIGSIRGATAYGALIDEGTLADQGVFQEIINRCSIEGARIVVTSNPDAPTNFIKTEYID 181

Query: 64  ASSSD--RQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIF-PIVE 119
                   +V   TI +    ++     ++ + P     +    G+ +   G+IF     
Sbjct: 182 NHDPKARIKVFNFTIFDNTFLSKDYVDALVAATPSGMYTDRTIYGKWVSAEGQIFSDFNI 241

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPF-AAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
           E + I +  +PE       +D+G+         L  + ++   Y++K +    +   + +
Sbjct: 242 ETMTITTDQLPEMVKYYASIDWGFGKGHKGVIQLFGDDENGTSYLIKEWAHEHRFIDYWI 301

Query: 179 AALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
              K   +             D    +    Q +  G+  +            V +G+  
Sbjct: 302 DVAKEIKQKYGNIV----FWADSARVD-YVNQMQANGINCINANKN-------VLSGLEF 349

Query: 239 MLDRMRSGRWKV 250
           +    + G+  +
Sbjct: 350 VDSYFKQGKLII 361


>gi|283770989|ref|ZP_06343880.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           H19]
 gi|283459583|gb|EFC06674.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           H19]
          Length = 407

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/253 (13%), Positives = 83/253 (32%), Gaps = 21/253 (8%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G    +  T    + +E     E+V+ E  +R + T   + +   P      +++ Y+ 
Sbjct: 116 SGIGAIRGMTSFGAYINEASLAHEEVFDEIKSRCSGTGARILVDTNPDHPEHWLLKDYIE 175

Query: 64  ASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVE- 119
            +         +  +++    N++ ++ I  S P      R   G  + G G ++   + 
Sbjct: 176 NTDPKAGILSHQFKLDDNNFLNDRYKESIKASTPSGMFYERNINGMWVSGDGVVYADFDL 235

Query: 120 --EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH 177
               I  + LD         G+D+G+ H  +   +    D +  Y ++ +  + +     
Sbjct: 236 NENTIKADELDDIPIKEYFAGVDWGYEHYGSIVLIGRGIDGN-FYFIEEHAHQFKFIDDW 294

Query: 178 VAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
           V   K     +   + +     D    E ++                  +      +G+ 
Sbjct: 295 VDIAK----DVVSRYGNINFYCDTARPEYITE--------FRRHRLRAINADKSKLSGVE 342

Query: 238 DMLDRMRSGRWKV 250
           ++    +  +  V
Sbjct: 343 EVAKLFKQNKLLV 355


>gi|134095464|ref|YP_001100539.1| putative terminase, large subunit [Herminiimonas arsenicoxydans]
 gi|133739367|emb|CAL62417.1| Conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 437

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/295 (12%), Positives = 85/295 (28%), Gaps = 49/295 (16%)

Query: 1   LKAYEQGRD---KWQSNTVHYVWFDEEPPE---DVYFEGLTRINATQGLV----TLTLTP 50
              Y +  D    +  +   +  ++E         +    +   ++   +      T  P
Sbjct: 78  FFRYGESEDDYWNYHGHEYPWQGYEELTNWRDPTFFEAMASTCRSSFPGMPRRRRATCNP 137

Query: 51  LKGRSPIIEHYLSASSSD--------------RQVIRMTINETPHY---NEQERKRIIDS 93
                  ++      +                R  IR +I+E  H    +    K +   
Sbjct: 138 FGRGHGWVKERYDLGTGGTPSGQVIRLEGEQPRVRIRSSIHENTHLLESDPDYLKTLEAL 197

Query: 94  YPLHEREARTKGEPILGSGRIF--PIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGH 151
              + R A  +G+  +  G  F      +  +++   IP  W     MD+G+  P+    
Sbjct: 198 KDPNRRRAWLEGDWDIHVGSFFEGVWDAKRHIVDPFPIPASWQVWKAMDWGFAAPYCVLW 257

Query: 152 LVWNRDSDVIYVVKNYRCREQT--------PIFHVAALK-------SWGKWLPWAWPHDG 196
           L  + D   IYV +      +                ++         G           
Sbjct: 258 LAMDPDG-CIYVWRELYGAGEKVGEGSREHADVVAKKVRTIEERDERLGYEYRMNLADPS 316

Query: 197 LQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
           +  +      + A +R+ G+K         +    +  G  +++  M   + K+F
Sbjct: 317 IFSNTGVNTTIGAIFRKAGVKWQEAW----NAKGSIANGAQEIMRLMGDDKLKIF 367


>gi|66395894|ref|YP_240228.1| ORF009 [Staphylococcus phage 96]
 gi|122891825|ref|YP_001004370.1| large terminase [Staphylococcus phage phiETA3]
 gi|151220501|ref|YP_001331323.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|253314583|ref|ZP_04837796.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
 gi|257433214|ref|ZP_05609572.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           E1410]
 gi|258424424|ref|ZP_05687304.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A9635]
 gi|258446379|ref|ZP_05694536.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A6300]
 gi|284024200|ref|ZP_06378598.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           132]
 gi|62636315|gb|AAX91426.1| ORF009 [Staphylococcus phage 96]
 gi|104641959|gb|ABF73267.1| phage terminase [Staphylococcus aureus phage phiNM4]
 gi|121309304|dbj|BAF43925.1| large terminase [Staphylococcus phage phiETA3]
 gi|150373301|dbj|BAF66561.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|257281307|gb|EEV11444.1| phage terminase large subunit [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257845437|gb|EEV69471.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A9635]
 gi|257854829|gb|EEV77775.1| PBSX family phage terminase, large subunit [Staphylococcus aureus
           A6300]
          Length = 407

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/253 (13%), Positives = 83/253 (32%), Gaps = 21/253 (8%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G    +  T    + +E     E+V+ E  +R + T   + +   P      +++ Y+ 
Sbjct: 116 SGIGAIRGMTSFGAYINEASLAHEEVFDEIKSRCSGTGARILVDTNPDHPEHWLLKDYIE 175

Query: 64  ASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVE- 119
            +         +  +++    N++ ++ I  S P      R   G  + G G ++   + 
Sbjct: 176 NTDPKAGILSHQFKLDDNNFLNDRYKESIKASTPSGMFYERNINGMWVSGDGVVYADFDL 235

Query: 120 --EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH 177
               I  + LD         G+D+G+ H  +   +    D +  Y ++ +  + +     
Sbjct: 236 NENTIKADELDDIPIKEYFAGVDWGYEHYGSIVLIGRGIDGN-FYFIEEHAHQFKFIDDW 294

Query: 178 VAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
           V   K     +   + +     D    E ++                  +      +G+ 
Sbjct: 295 VVIAK----DIVSRYGNINFYCDTARPEYITE--------FRRHRLRAINADKSKLSGVE 342

Query: 238 DMLDRMRSGRWKV 250
           ++    +  +  V
Sbjct: 343 EVAKLFKQNKLLV 355


>gi|291335422|gb|ADD95035.1| phage terminase large subunit [uncultured phage MedDCM-OCT-S04-C26]
          Length = 446

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 76/258 (29%), Gaps = 21/258 (8%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEPPED------VYFEGLTRINATQGLVTLTLTPLKGRS 55
           +++E    +     + +V  DE            + + L R+ A         +  +G  
Sbjct: 132 RSFE-NWSRIIGLNLSHVLVDEIDVVSPVIADKAFPKILGRLRAGNVRQFCAASTPEGFR 190

Query: 56  PIIEHYLSASSS---DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI--LG 110
            +   + +  +    DR++I+M   + PH      +R+  +Y     +A   GE I    
Sbjct: 191 WLYNTFGTDEAKERTDRELIKMRTQDNPHLPSDFIERMQANYDPSMLQAYLNGEFINLTT 250

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR 170
                    E+ + N            G+DF   +  A   +V +     + +       
Sbjct: 251 GQVYDRFTRENNMTNIKPDIGLEPLRVGLDFNIGNMNAVIGIVQD---QKLLIFDEISGS 307

Query: 171 EQTPIFHVAALKSWGKWLPWAWPHD-GLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGS 229
             T          +     + +P   G      + +         G       +      
Sbjct: 308 HDTDSLAQTIKSRYPMNKIYVYPDASGGNRSTNASQTDIQILESYGFSNQSPRSNPP--- 364

Query: 230 NGVEAGISDMLDRMRSGR 247
             V   +S +   + +G+
Sbjct: 365 --VRDRVSAVQALLCNGK 380


>gi|297590111|ref|ZP_06948751.1| PBSX family phage terminase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|297577239|gb|EFH95953.1| PBSX family phage terminase [Staphylococcus aureus subsp. aureus
           MN8]
          Length = 407

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/253 (13%), Positives = 83/253 (32%), Gaps = 21/253 (8%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G    +  T    + +E     E+V+ E  +R + T   + +   P      +++ Y+ 
Sbjct: 116 SGIGAIRGMTSFGAYINEASLAHEEVFDEIKSRCSGTGARILVDTNPDHPEHWLLKDYIE 175

Query: 64  ASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVE- 119
            +         +  +++    N++ ++ I  S P      R   G  + G G ++   + 
Sbjct: 176 NTDPKAGILSHQFKLDDNNFLNDRYKESIKASTPSGMFYERNINGMWVSGDGVVYADFDL 235

Query: 120 --EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH 177
               I  + LD         G+D+G+ H  +   +    D +  Y ++ +  + +     
Sbjct: 236 NENTIKADELDDIPIKEYFAGVDWGYEHYGSIVLIGRGIDGN-FYFIEEHAHQFKFIDDW 294

Query: 178 VAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
           V   K     +   + +     D    E ++                  +      +G+ 
Sbjct: 295 VDIAK----DVVSRYGNINFYCDTARPEYITE--------FRRHRLRAINADKSKLSGVE 342

Query: 238 DMLDRMRSGRWKV 250
           ++    +  +  V
Sbjct: 343 EVAKLFKQNKLLV 355


>gi|293411885|ref|ZP_06654610.1| predicted protein [Escherichia coli B354]
 gi|220980013|emb|CAP72205.1| Hypothetical protein [Escherichia coli LF82]
 gi|291469440|gb|EFF11929.1| predicted protein [Escherichia coli B354]
 gi|323934319|gb|EGB30739.1| PBSX family protein phage terminase [Escherichia coli E1520]
          Length = 418

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/255 (11%), Positives = 71/255 (27%), Gaps = 14/255 (5%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS-- 63
            D  +   +H+V  DE  +   D +++ L    ++     L +   KG S   + +    
Sbjct: 110 PDTLRGVALHFVVLDEFQDMKADTWYKVLRPTLSSTRGGALIIGTPKGFSEFHKLWTIGQ 169

Query: 64  ----ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE 119
                     +  +    ++P     E +   +                  SGR++   +
Sbjct: 170 NVELQRKGQWKSWQFVTADSPFVPTAEIEAAKNDMDPKSFAQEYLASFENMSGRVYYPFD 229

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
            ++ +  L          G DF      +    +  + +  ++ +               
Sbjct: 230 RNVHVKPLQFNPRLPIWVGQDFNIDPMSSVI--LQPQPNGELWAIDELVLFSSNTAEVCD 287

Query: 180 ALK----SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            L+     W   +       G       GE     ++ +G   +         ++ V A 
Sbjct: 288 ELERRFWRWKSQITVFPDPAGAYRQHARGESDVDIFKEKGFLRVDYSKKHPPIADRVNAV 347

Query: 236 ISDMLDRMRSGRWKV 250
              ++      R  +
Sbjct: 348 NRMLMTASGDIRLYI 362


>gi|312868635|ref|ZP_07728829.1| phage terminase, large subunit, PBSX family [Lactobacillus oris
           PB013-T2-3]
 gi|311095844|gb|EFQ54094.1| phage terminase, large subunit, PBSX family [Lactobacillus oris
           PB013-T2-3]
          Length = 409

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/245 (13%), Positives = 83/245 (33%), Gaps = 18/245 (7%)

Query: 12  QSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDR 69
           +  T +  + +E     + V+ E L+R +     V     P   +  + + Y+     D 
Sbjct: 121 RGFTAYGAYVNEASLANQKVFSEILSRCSKAGSHVICDTNPDNPQHWLKKDYIDNDDPDD 180

Query: 70  QVIR--MTINETPHYNEQERKRIIDSYP-LHEREARTKGEPILGSGRIFPIVEEDIVINS 126
           + +    T+++         K+     P     +    G  + G G ++   ++  +I +
Sbjct: 181 KTVTFCFTMDDNTFLAPDYVKQKKAQTPTGMFYDREILGLWVSGDGIVYRDFDQRAMIIN 240

Query: 127 LDIPEHW-VQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG 185
            +          G+D+G+ H         + D + IY+++ +  + +   + V   K   
Sbjct: 241 QEQLPDGLHIYCGVDWGFEHKGVITVWGDDEDGN-IYMLEEHTSQYKYIDYWVRVAKDIQ 299

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRS 245
           K   +         D    + +S                  +      AG+  + + M+ 
Sbjct: 300 KRYGYNIN---FWVDSARPDNVSE--------FQRNDINAINADKSRMAGVERVAEFMKL 348

Query: 246 GRWKV 250
           G++ V
Sbjct: 349 GKFFV 353


>gi|317060942|ref|ZP_07925427.1| conserved hypothetical protein [Fusobacterium sp. D12]
 gi|313686618|gb|EFS23453.1| conserved hypothetical protein [Fusobacterium sp. D12]
          Length = 423

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 71/237 (29%), Gaps = 24/237 (10%)

Query: 16  VHYVWFDEEPPE------DVYFEGLTRINATQGLVT---LTLTPLKGRSPI--IEHYLSA 64
           + Y W +E          ++  + + R   +  L     L+  P K R      ++ +  
Sbjct: 126 IAYFWIEEAAEFLTEEEIEIVIKSVLRGKISDNLKYKGFLSYNPPKQRHHWINKKYGVIQ 185

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
                 +      + P+ +E+      +           +       G + P     I  
Sbjct: 186 KQETSFIHHSCYTDNPYLSEEFILEAEEKKKKDPVGYDWEYLGEPVGGGVVPFPRLHIGK 245

Query: 125 NSLDIPEHWVQIG-GMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
               +         G+D+G+   P A     ++R    IY +  +   +++      A+K
Sbjct: 246 IPDSLIRTLDTFRNGVDWGYAVDPVAFVRWGYDRMRKRIYAISEFYGVQKSNEVLAKAIK 305

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
              K             D    + ++   R  G++      +   G   VE+G   +
Sbjct: 306 KQIKRNETV------TCDSAEPKSVAD-LRSYGIRA----YSAKKGKGSVESGEKWL 351


>gi|295407505|ref|ZP_06817299.1| PBSX family phage terminase [Staphylococcus aureus A8819]
 gi|297246664|ref|ZP_06930491.1| PBSX family phage terminase [Staphylococcus aureus A8796]
 gi|294967614|gb|EFG43649.1| PBSX family phage terminase [Staphylococcus aureus A8819]
 gi|297176476|gb|EFH35744.1| PBSX family phage terminase [Staphylococcus aureus A8796]
          Length = 407

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/253 (13%), Positives = 83/253 (32%), Gaps = 21/253 (8%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G    +  T    + +E     E+V+ E  +R + T   + +   P      +++ Y+ 
Sbjct: 116 SGIGAIRGMTSFGAYINEASLAHEEVFDEIKSRCSGTGARILVDTNPDHPEHWLLKDYIE 175

Query: 64  ASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVE- 119
            +         +  +++    N++ ++ I  S P      R   G  + G G ++   + 
Sbjct: 176 NTDPKAGILSHQFKLDDNNFLNDRYKESIKASTPSGMFYERNINGMWVSGDGVVYADFDL 235

Query: 120 --EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH 177
               I  + LD         G+D+G+ H  +   +    D +  Y ++ +  + +     
Sbjct: 236 NENTIKADELDDIPIKEYFAGVDWGYEHYGSIVLIGRGIDGN-FYFIEEHAHQFKFIDDW 294

Query: 178 VAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
           V   K     +   + +     D    E ++                  +      +G+ 
Sbjct: 295 VVIAK----DIVSRYGNINFYCDTARPEYITE--------FRRHRLRAINADKSKLSGVE 342

Query: 238 DMLDRMRSGRWKV 250
           ++    +  +  V
Sbjct: 343 EVAKLFKQNKLLV 355


>gi|317486764|ref|ZP_07945580.1| terminase-like family protein [Bilophila wadsworthia 3_1_6]
 gi|316921927|gb|EFV43197.1| terminase-like family protein [Bilophila wadsworthia 3_1_6]
          Length = 463

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/303 (14%), Positives = 85/303 (28%), Gaps = 65/303 (21%)

Query: 7   GRDKWQSNTVHYVWFDEE---PPEDVYFEGLT--RINATQGL--VTLTLTPLKGRSPIIE 59
             + +Q +   +V FDE    P ++VY +     R +       +  T  PL      ++
Sbjct: 115 DMENYQGHEYPFVGFDELCNLPSQEVYEKAKGFCRSSDPNVPKMIRCTANPLGPGHLWVK 174

Query: 60  HYLSASSS-----------DRQVIRMTINETPHY---NEQERKRIIDSYPLHEREARTKG 105
            Y    +             R  I  TI +  +    +    +R+        R A   G
Sbjct: 175 RYFIDPAPALTPIVESHGGKRVFIPATIYDNKNLVEADPDYLRRLESIADDSLRRAWLNG 234

Query: 106 EPILGSGRIF--PIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWN-------- 155
           +  + +G  F         ++   +IP +W      D+G  HPF+ G             
Sbjct: 235 DWNVVAGSFFGDVWSASRNIVKPFNIPRNWYCFRSFDWGSSHPFSVGWWAIADGTQAPDG 294

Query: 156 --RDSDVIYVVKNYRCRE--------------QTPIFHVAALKSWGKWLPWAW------- 192
                        +   +               +       ++   + +  A        
Sbjct: 295 RYYPRGAFIRFAEWYGAKRGSNGMVVPNEGLRMSSKHVAQGIRERERKMSDAMGIRINPG 354

Query: 193 PHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM----RSGRW 248
           P D   +    G  ++     +G+K +          N    G   M +R+         
Sbjct: 355 PADPAIYASTDGPSVADNMASEGIKWVR-------ADNSRVTGWQQMRERIWQEGEEPML 407

Query: 249 KVF 251
            VF
Sbjct: 408 YVF 410


>gi|22855048|ref|NP_690654.1| hypothetical protein SPP1p003 [Bacillus phage SPP1]
 gi|1729903|sp|P54308|TERL_BPSPP RecName: Full=Large terminase protein; AltName: Full=DNA-packaging
           protein G2P; AltName: Full=Terminase large subunit
 gi|15466|emb|CAA39537.1| terminase [Bacillus phage SPP1]
 gi|2764840|emb|CAA66573.1| unnamed protein product [Bacillus phage SPP1]
          Length = 422

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 75/242 (30%), Gaps = 24/242 (9%)

Query: 16  VHYVWFDEEPPE------DVYFEGLTRINATQGLVTLTL----TPLKGRSPIIEHYLSAS 65
           V  +W +E           V  + + R     G   +       P + +S + + + S+ 
Sbjct: 128 VAGMWIEELAEFKTEEEVSVIEKSVLRAELPPGCRYIFFYSYNPPKRKQSWVNKVFNSSF 187

Query: 66  SS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE---ED 121
              +  V   T  + P  ++   +   +    +E + R +         + P      E+
Sbjct: 188 LPANTFVDHSTYLQNPFLSKAFIEEAEEVKRRNELKYRHEYLGEALGSGVVPFENLQIEE 247

Query: 122 IVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            +I   ++        G+DFG+   P A     +++  + IY +      + +       
Sbjct: 248 GIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAIDELVDHKVSLKRTADF 307

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           ++         +    +  D      + A     G+           G + VE G   + 
Sbjct: 308 VRKNK------YESARIIADSSEPRSIDALKLEHGIN---RIEGAKKGPDSVEHGERWLD 358

Query: 241 DR 242
           + 
Sbjct: 359 EL 360


>gi|82702592|ref|YP_412158.1| Phage terminase, large subunit, PBSX [Nitrosospira multiformis ATCC
           25196]
 gi|82410657|gb|ABB74766.1| Phage terminase, large subunit, PBSX [Nitrosospira multiformis ATCC
           25196]
          Length = 417

 Score = 96.8 bits (239), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/243 (13%), Positives = 75/243 (30%), Gaps = 20/243 (8%)

Query: 9   DKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
             ++   V  VW +E        +   +  I      + +T  P        + ++    
Sbjct: 110 KSFEG--VDRVWVEEAQTVSKTSWDTLIPTIRKEGSEIWVTYNPELNTDETHQRFVVNPP 167

Query: 67  SDRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGE-PILGSGRIFPIV----E 119
           +   V+++  N+ P + E  R+    + +      +   +G   +   G ++       +
Sbjct: 168 AGAVVVKINWNDNPWFPEILRREKDGLKARDPDAYQNVWEGNCRVTLEGAVYAKELRLAQ 227

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
           E+  I S+   E        D GW    +          + + ++  Y   +     ++ 
Sbjct: 228 EEGRIRSVPYDEAKPVHTFFDLGWADNTSIWFA--QTVGNELRLIDYYSNSQMPIQHYIG 285

Query: 180 ALKSWGKWLPWAW-PHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
            L++ G      W PHD       +G  +       G K+             +  GI+ 
Sbjct: 286 VLQNKGYMYGTDWLPHDARARTLATGRSVEEIMLAAGRKVRIVPNL------SIHDGINA 339

Query: 239 MLD 241
              
Sbjct: 340 ART 342


>gi|304440418|ref|ZP_07400307.1| PBSX family phage terminase [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371170|gb|EFM24787.1| PBSX family phage terminase [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 388

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 76/239 (31%), Gaps = 24/239 (10%)

Query: 16  VHYVWFDEEPPE------DVYFEGLTRINATQG---LVTLTLTPL-KGRSPIIEHY-LSA 64
           +  +W +E           +    + R     G       T  P  + +S + + Y  + 
Sbjct: 100 IARLWIEELAEFKTEDEVSMIENSILRGELEDGLEYKFYYTYNPPKRKQSWVNKRYETTF 159

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI-LGSGRIFPIVEEDIV 123
            + +  V   T  + P+ ++  +            + R +     +GSG +         
Sbjct: 160 LAENTFVHHSTYLDNPYISQAFKNEAEHIKNTKPLKYRWEYLGEPIGSGVVPFDNLVFRE 219

Query: 124 INSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
           I++ ++        G+D+G+   PFA   L +++    IY+       + +     A +K
Sbjct: 220 ISTKELLNFDNIRQGIDWGYANDPFAFIRLHYDKTRRRIYIFDELYRVKLSNREAAAKIK 279

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
           + G              D    + +       G+K+             VE G   + D
Sbjct: 280 ANGWNDCKI------IADSAEPKSIDE-MWEYGLKIYGAN----KRPGSVEYGEKWLDD 327


>gi|309797383|ref|ZP_07691776.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           145-7]
 gi|308119007|gb|EFO56269.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           145-7]
          Length = 418

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/255 (11%), Positives = 71/255 (27%), Gaps = 14/255 (5%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS-- 63
            D  +   +H+V  DE  +   D +++ L    ++     L +   KG S   + +    
Sbjct: 110 PDTLRGVALHFVVLDEFQDMKADTWYKVLRPTLSSTRGGALIIGTPKGFSEFHKLWTIGQ 169

Query: 64  ----ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE 119
                     +  +    ++P     E +   +                  SGR++   +
Sbjct: 170 NVELQRKGQWKSWQFVTADSPFVPTAEIEAAKNDMDPKSFAQEYLASFENMSGRVYYPFD 229

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
            ++ +  L          G DF      +    +  + +  ++ +               
Sbjct: 230 RNVHVKPLQFNPRLPIWVGQDFNIDPMSSVI--LQPQPNGELWAIDELVLFSSNTAEVCD 287

Query: 180 ALK----SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
            L+     W   +       G       GE     ++ +G   +         ++ V A 
Sbjct: 288 ELERRFWRWKSQVTVFPDPAGAYRQHARGESDVDIFKEKGFLRVDYSKKHPPIADRVNAV 347

Query: 236 ISDMLDRMRSGRWKV 250
              ++      R  +
Sbjct: 348 NRMLMSASGDIRLYI 362


>gi|255994017|ref|ZP_05427152.1| phage terminase, large subunit, PBSX family [Eubacterium saphenum
           ATCC 49989]
 gi|255993685|gb|EEU03774.1| phage terminase, large subunit, PBSX family [Eubacterium saphenum
           ATCC 49989]
          Length = 466

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/259 (12%), Positives = 75/259 (28%), Gaps = 17/259 (6%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           E  +D  Q  T    + DE    P+    + L R +     V L   P      I + Y+
Sbjct: 122 EASQDSLQGLTAAGAYGDEAALFPQSFTEQMLGRCSVKGSKVFLNCNPSSPNHYIKKEYI 181

Query: 63  SASS-SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED 121
             +   +   +  T+++    +    +R    Y     E   +G  +   G ++    ++
Sbjct: 182 DKADAKNICRLHFTLDDNLTLDPSTVERYHRMYTGVFYERFIRGLWVSAEGLVYKEFADN 241

Query: 122 IVINSLDIPEHWVQIGGM------DFGWHHPFAAGHLVWNRDSDVIYVVKNYR-CREQTP 174
           +    +D      +            G     +     + +    +  +  +      TP
Sbjct: 242 VSSYIVDDDYVASEDIAFATIGVDFGGNKSAHSFTLTGFTKGLGEVMTLDEWYSDERLTP 301

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLS--AQY-RRQGMKMLPECATFDDGSNG 231
               +    + +     +       D      +        R+G+ +  +      G   
Sbjct: 302 DELSSRFCDFVQRAKERYNVYEAYCDSAEQVLIKGFEVATARRGLAI--DIKNAIKG--A 357

Query: 232 VEAGISDMLDRMRSGRWKV 250
           +   I+     + S RW V
Sbjct: 358 INDRIAFYNSLIASRRWHV 376


>gi|28198423|ref|NP_778737.1| hypothetical protein PD0512 [Xylella fastidiosa Temecula1]
 gi|28056507|gb|AAO28386.1| phage-related protein [Xylella fastidiosa Temecula1]
          Length = 257

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 61/128 (47%), Positives = 85/128 (66%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           LK++EQG +KWQ++ V ++WFDE+PPEDVYFEG+ R N T GLV +T  PLK    ++  
Sbjct: 7   LKSFEQGGEKWQADPVDWIWFDEQPPEDVYFEGIIRTNRTFGLVCMTFAPLKSILTVVWR 66

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L  +  DR  ++M I +  HY  ++  RI  SYP +ER+ART+G P LGSGR+FPI  E
Sbjct: 67  FLLENVPDRADVQMIIEDAEHYLLEDCARITASYPPYERQARTQGVPALGSGRLFPIAGE 126

Query: 121 DIVINSLD 128
            I +    
Sbjct: 127 KIGVAPEK 134


>gi|307579537|gb|ADN63506.1| bacteriophage terminase large (ATPase) subunit and inactivated
           derivatives-like protein [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 278

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 61/128 (47%), Positives = 85/128 (66%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           LK++EQG +KWQ++ V ++WFDE+PPEDVYFEG+ R N T GLV +T  PLK    ++  
Sbjct: 28  LKSFEQGGEKWQADPVDWIWFDEQPPEDVYFEGIIRTNRTFGLVCMTFAPLKSILTVVWR 87

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L  +  DR  ++M I +  HY  ++  RI  SYP +ER+ART+G P LGSGR+FPI  E
Sbjct: 88  FLLENVPDRADVQMIIEDAEHYLLEDCARITASYPPYERQARTQGVPALGSGRLFPIAGE 147

Query: 121 DIVINSLD 128
            I +    
Sbjct: 148 KIGVAPEK 155


>gi|221199508|ref|ZP_03572552.1| phage terminase, large subunit, pbsx family [Burkholderia
           multivorans CGD2M]
 gi|221205590|ref|ZP_03578605.1| phage terminase, large subunit, pbsx family [Burkholderia
           multivorans CGD2]
 gi|221174428|gb|EEE06860.1| phage terminase, large subunit, pbsx family [Burkholderia
           multivorans CGD2]
 gi|221180793|gb|EEE13196.1| phage terminase, large subunit, pbsx family [Burkholderia
           multivorans CGD2M]
          Length = 425

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/239 (12%), Positives = 72/239 (30%), Gaps = 19/239 (7%)

Query: 16  VHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +   W +E     E+ + +    I A    + L+  P      I +  +     +   + 
Sbjct: 112 IDIAWVEEAQTITENSFRKLTPSIRAPGSQIWLSWNPELETDFIYQKVVIEGLPNCASLF 171

Query: 74  MTINETPHYNEQER--KRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS----- 126
           +  ++ P + ++ R  ++ +             G P+          E   + +      
Sbjct: 172 VNFDQNPWFPDELRLEEQDMKGKDPDMHRHVWLGMPLPAVAGAIYFNEISQMESEGRLLN 231

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
           + I +       MD G++   +    V  +      +V  +  R +   +        G 
Sbjct: 232 IPIDDGLNTYIIMDLGFNDFTSC--PVVQQVGGEFRIVDFFENRRKPLSWFSEQFIEAGY 289

Query: 187 WLPWAWP--HDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
                        +     G  + A+ +  G ++          +  VEAGI  + + +
Sbjct: 290 EGAIVVMPHDAEHERLDSDGVSMKAKMQALGWEVE------IVANMPVEAGIRLVREML 342


>gi|238021116|ref|ZP_04601542.1| hypothetical protein GCWU000324_01014 [Kingella oralis ATCC 51147]
 gi|237868096|gb|EEP69102.1| hypothetical protein GCWU000324_01014 [Kingella oralis ATCC 51147]
          Length = 408

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/243 (15%), Positives = 67/243 (27%), Gaps = 21/243 (8%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           Q         +     +E     E  +      I A +  + +   P +  S     +  
Sbjct: 112 QSVKSL--AKIDVCIVEEAEDISEAAWEVLEPTIRAPKSEIWVIWNPKQENSATDRRFRK 169

Query: 64  ASSSDRQVIRMTINETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
                  ++ M   + P +    E+ R+    +          +G           +   
Sbjct: 170 NPPPRSCIMEMNYGDNPFFPPELEELRRHQQQTLDPARYAWIWEGAY--YEQSEAQVFRG 227

Query: 121 DIVINSLDIPEHWV-QIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
              I      E+W     G+DFG+   P AA         + +Y+ +             
Sbjct: 228 KYEIAEFVPGENWDGAYFGLDFGFSQDPTAAVQCWI--HDNKLYIEREAGGVGIELDDTA 285

Query: 179 AALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           A L++    +           D    E +S   RR G+   P       G   VE GI  
Sbjct: 286 AVLQAAMPDIGRYVVRA----DSARPESIS-YLRRHGL---PRIVGAVKGKGSVEDGIEF 337

Query: 239 MLD 241
           +  
Sbjct: 338 IKS 340


>gi|118443517|ref|YP_878252.1| PBSX family phage terminase large subunit [Clostridium novyi NT]
 gi|118133973|gb|ABK61017.1| phage terminase, large subunit, PBSX family [Clostridium novyi NT]
          Length = 419

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/238 (13%), Positives = 76/238 (31%), Gaps = 22/238 (9%)

Query: 15  TVHYVWFDEEPPEDVY------FEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            + Y+W++E    + Y       + L R    +  V  +  P + +       +  +  D
Sbjct: 134 YIKYIWYEEVDEFEGYDKIRNINQSLMR-GGPKFCVFYSFNPPESQRNWANMEVLETRKD 192

Query: 69  RQVIRMTINETP--HYNEQERKRIIDSYPLHEREARTKGEP-ILGSGRIFPIVEEDIVIN 125
           + V        P     +Q          ++  +        + G+G           I 
Sbjct: 193 KLVHHSNYLGVPREWLGKQFILEAEHLKKVNHLKYEHDYLGAVTGTGGEVFTNVTIRKIT 252

Query: 126 SLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
             +I        G+DFG+   P       +++    +Y+         +    V  +K  
Sbjct: 253 DEEIASFDRVHRGLDFGYASDPLHYTVNHYDKTRRRLYIFYEIHKAGMSNSSAVETIKQE 312

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
            K       ++ +  D      ++  +++ G+K++        G + VE G+  + D 
Sbjct: 313 NK------SNNRIVADSAEPRTIAE-FKKLGLKIIGA----KKGPDSVEHGVKFLQDL 359


>gi|309806821|ref|ZP_07700810.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           LactinV 03V1-b]
 gi|308166795|gb|EFO68985.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           LactinV 03V1-b]
          Length = 409

 Score = 96.0 bits (237), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 33/246 (13%), Positives = 81/246 (32%), Gaps = 18/246 (7%)

Query: 11  WQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA--SS 66
            +  T +  + +E       V+ E   R +     +     P      +   Y+    S+
Sbjct: 120 IRGMTSYGAYINEASLSTHAVFQEIKQRCSKEGARIICDTNPDIPTHWLKTEYIDNVDSN 179

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REARTKGEPILGSGRIFPIVEE-DIVI 124
           +  +    TI++ P   +     +  S P     +   KG    G G ++   ++  + I
Sbjct: 180 AGIKYFMFTIDDNPTLPKDYVVSLKASTPKGMFYDRAIKGLWCTGEGVVYRDFDQSTMTI 239

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
           +   +P       G+D+G+ H         +   +  Y+++ +  + +   + V      
Sbjct: 240 DRDKLPTDLTYYVGVDWGYEHTGTLIVFADDSQGNT-YLIEEHAHKHRFIDYWVDLAHDV 298

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
            +      P      D    + L+      G++           +  + +GI  +   M+
Sbjct: 299 QQKYGSTIP---FWCDSARPDNLNEFLT-HGIRAYN-------ANKAINSGIEAVGSLMK 347

Query: 245 SGRWKV 250
           +  + V
Sbjct: 348 AKHFFV 353


>gi|182681090|ref|YP_001829250.1| bacteriophage terminase large (ATPase) subunit and inactivated
           derivatives-like protein [Xylella fastidiosa M23]
 gi|182631200|gb|ACB91976.1| Bacteriophage terminase large (ATPase) subunit and inactivated
           derivatives-like protein [Xylella fastidiosa M23]
          Length = 291

 Score = 96.0 bits (237), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 61/128 (47%), Positives = 85/128 (66%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           LK++EQG +KWQ++ V ++WFDE+PPEDVYFEG+ R N T GLV +T  PLK    ++  
Sbjct: 41  LKSFEQGGEKWQADPVDWIWFDEQPPEDVYFEGIIRTNRTFGLVCMTFAPLKSILTVVWR 100

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L  +  DR  ++M I +  HY  ++  RI  SYP +ER+ART+G P LGSGR+FPI  E
Sbjct: 101 FLLENVPDRADVQMIIEDAEHYLLEDCARITASYPPYERQARTQGVPALGSGRLFPIAGE 160

Query: 121 DIVINSLD 128
            I +    
Sbjct: 161 KIGVAPEK 168


>gi|323441910|gb|EGA99548.1| hypothetical protein SAO46_2129 [Staphylococcus aureus O46]
          Length = 407

 Score = 96.0 bits (237), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 33/253 (13%), Positives = 83/253 (32%), Gaps = 21/253 (8%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
            G    +  T    + +E     E+V+ E  +R + T   + +   P      +++ Y+ 
Sbjct: 116 SGIGAIRGMTSFGAYINEASLAHEEVFDEIKSRCSGTGARILVDTNPDHPEHWLLKDYIE 175

Query: 64  ASSS--DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVE- 119
            +         +  +++    N++ ++ I  S P      R   G  + G G ++   + 
Sbjct: 176 NTDPKAGILSYQFKLDDNNFLNDRYKESIKASTPSGMFYERNINGMWVSGDGVVYADFDL 235

Query: 120 --EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH 177
               I  + LD         G+D+G+ H  +   +    D +  Y ++ +  + +     
Sbjct: 236 NENTIKADELDDIPIKEYFAGVDWGYEHYGSIVLIGRGIDGN-FYFIEEHAHQFKFIDDW 294

Query: 178 VAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
           V   K     +   + +     D    E ++                  +      +G+ 
Sbjct: 295 VGIAK----DIVSRYGNINFYCDTARPEYITE--------FRRHRLRAINADKSKLSGVE 342

Query: 238 DMLDRMRSGRWKV 250
           ++    +  +  V
Sbjct: 343 EVAKLFKQNKLLV 355


>gi|148380306|ref|YP_001254847.1| terminase large subunit [Clostridium botulinum A str. ATCC 3502]
 gi|148289790|emb|CAL83898.1| terminase large subunit [Clostridium botulinum A str. ATCC 3502]
          Length = 448

 Score = 95.6 bits (236), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 38/236 (16%), Positives = 76/236 (32%), Gaps = 24/236 (10%)

Query: 16  VHYVWFDEEPPEDVY------FEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDR 69
           + Y+W++E    + Y       + L R    +  V  +  P + +       +     D+
Sbjct: 133 IKYIWYEEADEFENYDKIRNVNQSLMR-GGPEFEVFYSFNPPESQRNWTNMEVLEERKDK 191

Query: 70  QVIRMTINETP--HYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVIN 125
            V   T    P     EQ          +++   +    G  + G+G           I 
Sbjct: 192 FVHHSTYLTVPKEWLGEQFVIEAEHLKKVNKTKYDHDYLGA-VTGTGGEVFRNVTVRNIT 250

Query: 126 SLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
             +I        G+DFG+   P A     +++    +Y+       +      V  +K  
Sbjct: 251 DDEIKVFDHVKNGLDFGYAADPLAYIKCHYDKTRKRLYIFDEIVKVQLGNSKAVKLIKEK 310

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
            K       +  +  D      +S  +R+ G+ ++        G + VE GI  + 
Sbjct: 311 NK------LNMRVTADSAEPRTISE-FRKLGLNIIGAI----KGPDSVEHGIKFLS 355


>gi|309804997|ref|ZP_07699054.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           LactinV 09V1-c]
 gi|308165656|gb|EFO67882.1| phage terminase, large subunit, PBSX family [Lactobacillus iners
           LactinV 09V1-c]
          Length = 409

 Score = 95.2 bits (235), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 34/246 (13%), Positives = 82/246 (33%), Gaps = 18/246 (7%)

Query: 11  WQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA--SS 66
            +  T +  + +E       V+ E   R +     +     P      +   Y+    S+
Sbjct: 120 IRGMTSYGAYINEASLSTHAVFQEIKQRCSKEGARIICDTNPDIPTHWLKTEYIDNVDSN 179

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REARTKGEPILGSGRIFPIVEE-DIVI 124
           +  +    TI++ P   +     +  S P     +   KG  + G G ++   ++  + I
Sbjct: 180 AGIKYFMFTIDDNPTLPKDYVVSLKASTPKGMFYDRAIKGLWVTGEGVVYRDFDQSTMTI 239

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
           +   +P       G+D+G+ H         +   +  Y++K +  + +   + V      
Sbjct: 240 DRDKLPTDLTYYVGVDWGYEHTGTLIVFADDSQGNT-YLIKEHAHKHRFIDYWVDLAHDV 298

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
            +      P      D    + L+      G++           +  + +GI  +   M+
Sbjct: 299 QQKYGSTIP---FWCDSARPDNLNEFLT-HGIRAYN-------ANKAINSGIEAVGSLMK 347

Query: 245 SGRWKV 250
           +  + V
Sbjct: 348 AKHFFV 353


>gi|312900430|ref|ZP_07759739.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0470]
 gi|311292452|gb|EFQ71008.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0470]
          Length = 451

 Score = 95.2 bits (235), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 30/227 (13%), Positives = 70/227 (30%), Gaps = 16/227 (7%)

Query: 23  EEPPEDVYFEGLTRINAT-QGLVTLTLTPL-KGRSPIIEHYLSASSSD-RQVIRMTINET 79
           EE    +  E   +           +  P  + +S + + Y S+   +   V   T    
Sbjct: 158 EELEGKIVNESKRKNVYPFDYSFYYSYNPPKRRQSWVNKKYESSFIDNNTYVHHSTYLGN 217

Query: 80  PHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDI---VINSLDIPEHWVQI 136
            H +++  +   +       + R +         + P     I    I    +       
Sbjct: 218 HHLSKKFIEEAENVKANKPLKYRWEYLGEAIGSGVVPFGNLKIEKGCITDEMVANFDNIR 277

Query: 137 GGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHD 195
            G+DFG+   P A     +++  + IY +      + +       +++ G      +  +
Sbjct: 278 NGLDFGYATDPLAFVRWHYDKKKNGIYAIDEIYGVKISNRELAKKVRAKG------YESE 331

Query: 196 GLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
            +  D    + ++       +K   +      G + VE G   + D 
Sbjct: 332 RIGADSAEPKSIAELINEHSIK---KLYGVKKGPDSVEYGEEWLDDL 375


>gi|237737490|ref|ZP_04567971.1| phage terminase [Fusobacterium mortiferum ATCC 9817]
 gi|229421352|gb|EEO36399.1| phage terminase [Fusobacterium mortiferum ATCC 9817]
          Length = 447

 Score = 95.2 bits (235), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 44/285 (15%), Positives = 82/285 (28%), Gaps = 51/285 (17%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQG--LVTLT 47
            +  +    K  S TV      + WF+E      E   +     +           +T T
Sbjct: 114 FRGLD-DPLKITSITVDVGYLCWAWFEEMYQIENEDDFNKIDVSIRGAVPNHLFKQITCT 172

Query: 48  LTPLKGRSPIIEHYLSASSSD-----------------RQVIRMTINETPHYNEQERKRI 90
             P      + + +      D                    I          +E +    
Sbjct: 173 FNPWSETHWLNDRFFKGGKEDKDNLLTKGLAIHKNTKDILAITTNFRANEFLDEADLNVF 232

Query: 91  IDSYPLHEREARTKGEPILG--SGRIFPIVEE-DIVINSLDIPEHWVQIGGMDFGWH-HP 146
                 + R    +G    G   G +F   E  +  IN+L     ++   G+D+G+   P
Sbjct: 233 NLMKEENPRRFEIEGNGNWGICEGTVFYRWEVLNFDINTLIKTGKYLTCIGLDYGFTNDP 292

Query: 147 FAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQ 206
            A    + N D   IY++  +          V  +K  G      +    +  D    + 
Sbjct: 293 TALIVSLVNEDEKEIYIIDEHYQTGMFNEDIVELIKYKG------YSKSVIIADSAEEKS 346

Query: 207 LSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
           +    ++ G+   P   +   G + +  GI  +         KVF
Sbjct: 347 IK-WMKKNGV---PRIKSSVKGPDSIMFGIQYLQGY------KVF 381


>gi|319654620|ref|ZP_08008701.1| hypothetical protein HMPREF1013_05323 [Bacillus sp. 2_A_57_CT2]
 gi|317393686|gb|EFV74443.1| hypothetical protein HMPREF1013_05323 [Bacillus sp. 2_A_57_CT2]
          Length = 400

 Score = 95.2 bits (235), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 34/256 (13%), Positives = 83/256 (32%), Gaps = 26/256 (10%)

Query: 8   RDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS 65
             K +  T      +E     +    E ++R +     + L   P     P+    +   
Sbjct: 106 WKKARGFTAAGALLNEGTALHDMFVKEVISRCSYPGAQILLDTNPENPAHPVKTDIIDKD 165

Query: 66  SS-------DRQVIRMTINETPHYNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPI 117
                    +      T+ +    +E+  + I+ + P     +    G  +   G I+  
Sbjct: 166 GQRLDNGRLNIVAFHFTLFDNIFLDEEYVQSIVAATPTGMFTDRDINGLWVAAEGVIYKD 225

Query: 118 VEED---IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
              D   I     +         G+D+G+ H  +   L  +   D +++++ +  +    
Sbjct: 226 FNRDKHYISRAKFEKKNIVKYFAGVDWGYEHHGSICVLAEDDVGD-LFLIEEHAKQHMEI 284

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
            + V   K         + +     D    E +  ++RR+G++ +            V A
Sbjct: 285 DYWVGVAKELKGR----YGNINFYCDSARPEHV-QRFRREGLRAIEAVKK-------VVA 332

Query: 235 GISDMLDRMRSGRWKV 250
           GI ++    +  ++ +
Sbjct: 333 GIEEVARLFKLNKFFI 348


>gi|222151170|ref|YP_002560324.1| hypothetical protein MCCL_0921 [Macrococcus caseolyticus JCSC5402]
 gi|222120293|dbj|BAH17628.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 416

 Score = 95.2 bits (235), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/256 (12%), Positives = 89/256 (34%), Gaps = 27/256 (10%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY-- 61
            G    +  T +  + +E     E+V+ E  +R +     + +   P      +++ Y  
Sbjct: 116 SGIGAIRGMTAYGAYINEASLAHEEVFDEIKSRCSGYGARILVDTNPDHPEHWLLKDYIE 175

Query: 62  LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR-TKGEPILGSGRIFPIVE- 119
            + + +     +  +++    NE+ ++ I  S P      R   G  + G G ++   + 
Sbjct: 176 NTDAKAGILSYQFKLDDNTFLNERYKQSIKASTPSGMFYERNINGMWVSGDGVVYSDFDL 235

Query: 120 --EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH 177
               I  + L+         G+D+G+ H  +   +  +   + +Y+++ +  + +     
Sbjct: 236 EQNTITADELNEIPMKEYFAGVDWGYEHYGSIVVMAKDFKEN-LYLIEEHAHQHKFIDEW 294

Query: 178 VAA---LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
                 ++     +P+       +H K+        ++ +G+  +              A
Sbjct: 295 AMIAKDIEERYGKIPFYCDTARTEHIKK--------FKDEGINAVYANKNR-------MA 339

Query: 235 GISDMLDRMRSGRWKV 250
           G+  +    +     V
Sbjct: 340 GVEQVAKLFKLNCLFV 355


>gi|66394679|ref|YP_240816.1| ORF009 [Staphylococcus phage X2]
 gi|62636903|gb|AAX92014.1| ORF009 [Staphylococcus phage X2]
          Length = 421

 Score = 95.2 bits (235), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 36/256 (14%), Positives = 78/256 (30%), Gaps = 27/256 (10%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L              +  P
Sbjct: 113 AQNPERLKSLKDSRFPFSISWIEELAEFKTEDEVTTITNSLLRGELDEGLFYKFFFSYNP 172

Query: 51  L-KGRSPIIEHYLS-ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y S   + +  V   T    P  ++Q  +    +   +E+  R +    
Sbjct: 173 PKRKQSWVNKKYESSFQADNTYVHHSTYLNNPFISKQFIQEAESAKKRNEQRYRWEYMGE 232

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIG-GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
                + P     I        + +  I   +DFG+   P A     +++   VIY +  
Sbjct: 233 AIGSGVVPFNNLRIEEIPQRQYDTFDNIRNAVDFGYATDPLAFVRWHYDKKKRVIYAMDE 292

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           +   + +       LK  G      +  D +  D    + ++   +      + +     
Sbjct: 293 HYGVQISNREFANWLKKKG------YQSDEVFADSAEPKSIAELKQEH---GIKKIKGVK 343

Query: 227 DGSNGVEAGISDMLDR 242
            G++ VE G   + D 
Sbjct: 344 KGADSVEFGEQWLDDL 359


>gi|254362872|ref|ZP_04978947.1| bacteriophage terminase large subunit [Mannheimia haemolytica
           PHL213]
 gi|153094509|gb|EDN75343.1| bacteriophage terminase large subunit [Mannheimia haemolytica
           PHL213]
          Length = 410

 Score = 94.8 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 68/234 (29%), Gaps = 17/234 (7%)

Query: 18  YVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE     E  + + +  +      + +T  P    S     +      +  +I M+
Sbjct: 124 IAWIDEAETVSETAWRKLIPTVRENNSEIWVTWNPENRGSATDTRFRQNPPENSCIIEMS 183

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
             + P +    EQER                +G+          I  +            
Sbjct: 184 YQDNPWFPDVLEQERLNDKQRLDDATYRWIWEGDY--LESSDAQIFRDKYQELEFKPNPD 241

Query: 133 WV-QIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
           +     G+DFG+ +   A    W  D D +Y+ +             A L +        
Sbjct: 242 FNGPYYGLDFGFANDPTACVKCWVFDDD-LYIEREAGKVRLELDETAAYLANALPD---- 296

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRS 245
             +  ++ D    E +S   +R G+   P           VE G+  +    + 
Sbjct: 297 LSNYTVRADSARPESIS-YLKRHGL---PYIQPVPKWKGSVEDGVEHIKSYRKV 346


>gi|152982949|ref|YP_001353896.1| hypothetical protein mma_2206 [Janthinobacterium sp. Marseille]
 gi|151283026|gb|ABR91436.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 436

 Score = 94.8 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 27/223 (12%), Positives = 59/223 (26%), Gaps = 13/223 (5%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
             D  +      V  DE  +    V+   +   +    G   +  TP         +  +
Sbjct: 111 NADALRGLFFDGVVADEYGDWKPSVWGYVIRPALADRGGWAVIIGTPKGRNQFWEIYQHA 170

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILG-----SGRIFPIV 118
             + D   + +  +E+     +E + +             + +          G+     
Sbjct: 171 GVNEDWLCLTIRASESGLLPPKEIEALQLELTEDAWRQEMECDFDAALPGAIFGKEIWQA 230

Query: 119 EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV 178
           E+D  +              +D G+    A            + ++  Y         + 
Sbjct: 231 EQDGRVKDDLYDPELKVHAVLDLGFTDDTAIWWFQV---GKELRIIDCYSTHGMPIAHYN 287

Query: 179 AALKSWGKWLP--WAWPHDGLQHDKRSGEQLSAQYRRQGMKML 219
             L +           PHD      ++G  +  Q+R  G K  
Sbjct: 288 DVLHAKNYKYGDWLWLPHDARAKSLQTGRSIEEQFRSLGWKPR 330


>gi|303246839|ref|ZP_07333116.1| protein of unknown function DUF264 [Desulfovibrio fructosovorans
           JJ]
 gi|302491856|gb|EFL51736.1| protein of unknown function DUF264 [Desulfovibrio fructosovorans
           JJ]
          Length = 485

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/288 (12%), Positives = 73/288 (25%), Gaps = 56/288 (19%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPEDV--YFEGLTRIN----------ATQGLVTLTLTPLK 52
           E     +Q   +H +  DE        Y     R+                +     P  
Sbjct: 121 EADVFAYQGAEIHLLLIDELTHFTEFMYDYLRGRLRCTLEAPPEMRHKIPGIVCASNPGG 180

Query: 53  GRSPIIE-HYLSASSSD-------------RQVIRMTINETPHY--NEQERKRIIDSYPL 96
                ++  ++  +                R  I   + +       +    + +D+ P 
Sbjct: 181 VGHAFVKARFVDFAPPMTPRRAPDAEGGMLRCHIPGRLADNAILLARDPGYAKRLDALPE 240

Query: 97  HEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNR 156
             R A   G+  +  G+ F       V+    +PE        D+G+  PF+ G    + 
Sbjct: 241 PYRTAYRDGDWDVFMGQAFAFSRRLHVVKPRPVPETAPLFMTFDWGYGAPFSVGWWWVDG 300

Query: 157 DSDVIYVVKNYRCRE--------QTPIFHVAALKSWGKWL------------PWAWPHDG 196
           +  ++     +             T       ++                  P  +    
Sbjct: 301 EGRLLR-FAEWYGTNGSPNQGLRLTDSRIADGIRERETRHGIAGRAITRLAGPDCFAKKP 359

Query: 197 LQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
                  G   +  +   G+ + P       G     A I    +R+R
Sbjct: 360 DYRGGGQGPSTAEVFAAAGVFLAP-------GDPSRTAKIRQFHERLR 400


>gi|321315003|ref|YP_004207290.1| PBSX defective prophage terminase large subunit [Bacillus subtilis
           BSn5]
 gi|291483777|dbj|BAI84852.1| PBSX defective prophage terminase large subunit [Bacillus subtilis
           subsp. natto BEST195]
 gi|320021277|gb|ADV96263.1| PBSX defective prophage terminase (large subunit) [Bacillus
           subtilis BSn5]
          Length = 433

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/237 (14%), Positives = 73/237 (30%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGR--SPIIEHYLSASSS---- 67
           +  +W +E  E   + + E + R+   +  + +  T       +    H+          
Sbjct: 116 ISLIWIEECSEVKYEGFKELIGRLRHPELKLHMICTTNPVGTSNWTYRHFFRDERKKRFV 175

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          D      T N+     E   K++  +  Y         KG   + 
Sbjct: 176 LDDSELYEKRTIVKGDTYYHHSTANDNLFLPESYLKQLDGLKEYDPDLYRIARKGRFGVN 235

Query: 111 SGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  E    + +   +      +   GMDFG+     A   L  + +   +Y+   
Sbjct: 236 GIRVLPQFEVLPHNQMKKCIAAISKPIFRTGMDFGFEESYNAVVRLAVDPEKKYLYIYWE 295

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       L+ +          + ++ D    + +   +R+QG +M+    
Sbjct: 296 YYQNKMTDDRTAEELREF------IETQELIKADSAEPKSI-QYFRQQGFRMVGARK 345


>gi|237743779|ref|ZP_04574260.1| phage terminase [Fusobacterium sp. 7_1]
 gi|229432810|gb|EEO43022.1| phage terminase [Fusobacterium sp. 7_1]
          Length = 426

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/263 (14%), Positives = 90/263 (34%), Gaps = 39/263 (14%)

Query: 7   GRDKWQSN-TVHYVWFDE--EPPEDVYFEG--LTRINATQGLVTLTLTPLKGRSPIIEHY 61
             +K +S   V  +W +E  E   + + E     R       + LT  P+   +   E +
Sbjct: 107 DPEKLKSIDNVDMIWIEECPEISYNAFNELNGRLRALEKDLHIFLTNNPVSVNNWTYERF 166

Query: 62  LS--------------ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLH--EREARTKG 105
           +                ++ D       + +     ++  K++ +             +G
Sbjct: 167 IKKAGIDEEELYQNRIMTTDDTYYHHSVVEDNAFVTDEYIKQLKNFETYDIERYRIAYQG 226

Query: 106 EPILGSGRIFPIVEEDIVINSLDIPEHWVQIG------GMDFGWH-HPFAAGHLVWNRDS 158
              +   R+F  +++        I +   + G      G+D+G+     A   +  +R++
Sbjct: 227 RFGIVGERVFTNIQKASDTEVQAIVKELSKYGLGNLYDGLDYGFSFSYNALVRMALDREN 286

Query: 159 DVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKM 218
           +++Y+      ++      +  LK      P    H  +  D    E  + + RR G K+
Sbjct: 287 NLLYIYDEVYNKKLITSELIETLK------PIKNKHREIIADNARPET-TEEIRRAGFKI 339

Query: 219 LPECATFDDGSNGVEAGISDMLD 241
           +    + + G+  +  G+  +  
Sbjct: 340 I----SCEKGAGSILDGLQKLRS 358


>gi|148544063|ref|YP_001271433.1| PBSX family phage terminase large subunit [Lactobacillus reuteri
           DSM 20016]
 gi|184153441|ref|YP_001841782.1| putative phage terminase [Lactobacillus reuteri JCM 1112]
 gi|227365124|ref|ZP_03849143.1| PBSX family phage terminase large subunit [Lactobacillus reuteri
           MM2-3]
 gi|325682397|ref|ZP_08161914.1| prophage Lp1 protein 38 [Lactobacillus reuteri MM4-1A]
 gi|148531097|gb|ABQ83096.1| phage terminase, large subunit, PBSX family [Lactobacillus reuteri
           DSM 20016]
 gi|183224785|dbj|BAG25302.1| putative phage terminase [Lactobacillus reuteri JCM 1112]
 gi|227069827|gb|EEI08231.1| PBSX family phage terminase large subunit [Lactobacillus reuteri
           MM2-3]
 gi|324978236|gb|EGC15186.1| prophage Lp1 protein 38 [Lactobacillus reuteri MM4-1A]
          Length = 431

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 44/242 (18%), Positives = 79/242 (32%), Gaps = 27/242 (11%)

Query: 15  TVHYVWFDEE------PPEDVYFEGLTRINATQG---LVTLTLTPLKGRSPIIEHYLSAS 65
            + +VW +E          +   E +       G    +T+T  P   +  +   +    
Sbjct: 125 YLSFVWIEEAYEIENADKLETLQESIRGRIDVPGAFKQITVTFNPWNAQHWLKRTFFDPE 184

Query: 66  --SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEED 121
              +D      T       +EQ+R+R +D Y  + R A+    G+  +  G +F    E 
Sbjct: 185 TRKADTFAQTTTFRCNEWLDEQDRQRYLDLYKTNPRRAKVAADGDWGVSEGLVFEDNVER 244

Query: 122 IVINSLDIPEHWVQ-IGGMDFG-WHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
           +  +  +          G+D+G    P A   L  +  S  I++        QT      
Sbjct: 245 VEFDPQEKLTECGHAGFGLDYGFGGDPNAFVALAIDPKSKNIWIYDEMYTYHQTTPHIAD 304

Query: 180 ALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
            LK  G      + H  +  D  S E  + Q     +  +            +EAGI  +
Sbjct: 305 WLKKNG------YQHASIYADSASPE-RTQQLLDLDIDNIQSVVKTP-----IEAGIDQL 352

Query: 240 LD 241
             
Sbjct: 353 WQ 354


>gi|21910863|ref|NP_665131.1| putative terminase large subunit - phage associated [Streptococcus
           pyogenes MGAS315]
 gi|28876409|ref|NP_795632.1| putative terminase large subunit [Streptococcus pyogenes phage
           315.5]
 gi|21905069|gb|AAM79934.1| putative terminase large subunit - phage-associated [Streptococcus
           pyogenes MGAS315]
          Length = 273

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 65/204 (31%), Gaps = 13/204 (6%)

Query: 43  LVTLTLTPL-KGRSPIIEHYLSASSSDRQVIRM-TINETPHYNEQERKRIIDSYPLHERE 100
               T  P  + +S + + Y S        +   T  + P   ++       +    ER 
Sbjct: 12  KFFYTYNPPKRKQSWVNKKYESQFQPSNTFVHASTYKDNPFIAKEFIAEAEATRERSERR 71

Query: 101 ARTKGEPIL-GSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDS 158
            R +      GSG +         I    + +      G+D+G+   P A     +++  
Sbjct: 72  YRWEYLGEAIGSGVVPFDNLRFERITDEQVADFDNIRNGIDYGYATDPLAFVRWHYDKKK 131

Query: 159 DVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKM 218
           + IY +  Y  ++ +       L + G      +  D +  +    +  +      G+K 
Sbjct: 132 NGIYAIDEYYGQKISNRQLAKWLTTKG------YQSDEMFAESAEPKSNAELKNEFGIK- 184

Query: 219 LPECATFDDGSNGVEAGISDMLDR 242
                    G + VE G   + D 
Sbjct: 185 --RIKGVKKGPDSVEFGERWLDDL 206


>gi|216905967|ref|YP_002333563.1| gp2 [Bacillus phage TP21-L]
 gi|215809694|gb|ACJ70528.1| gp2 [Bacillus phage TP21-L]
          Length = 439

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 64/203 (31%), Gaps = 13/203 (6%)

Query: 44  VTLTLTPLKGR-SPIIEHYLSASSSD-RQVIRMTINETPHYNEQERKRIIDSYPLHEREA 101
              +  P K R   + + Y S+   D   V   T  +  +  +   +       ++  + 
Sbjct: 177 FFYSYNPPKRRAHWLNKKYNSSFIPDNTHVNHSTYLDNDYLTKAFYEEAEIEKKMNPLKY 236

Query: 102 RTKGEPIL-GSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSD 159
           R +      GSG +         I    I +      G+DFG+   P A G + +++  +
Sbjct: 237 RWEYLGEAIGSGVVPFDNIVSAEITDEQISQFDNIRQGIDFGYATDPLAFGRMHFDKKKN 296

Query: 160 VIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKML 219
            +Y+       + +       +K  G              D    + ++       ++  
Sbjct: 297 TLYIFDELYGVQISNRKLAEWIKKKGYQDIEI------TCDSAEPKSIAELKNEHDIR-- 348

Query: 220 PECATFDDGSNGVEAGISDMLDR 242
            +      G + VE G   + D 
Sbjct: 349 -KVKGAKKGPDSVEYGTEWLGDL 370


>gi|72384687|gb|AAZ67635.1| phage terminase large subunit-like protein [Haemophilus parasuis
           29755]
          Length = 405

 Score = 94.1 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 69/230 (30%), Gaps = 17/230 (7%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + + L  +      + LT  P K  S     +         ++ M 
Sbjct: 125 LAWIDEAESVSEMAWRKLLPTVRENGSEIWLTWNPEKKGSATDLRFRQHQDESMAIVEMN 184

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    EQER R              +G+  L          +   +    +P+ 
Sbjct: 185 YSDNPWFPDVLEQERLRDKARLDDATYRWIWEGDY-LEESEAQVFRGKYQELEFKPLPDF 243

Query: 133 WVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
                G+DFG+   P AA      +D   +Y+                 L+     +   
Sbjct: 244 EGPYHGLDFGFAQDPTAAIKCWVFKD--ELYIEYEAGKVGLELDDTATFLQKGIASIEQY 301

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
                ++ D    E +S   +R G+   P           VE GI+ +  
Sbjct: 302 V----IRADSARPESIS-YLKRHGL---PRIDGVSKWKGSVEDGIAHIKS 343


>gi|311067750|ref|YP_003972673.1| PBSX defective prophage terminase large subunit [Bacillus
           atrophaeus 1942]
 gi|310868267|gb|ADP31742.1| PBSX defective prophage terminase (large subunit) [Bacillus
           atrophaeus 1942]
          Length = 432

 Score = 94.1 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 72/237 (30%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQG--LVTLTLTPLKGRSPIIEHYLSASSS---- 67
           +  +W +E  E   + + E + R+   +    +  T  P+   +    H+     +    
Sbjct: 116 ISLIWIEECSEVKYEGFKELIGRLRHPKLDLHMICTTNPVGTSNWTYRHFFRDERNKRYI 175

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          D      T  +     E   K++  +  Y         +G   + 
Sbjct: 176 LDDQELYKKRTIVSGDTYYHHSTALDNLFLPESYVKQLDGLKRYDPDLYRIARQGRFGVN 235

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIG---GMDFGWH-HPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  E      + +   +  +     GMDFG+     A   L  + +   +Y+   
Sbjct: 236 GVRVLPQFEVLPHEQAEECIANISRPIFRTGMDFGFEESYNAVIRLAVDPEKKHLYIYWE 295

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       L+   +           + D    + +   +R+QG +M+    
Sbjct: 296 YYKNKMTDDRTAEELRELAEKQEVI------KADSAEPKSI-QYFRQQGFRMVAARK 345


>gi|16078323|ref|NP_389140.1| PBSX defective prophage terminase large subunit [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221309110|ref|ZP_03590957.1| PBSX defective prophage terminase (large subunit) [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221313437|ref|ZP_03595242.1| PBSX defective prophage terminase (large subunit) [Bacillus
           subtilis subsp. subtilis str. NCIB 3610]
 gi|221318360|ref|ZP_03599654.1| PBSX defective prophage terminase (large subunit) [Bacillus
           subtilis subsp. subtilis str. JH642]
 gi|221322633|ref|ZP_03603927.1| PBSX defective prophage terminase (large subunit) [Bacillus
           subtilis subsp. subtilis str. SMY]
 gi|1722887|sp|P39786|XTMB_BACSU RecName: Full=PBSX phage terminase large subunit
 gi|1225943|emb|CAA94059.1| PBSX terminase [Bacillus subtilis subsp. subtilis str. 168]
 gi|2633612|emb|CAB13115.1| PBSX defective prophage terminase (large subunit) [Bacillus
           subtilis subsp. subtilis str. 168]
          Length = 433

 Score = 94.1 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/237 (15%), Positives = 73/237 (30%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGR--SPIIEHYLSASSS---- 67
           +  +W +E  E   + + E + R+   +  + +  T       +    H+          
Sbjct: 116 ISLIWIEECSEVKYEGFKELIGRLRHPELKLHMICTTNPVGTSNWTYRHFFRDERKKRFV 175

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          D      T N+     E   K++  +  Y         KG   + 
Sbjct: 176 LDDSELYEKRTIVKGDTYYHHSTANDNLFLPESYVKQLDGLKEYDPDLYRIARKGRFGVN 235

Query: 111 SGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  E    D V   +      +   GMDFG+     A   L  + +   +Y+   
Sbjct: 236 GIRVLPQFEVLPHDQVKKCIAAISKPIFRTGMDFGFEESYNAVVRLAVDPEKKYLYIYWE 295

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       L+ +          + ++ D    + +   +R+QG +M+    
Sbjct: 296 YYQNKMTDDRTAEELREF------IETQELIKADSAEPKSI-QYFRQQGFRMVGARK 345


>gi|52079727|ref|YP_078518.1| putative phage terminase (large subunit) [Bacillus licheniformis
           ATCC 14580]
 gi|52785096|ref|YP_090925.1| XtmB [Bacillus licheniformis ATCC 14580]
 gi|319646468|ref|ZP_08000697.1| XtmB protein [Bacillus sp. BT1B_CT2]
 gi|52002938|gb|AAU22880.1| putative phage terminase (large subunit) [Bacillus licheniformis
           ATCC 14580]
 gi|52347598|gb|AAU40232.1| XtmB [Bacillus licheniformis ATCC 14580]
 gi|317391056|gb|EFV71854.1| XtmB protein [Bacillus sp. BT1B_CT2]
          Length = 432

 Score = 94.1 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/237 (14%), Positives = 75/237 (31%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTL--TLTPLKGRSPIIEHYLSASSS---- 67
           +  +W +E  E   + + E + R+      + +  T  P+   +    H+     +    
Sbjct: 116 ISLIWIEECSEVKYEGFKELIGRLRHPYHRLYMMLTTNPVSQSNWTYRHFFKDERNKRFI 175

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          D      T ++     +   K++  + +Y         KG   + 
Sbjct: 176 LDDEVLYKKRVAVVGDTYYHHSTADDNLFLPKSYLKQLDDMKAYDPDLYRIARKGRFGVN 235

Query: 111 SGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  E    + V+  +    + ++  GMDFG+     A      + D   +Y+   
Sbjct: 236 GTRVLPQFEVMEHEEVMRQISAISNPLKRTGMDFGFEESYNAVVRAAVDPDKKYLYIYWE 295

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       L  +      A   + ++ D    + +   +R+ G  M     
Sbjct: 296 YYKNKMTDDKTAEELHEF------AVAKELIKADPAEPKSI-QFFRQNGFNMTAARK 345


>gi|283852514|ref|ZP_06369782.1| protein of unknown function DUF264 [Desulfovibrio sp. FW1012B]
 gi|283572122|gb|EFC20114.1| protein of unknown function DUF264 [Desulfovibrio sp. FW1012B]
          Length = 471

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/303 (14%), Positives = 77/303 (25%), Gaps = 64/303 (21%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPEDV--YFEGLTRIN----------ATQGLVTLTLTPLK 52
           E     +Q   +H +  DE        Y     R+                V     P  
Sbjct: 103 EADVFAYQGVEIHLLVIDELTHFTEFQYDYLRGRLRCALAVPPALRHKIPGVVCASNPGG 162

Query: 53  GRSPIIEHYLSASSSD--------------RQVIRMTINETPHY--NEQERKRIIDSYPL 96
                ++      +                R  I   + +       +      +D+ P 
Sbjct: 163 VGHGFVKARFVDFAPPLTPRRAPAEEGGMLRCFIPGKLADNQILLSRDPGYALRLDALPE 222

Query: 97  HEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNR 156
             R A   G+  +  G+ F       V+    +PEH       D+G+  PF+ G    + 
Sbjct: 223 PYRSAYRDGDWDIFLGQAFAFSRRLHVVKPRPVPEHGPLFMTFDWGYGAPFSVGWWWVDA 282

Query: 157 DSDVIYVVKNYRCR----EQTP-------IFHVAALKSWGKWL------------PWAWP 193
           D  +      +        +TP           A +      L            P  + 
Sbjct: 283 DGRLFR-FSEWYGAAGGPGRTPQGLRLADSGIAAGILEREARLGLAGRALTRLAGPDCFA 341

Query: 194 HDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGR-----W 248
                     G   +  +   G+ ++P       G     A I    +R+R         
Sbjct: 342 KKPDYRGGGQGPSTAEVFAGAGLFLVP-------GDPSRVAKIRQFHERLRPREDGPPLL 394

Query: 249 KVF 251
           +VF
Sbjct: 395 QVF 397


>gi|294789839|ref|ZP_06755067.1| phage terminase, large subunit, PBSX family [Simonsiella muelleri
           ATCC 29453]
 gi|294482221|gb|EFG29920.1| phage terminase, large subunit, PBSX family [Simonsiella muelleri
           ATCC 29453]
          Length = 413

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/246 (15%), Positives = 74/246 (30%), Gaps = 21/246 (8%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPII 58
           L+   Q         +     +E     E  +      I A +  + +   P +  S   
Sbjct: 113 LRNNTQSIKSL--ANIDICVIEEAEDISESAWEVLEPTIRAPKSEIWVIWNPKQRGSATD 170

Query: 59  EHYLSASSSDRQVIRMTINETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIF 115
             +   +     ++ +  ++ P +    +++RK               +G          
Sbjct: 171 TRFRQNTPPRSCIVEINHSDNPFFPDVLDEQRKYQQKVLDPARYAWIWEGAY--YEQSDA 228

Query: 116 PIVEEDIVINSLDIPEHWV-QIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
            +      +        W     G+DFG+   P AA         + +++ +        
Sbjct: 229 QVFAGKYAVREFTPQSDWNGAYFGLDFGFSQDPTAAIECYV--ADNCLWIYREAGGVGLE 286

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                  LKS    +P    H  ++ D    E +S   RR G+   P     + G   VE
Sbjct: 287 LDDTAGCLKSI---MPEIDKH-IIRADSARPESIS-YLRRHGL---PRIVAVEKGRGSVE 338

Query: 234 AGISDM 239
           +GI  +
Sbjct: 339 SGIEFI 344


>gi|71898835|ref|ZP_00681003.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71731421|gb|EAO33484.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 291

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 62/128 (48%), Positives = 87/128 (67%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           LK++EQG +KWQ++ V+++WFDE+PPEDVYFEG+TR N T GLV +T  PLK    ++  
Sbjct: 41  LKSFEQGGEKWQADPVNWMWFDEQPPEDVYFEGITRTNRTFGLVCMTFAPLKSILTVVWR 100

Query: 61  YLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
           +L  +  DR  ++M I +  HY  ++  RI  SYP +ER+ART+G P LGSGR+FPI  E
Sbjct: 101 FLLENVPDRADVQMIIEDAEHYLLEDCARITASYPPYERQARTQGVPALGSGRLFPIAGE 160

Query: 121 DIVINSLD 128
            I +    
Sbjct: 161 KIGVAPEK 168


>gi|321312115|ref|YP_004204402.1| putative phage-related terminase large subunit [Bacillus subtilis
           BSn5]
 gi|320018389|gb|ADV93375.1| putative phage-related terminase large subunit; skin element
           [Bacillus subtilis BSn5]
          Length = 431

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/237 (14%), Positives = 70/237 (29%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGL--VTLTLTPLKGRSPIIEHYLSASSS---- 67
           +  +W +E  E   + + E L R+        + L+  P+   +   +H+          
Sbjct: 115 ISLIWIEECSEVKYEGFKELLGRLRHPTLPLHMILSTNPVGEDNWTFKHFFKDDREKRFV 174

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRII--DSYPLHEREARTKGEPILG 110
                          D      T ++     E   +++     Y         KG   + 
Sbjct: 175 LDDKELYEKRIIVSNDTYYHHSTADDNLFLPESYVQQLEELKEYDPDLYRIARKGHFGVN 234

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQI---GGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  EE      L       +     GMDFG+     A   +  + +   +Y+   
Sbjct: 235 GIRVLPQFEEWPHEEVLKAIADINRPLKRVGMDFGFVESYNAVVRVAVDPEKKYLYIYWE 294

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y     T       LK +          + ++ D    + +   +++ G  M+    
Sbjct: 295 YYKNGLTDDKTAEELKEF------VETKELIKSDSAEPKTIR-FFQQHGFNMVGARK 344


>gi|308173233|ref|YP_003919938.1| PBSX terminase large subunit [Bacillus amyloliquefaciens DSM 7]
 gi|307606097|emb|CBI42468.1| PBSX terminase (large subunit)) [Bacillus amyloliquefaciens DSM 7]
 gi|328553846|gb|AEB24338.1| PBSX terminase (large subunit) [Bacillus amyloliquefaciens TA208]
 gi|328911299|gb|AEB62895.1| PBSX terminase (large subunit) [Bacillus amyloliquefaciens LL3]
          Length = 432

 Score = 93.3 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/237 (14%), Positives = 68/237 (28%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGR--SPIIEHYLSASSS---- 67
           +  +W +E  E   + + E + R+   +  + +  T       +    H+          
Sbjct: 116 ISLIWIEECSEVKYEGFKELIGRLRHPELSLHMICTTNPVGTSNWTYRHFFRDEQKKRFV 175

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          D      T  +     +   K++  +  Y         KG+  + 
Sbjct: 176 LDDHTLYEKGTVVKGDTYYHHSTACDNLFLLKSYIKQLDSLRQYDPDLYRIARKGQFGVN 235

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIG---GMDFGWH-HPFAAGHLVWNRDSDVIYVVKN 166
             R+FP  +        +      +     GMDFG+     A   L  + D   +Y+   
Sbjct: 236 GIRVFPQFQVMEHTEVTERIAAIRRPLFRTGMDFGFEESYNAVIRLAVDPDKKELYIFWE 295

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       L+               + D    + +   +RRQG  M+    
Sbjct: 296 YYKNKMTDDQTAEELQELADKKELI------KADSAEPKSI-QYFRRQGFCMVAAKK 345


>gi|221314872|ref|ZP_03596677.1| hypothetical protein BsubsN3_14247 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
          Length = 433

 Score = 93.3 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 72/237 (30%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGL--VTLTLTPLKGRSPIIEHYLSASSS---- 67
           +  +W +E  E   + + E L R+        + L+  P+   +   +H+          
Sbjct: 117 ISLIWIEECSEVKYEGFKELLGRLRHPTLPLHMILSTNPVGEDNWTFKHFFKDDREKRFV 176

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRII--DSYPLHEREARTKGEPILG 110
                          D      T ++     E   +++     Y         KG   + 
Sbjct: 177 LDDKELYEKRIIVSNDTYYHHSTADDNLFLPESYVQQLEELKEYDPDLYRIARKGHFGVN 236

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQI---GGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  EE      +    +  +     GMDFG+     A   +  + +   +Y+   
Sbjct: 237 GIRVLPQFEERPHEEVMTAISNINRPLKRVGMDFGFVESYNAVVRVAVDHEKKYLYIYWE 296

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y     T       LK + +        + ++ D    + +   +++ G  M+    
Sbjct: 297 YYKNGLTDDKTAEELKEFAE------TKELIKADSAEPKTIR-YFQQHGFNMVGARK 346


>gi|240115343|ref|ZP_04729405.1| putative phage associated protein [Neisseria gonorrhoeae PID18]
          Length = 424

 Score = 93.3 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 111 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 168

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 169 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMSKEDYGHIWEGRPRMVSEGAVYRHEIQ 228

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 229 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 286

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 287 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNATGIEEG 341

Query: 236 ISDMLDRM 243
           I       
Sbjct: 342 IRAARMLF 349


>gi|126652757|ref|ZP_01724909.1| hypothetical protein BB14905_21478 [Bacillus sp. B14905]
 gi|126590446|gb|EAZ84565.1| hypothetical protein BB14905_21478 [Bacillus sp. B14905]
          Length = 420

 Score = 93.3 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/253 (14%), Positives = 86/253 (33%), Gaps = 38/253 (15%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDE--EPPEDVYFEGLTRINAT--QGLVTLTLTPLKGRS 55
            +  ++  +K +S   +  +W +E  E     + E L R+     +  + L+  P+   +
Sbjct: 100 FRGMDK-PEKLKSINNISLIWLEECSEIKYAGFKELLGRLRHPTLKLFIILSTNPVSKGN 158

Query: 56  PIIEHYLSASSS-------------------DRQVIRMTINETPHYNEQERKRI--IDSY 94
            + +H+                         +      T ++         +++  ++ Y
Sbjct: 159 WVYKHFFKNELEEYFVLDDEELYKQQTIIVNNTYYHHSTADDNLFLPVSYIEQLDEMELY 218

Query: 95  PLHEREARTKGEPILGSGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGW-HHPFAAG 150
                    KG   +    + P  E    + V+N + +    ++  GMDFG+     A  
Sbjct: 219 DPDLYRIARKGRFGVNGVLVLPQFEIKPHEEVMNEIALIRKPIRKNGMDFGFVDSYNALL 278

Query: 151 HLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQ 210
            +V + +   +Y+   Y  R  T       L+  G           ++ D    + ++  
Sbjct: 279 RMVVDHEKKWLYIYWEYYKRGMTDDKTADELEEEG------LKKSIIKADNAEPKTIA-Y 331

Query: 211 YRRQGMKMLPECA 223
           Y+++G +M     
Sbjct: 332 YKQRGFRMFACKK 344


>gi|16079672|ref|NP_390496.1| phage-related terminase large subunit; skin element [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221310548|ref|ZP_03592395.1| hypothetical protein Bsubs1_14326 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221319794|ref|ZP_03601088.1| hypothetical protein BsubsJ_14163 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324073|ref|ZP_03605367.1| hypothetical protein BsubsS_14297 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|1176739|sp|P45916|YQAT_BACSU RecName: Full=Uncharacterized protein yqaT; AltName: Full=ORF50
 gi|1217848|dbj|BAA06933.1| ORF50 [Bacillus subtilis]
 gi|1303739|dbj|BAA12395.1| YqaT [Bacillus subtilis]
 gi|2635064|emb|CAB14560.1| putative phage-related terminase large subunit; skin element
           [Bacillus subtilis subsp. subtilis str. 168]
          Length = 431

 Score = 92.9 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 72/237 (30%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGL--VTLTLTPLKGRSPIIEHYLSASSS---- 67
           +  +W +E  E   + + E L R+        + L+  P+   +   +H+          
Sbjct: 115 ISLIWIEECSEVKYEGFKELLGRLRHPTLPLHMILSTNPVGEDNWTFKHFFKDDREKRFV 174

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRII--DSYPLHEREARTKGEPILG 110
                          D      T ++     E   +++     Y         KG   + 
Sbjct: 175 LDDKELYEKRIIVSNDTYYHHSTADDNLFLPESYVQQLEELKEYDPDLYRIARKGHFGVN 234

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQI---GGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  EE      +    +  +     GMDFG+     A   +  + +   +Y+   
Sbjct: 235 GIRVLPQFEERPHEEVMTAISNINRPLKRVGMDFGFVESYNAVVRVAVDHEKKYLYIYWE 294

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y     T       LK + +        + ++ D    + +   +++ G  M+    
Sbjct: 295 YYKNGLTDDKTAEELKEFAE------TKELIKADSAEPKTIR-YFQQHGFNMVGARK 344


>gi|11863101|ref|NP_071818.1| putative large terminase subunit [Methanothermobacter phage
           psiM100]
 gi|11692721|gb|AAG39957.1|AF301375_17 putative large terminase subunit [Methanothermobacter phage
           psiM100]
          Length = 467

 Score = 92.9 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/259 (16%), Positives = 78/259 (30%), Gaps = 17/259 (6%)

Query: 4   YEQGRDKWQSNTVHYVWFDEEP-----PEDVYFEGLTRINATQGLVTLTLTPLKGRSPII 58
           +E+ R ++Q ++ HY+ FDE            F  L +       +    T   G     
Sbjct: 156 HEKDRYRYQGSSYHYIAFDELTEFLESQYRFMFRSLRKEADDPIPLRFRATSNPGGIGHE 215

Query: 59  EHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILG--SGRIFP 116
                  + ++  I  T  E P+ N  E +  ++      R    +G+  +    G    
Sbjct: 216 WVKTRFITGEKTFIPSTWRENPYLNRDEYEEALNMLDHVTRRQLKEGDWDVSIQGGVFRR 275

Query: 117 IVEEDIVINSLDIPEHWVQI---GGMDFGWHHP--FAAGHLVWNRDSDVIYVVKNYRCRE 171
              E I     D+               G + P       +  ++D D  YV+   R R 
Sbjct: 276 EWFEIIDTPPHDLVMKLRYWDLAATPHDGSNDPDYTVGLLMGVDQD-DYYYVLDIQRFRG 334

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
                    L++  +           + +  S  ++   Y R  ++     A    G   
Sbjct: 335 SPGEVKARVLRTAEEDGREVII--AKEEEPGSSGKIVTDYLRSLLQGYTLRADRVTGDKT 392

Query: 232 VEAGISDMLDRMRSGRWKV 250
             A    +     S R KV
Sbjct: 393 TRA--LPVSSYAESFRIKV 409


>gi|268597147|ref|ZP_06131314.1| phage terminase [Neisseria gonorrhoeae FA19]
 gi|268550935|gb|EEZ45954.1| phage terminase [Neisseria gonorrhoeae FA19]
          Length = 426

 Score = 92.9 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 113 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 170

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 171 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMSKEDYGHIWEGRPRMVSEGAVYRHEIQ 230

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 231 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 288

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 289 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNAAGIEEG 343

Query: 236 ISDMLDRM 243
           I       
Sbjct: 344 IRAARMLF 351


>gi|240081035|ref|ZP_04725578.1| putative phage associated protein [Neisseria gonorrhoeae FA19]
 gi|240117647|ref|ZP_04731709.1| putative phage associated protein [Neisseria gonorrhoeae PID1]
 gi|240123201|ref|ZP_04736157.1| putative phage associated protein [Neisseria gonorrhoeae PID332]
 gi|268603349|ref|ZP_06137516.1| phage terminase [Neisseria gonorrhoeae PID1]
 gi|268681827|ref|ZP_06148689.1| phage terminase [Neisseria gonorrhoeae PID332]
 gi|268587480|gb|EEZ52156.1| phage terminase [Neisseria gonorrhoeae PID1]
 gi|268622111|gb|EEZ54511.1| phage terminase [Neisseria gonorrhoeae PID332]
          Length = 424

 Score = 92.9 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 111 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 168

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 169 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMSKEDYGHIWEGRPRMVSEGAVYRHEIQ 228

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 229 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 286

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 287 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNAAGIEEG 341

Query: 236 ISDMLDRM 243
           I       
Sbjct: 342 IRAARMLF 349


>gi|330718718|ref|ZP_08313318.1| PBSX family phage terminase large subunit [Leuconostoc fallax KCTC
           3537]
          Length = 422

 Score = 92.5 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/263 (15%), Positives = 73/263 (27%), Gaps = 39/263 (14%)

Query: 1   LKAYEQGRDKWQSNTVH-----YVWFDE------EPPEDVYFEGLTRINATQGLVTLTLT 49
            +  +   +K +S  V      ++WF+E              + L R    + +   +  
Sbjct: 115 FRGAD-DPEKIKSVKVDKGHIKFIWFEELSEFKAAAGIRNIKQSLGR--GGEQMFIFSFN 171

Query: 50  PLKGRSPIIEHYLSAS--SSDRQVIRMT-------INETPHYNEQERKRIIDSYPLHERE 100
           P K +      ++       D  V R T              +E    + +        E
Sbjct: 172 PPKSQRNWTNEFVEQEKVRDDVLVHRSTYLTVPKTWLGNVFISEA---KALKEVNPTAYE 228

Query: 101 ARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFG-WHHPFAAGHLVWNRDSD 159
               G+ ++G+G        +  I             G+DFG    P       ++    
Sbjct: 229 HEYLGK-VVGTGAEVFTNIINQRIPDELAATFDTIYRGLDFGFGADPLGYVEFYYDSTRR 287

Query: 160 VIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKML 219
            +Y V             V A+    K             D      ++  +R  G+ + 
Sbjct: 288 RLYFVNEIYKTGMKNRVAVEAIMKLNKDNNVV------IADSAEPRTIAE-FRDLGLNIQ 340

Query: 220 PECATFDDGSNGVEAGISDMLDR 242
           P       G   VE GI  + D 
Sbjct: 341 PA----VKGPGSVEHGIKWLQDL 359


>gi|268601026|ref|ZP_06135193.1| phage terminase [Neisseria gonorrhoeae PID18]
 gi|268585157|gb|EEZ49833.1| phage terminase [Neisseria gonorrhoeae PID18]
          Length = 417

 Score = 92.5 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 104 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 161

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 162 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMSKEDYGHIWEGRPRMVSEGAVYRHEIQ 221

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 222 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 279

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 280 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNATGIEEG 334

Query: 236 ISDMLDRM 243
           I       
Sbjct: 335 IRAARMLF 342


>gi|148379681|ref|YP_001254222.1| terminase large subunit [Clostridium botulinum A str. ATCC 3502]
 gi|237795044|ref|YP_002862596.1| phage terminase, large subunit, PBSX family [Clostridium botulinum
           Ba4 str. 657]
 gi|148289165|emb|CAL83259.1| terminase large subunit [Clostridium botulinum A str. ATCC 3502]
 gi|229261270|gb|ACQ52303.1| phage terminase, large subunit, PBSX family [Clostridium botulinum
           Ba4 str. 657]
          Length = 419

 Score = 92.5 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 32/236 (13%), Positives = 72/236 (30%), Gaps = 22/236 (9%)

Query: 15  TVHYVWFDEEPPE------DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            + Y+W++E          D   + L R    +  V  +  P + +       +  +  D
Sbjct: 132 YIKYIWYEEVDEFEGKNKIDTINQSLMR-GGPKFFVFYSFNPPESQRNWCNQEVVETRKD 190

Query: 69  RQVIRMTINETP--HYNEQERKRIIDSYPLHEREARTKGEP-ILGSGRIFPIVEEDIVIN 125
           + V        P     EQ          ++  +        + G+G           + 
Sbjct: 191 KYVHHSDYRLVPIEWLGEQFIIEAEHMKKVNPAKYEHDYLGAVTGTGGEVFRNLTIRELT 250

Query: 126 SLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
             +I        G+DFG+   P A   + +++    +Y+       + +    V  +K  
Sbjct: 251 DEEIKVFDRLKNGLDFGYAADPLAYVLMHYDKTRKRLYIFDEIYKVQLSNSKAVKEIKKL 310

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                    +  +  D      ++  ++  G+ +         G + VE GI  + 
Sbjct: 311 N------PLNKRVIADSAEPRTINE-FKTLGLNIKGA----KKGPDSVEHGIKFLS 355


>gi|163868971|ref|YP_001610200.1| hypothetical protein Btr_1983 [Bartonella tribocorum CIP 105476]
 gi|161018647|emb|CAK02205.1| phage-related protein [Bartonella tribocorum CIP 105476]
          Length = 453

 Score = 92.1 bits (227), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 72/242 (29%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQG-----LVTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  P    +P+ + + +  + + + 
Sbjct: 137 LCWVDEAEPVTETAWQTLIPTLREEGDDWNAELWVTWNPYHENAPVEKRFRNVDNPNIKG 196

Query: 72  IRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +   + P + E+  +  +        +     +G  +      +         +E  I
Sbjct: 197 VEINWRDNPKFPEKLNRDRLSDLQQRPEQYNHIWEGGYLQAVQGAYYQKCLLEAEMEGRI 256

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
                D          +        A    V       I V+  Y  + Q    HV  + 
Sbjct: 257 TTVPRDPLMQVRIFWDIGGTGAKADATALWVAQFVGREIRVLDYYEAQGQPLSEHVGWVF 316

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  ++ G +        + G+  V+  I  +  
Sbjct: 317 QRGYEKALMVLPHDGATKDRVYNVSFESALQQAGFQTK---IIPNQGTGAVKMRIEAVRR 373

Query: 242 RM 243
             
Sbjct: 374 LF 375


>gi|224541923|ref|ZP_03682462.1| hypothetical protein CATMIT_01096 [Catenibacterium mitsuokai DSM
           15897]
 gi|224525157|gb|EEF94262.1| hypothetical protein CATMIT_01096 [Catenibacterium mitsuokai DSM
           15897]
          Length = 419

 Score = 91.8 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 77/239 (32%), Gaps = 24/239 (10%)

Query: 15  TVHYVWFDEEPPEDVY------FEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            V YVW++E    + Y       + L R    +  V  +  P + +       +     D
Sbjct: 134 YVKYVWYEECDEFETYDKITNINQSLLR-GGHEYCVFYSFNPPESQRNWCNRQVLVKRDD 192

Query: 69  RQVIRMTINETP--HYNEQERKRIIDSYPLH--EREARTKGEPILGSGRIFPIVEEDIVI 124
             V   T  + P     EQ       +   +  +      GE + G+G       +   I
Sbjct: 193 TYVSHTTYLQAPPEWLGEQFLIEAEHTKKTNIEKYNHDYLGE-VTGTGSEVFTNLDIREI 251

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
              +I        G+DFG+   P A     +++    +++         +    V  +K 
Sbjct: 252 TKEEIDVFDRLKFGLDFGYAGDPLAFIKANYDKTRRRLFIFDEVYGTRLSNADAVKLIKE 311

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                     ++ +  D      ++  ++  G+++         G + V+ GI  + D 
Sbjct: 312 ------INPLNNQVTADSAEPRTINE-FKLLGLRITGA----KKGPDSVKNGIKFLQDL 359


>gi|296330713|ref|ZP_06873190.1| PBSX defective prophage terminase (large subunit) [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305673970|ref|YP_003865642.1| phage terminase large subunit; PBSZ phage [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296152177|gb|EFG93049.1| PBSX defective prophage terminase (large subunit) [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305412214|gb|ADM37333.1| phage terminase (large subunit); PBSZ phage [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 433

 Score = 91.8 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 34/237 (14%), Positives = 72/237 (30%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGR--SPIIEHYLSASSS---- 67
           +  +W +E  E   + + E + R+   +  + +  T       +    H+          
Sbjct: 116 ISLIWIEECSEVKYEGFKELIGRLRHPELKLHMICTTNPVGTSNWTYRHFFRDERKKRFV 175

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          D      T N+     +   K++  +  Y         KG   + 
Sbjct: 176 LDDRELYEKRTIVKGDTYYHHSTANDNLFLPKSYVKQLDGLKVYDPDLYRIARKGRFGVN 235

Query: 111 SGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  E      V   +      +   GMDFG+     A   L  + +   +Y+   
Sbjct: 236 GIRVLPQFEVLPHGQVKERIAAISKPIFRTGMDFGFEESYNAVVRLAVDPEKKYLYIYWE 295

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       L+ +          + ++ D    + +   +R+QG +M+    
Sbjct: 296 YYQNKMTDDRTAEELREF------IDTQELIKADSAEPKSI-QYFRQQGFRMVGARK 345


>gi|237745726|ref|ZP_04576206.1| phage terminase [Oxalobacter formigenes HOxBLS]
 gi|229377077|gb|EEO27168.1| phage terminase [Oxalobacter formigenes HOxBLS]
          Length = 414

 Score = 91.8 bits (226), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 35/242 (14%), Positives = 73/242 (30%), Gaps = 23/242 (9%)

Query: 6   QGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           QG    +   +   W +E     E+ +   +  I      + ++  P+    P  + +++
Sbjct: 121 QGIKSTEG--IDICWVEEGQTVSEESWSILIPTIRKENSEIWISWNPIDEDGPTYKRFVT 178

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEED 121
           A   D     +   + P + +  RK +           E    G+P+  S  +    +  
Sbjct: 179 APPPDCYNAEVNYYDNPWFPDVLRKEMEYLKATDYAAYEHVWLGKPLTVSDAVIFAGKYT 238

Query: 122 IVINSLDIPEHWVQ-IGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVA 179
           +     D+ E   +   G DFG+   P A          D +Y+                
Sbjct: 239 VETFPDDLWEKADRLFFGADFGFARDPSALVRCFIF--GDCLYIDYEAYGVGV------- 289

Query: 180 ALKSWGKWLPWAWPHDGL--QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
            +    +             + D    E +S  ++  G  +             VE GI+
Sbjct: 290 EITELPQLYDSVPGARKWPIKADSARPETISYLHKEHGFNISAAD----KWQGSVEDGIA 345

Query: 238 DM 239
            +
Sbjct: 346 HL 347


>gi|240851102|ref|YP_002972504.1| phage terminase large subunit [Bartonella grahamii as4aup]
 gi|240268225|gb|ACS51813.1| phage terminase large subunit [Bartonella grahamii as4aup]
          Length = 453

 Score = 91.8 bits (226), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 35/242 (14%), Positives = 72/242 (29%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  P    +P+ + + +  +   + 
Sbjct: 137 LCWVDEAEPVTETAWQTLIPTLREEGKDWNAELWVTWNPCYENAPVEKRFRNVDNPHIKG 196

Query: 72  IRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
             +   + P + E+  +  +D       +     +GE +      +         +E  I
Sbjct: 197 AEINWRDNPQFPEKLNRDRMDDLQQRPEQYNHIWEGEYLQAVQGAYYQKCLLEAEMEGRI 256

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
                D          +        A    V       I V+  Y  + Q    HV  + 
Sbjct: 257 TTVPRDPLMQVRIFWDIGGTGAKADATALWVAQFIGREIRVLDYYEAQGQPLSEHVGWVF 316

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  ++ G +        + G+  V+  I  +  
Sbjct: 317 QRGYEKALMVLPHDGATKDRVYNVSFESALQQAGFQTK---VIPNQGTGAVKMRIEAVRR 373

Query: 242 RM 243
             
Sbjct: 374 LF 375


>gi|119953777|ref|YP_950582.1| terminase large subunit [Streptococcus phage SMP]
 gi|118430589|gb|ABK91913.1| terminase large subunit [Streptococcus phage SMP]
          Length = 432

 Score = 91.8 bits (226), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 36/250 (14%), Positives = 72/250 (28%), Gaps = 30/250 (12%)

Query: 16  VHYVWFDEE------PPEDVYFEGLTRINATQ---GLVTLTLTPLKGRSPIIEHYLSAS- 65
           + ++W +E          +   E +            +T+T  P   R  +   +     
Sbjct: 130 LSWLWLEEAYQVENQDKFETLVESIRGSIDAPDFFKQITVTFNPWSERHWLKSAFFDEDT 189

Query: 66  -SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDI 122
              D      T       ++Q+  R  D +  + R A     G+  +  G +F   E   
Sbjct: 190 RKKDVFADTTTYRVNEWLDQQDIDRYEDLWRTNPRRAAVVANGDWGVAEGLVFENYEVKD 249

Query: 123 VINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
                 I        G+DFG+   P     L  + +   +++   +     T       +
Sbjct: 250 FDIVSTIKRIGETTAGLDFGFTHDPTTFPRLAVDLEKKELWIYAEHYEHAMTTDDIFKMI 309

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
                           Q        L A+ + +G++          G   + AGI  M  
Sbjct: 310 VDADMQNAVITADSAEQR-------LIAELQAKGIR---RLVPSIKGKGSINAGIDFMKQ 359

Query: 242 RMRSGRWKVF 251
                 +K++
Sbjct: 360 ------FKIY 363


>gi|291044162|ref|ZP_06569878.1| phage terminase [Neisseria gonorrhoeae DGI2]
 gi|291012625|gb|EFE04614.1| phage terminase [Neisseria gonorrhoeae DGI2]
          Length = 426

 Score = 91.8 bits (226), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 113 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 170

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 171 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQ 230

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 231 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 288

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 289 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNATGIEEG 343

Query: 236 ISDMLDRM 243
           I       
Sbjct: 344 IRAARMLF 351


>gi|240127880|ref|ZP_04740541.1| putative phage associated protein [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 424

 Score = 91.8 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 111 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 168

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 169 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQ 228

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 229 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 286

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 287 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNATGIEEG 341

Query: 236 ISDMLDRM 243
           I       
Sbjct: 342 IRAARMLF 349


>gi|167856075|ref|ZP_02478817.1| phage terminase, large subunit, PBSX family: protein [Haemophilus
           parasuis 29755]
 gi|167852772|gb|EDS24044.1| phage terminase, large subunit, PBSX family: protein [Haemophilus
           parasuis 29755]
          Length = 321

 Score = 91.8 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 70/230 (30%), Gaps = 17/230 (7%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + + L  +  +   + LT  P K  S     +         ++ M 
Sbjct: 41  LAWIDEAESVSEMAWRKLLPTVRESGSEIWLTWNPEKKGSATDLRFRQYQDESMAIVEMN 100

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    EQER R              +G+  L          +   +    +P+ 
Sbjct: 101 YSDNPWFPDVLEQERLRDKARLDDATYRWIWEGDY-LEESEAQVFRGKYQELEFKPLPDF 159

Query: 133 WVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
                G+DFG+   P AA      +D   +Y+                 L+     +   
Sbjct: 160 EGPYHGLDFGFAQDPTAAVKCWVFKD--ELYIEYEAGKVGLELDDTATFLQKGIASIEQY 217

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
                ++ D    E +S   +R G+   P           VE GI+ +  
Sbjct: 218 V----IRADSARPESIS-YLKRHGL---PRIDGVSKWKGSVEDGIAHIKS 259


>gi|59801465|ref|YP_208177.1| putative phage associated protein [Neisseria gonorrhoeae FA 1090]
 gi|260440843|ref|ZP_05794659.1| putative phage associated protein [Neisseria gonorrhoeae DGI2]
 gi|59718360|gb|AAW89765.1| hypothetical protein, putative phage associated protein [Neisseria
           gonorrhoeae FA 1090]
          Length = 424

 Score = 91.8 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 111 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 168

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 169 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQ 228

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 229 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 286

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 287 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNATGIEEG 341

Query: 236 ISDMLDRM 243
           I       
Sbjct: 342 IRAARMLF 349


>gi|194098237|ref|YP_002001293.1| putative phage associated protein [Neisseria gonorrhoeae NCCP11945]
 gi|240125445|ref|ZP_04738331.1| putative phage associated protein [Neisseria gonorrhoeae SK-92-679]
 gi|268684040|ref|ZP_06150902.1| phage terminase [Neisseria gonorrhoeae SK-92-679]
 gi|193933527|gb|ACF29351.1| putative phage associated protein [Neisseria gonorrhoeae NCCP11945]
 gi|268624324|gb|EEZ56724.1| phage terminase [Neisseria gonorrhoeae SK-92-679]
          Length = 424

 Score = 91.4 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 111 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 168

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 169 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQ 228

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 229 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 286

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 287 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNATGIEEG 341

Query: 236 ISDMLDRM 243
           I       
Sbjct: 342 IRAARMLF 349


>gi|302541176|ref|ZP_07293518.1| prophage terminase large subunit [Streptomyces hygroscopicus ATCC
           53653]
 gi|302458794|gb|EFL21887.1| prophage terminase large subunit [Streptomyces himastatinicus ATCC
           53653]
          Length = 270

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 43/214 (20%), Positives = 78/214 (36%), Gaps = 18/214 (8%)

Query: 44  VTLTLTPLKGRSPIIEHYLSASSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR 102
           +  T  P   R  +   Y+  +   + +     +++ P  + +    +   Y    R   
Sbjct: 1   MYATTNPDSPRHWLKAGYIDRAHELNLRAWHFKLSDNPSLSPEYVADLAAEYVGLWRRRM 60

Query: 103 TKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIY 162
             G  ++  G I+ + +E   + + ++P+      G D+G  +PF+A  L    D D +Y
Sbjct: 61  IDGAWVVAEGAIYDMWDEGRHVVA-ELPDVRRYWLGCDYGTTNPFSAILLGEGVD-DRLY 118

Query: 163 VVKNYR------CREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGM 216
           V   +R       R  T   + AA+++W   L              S    S Q  + G 
Sbjct: 119 VAAEWRHDSRATHRSMTDAQYSAAVRAWLADLGIVPE---WTFIDPSAASFSTQMWQDGH 175

Query: 217 KMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
             L         SN V  GI  +   + +GR  V
Sbjct: 176 AGLAR------ASNDVADGIRSVSSLLAAGRLLV 203


>gi|220903993|ref|YP_002479305.1| hypothetical protein Ddes_0719 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868292|gb|ACL48627.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 461

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/279 (10%), Positives = 64/279 (22%), Gaps = 49/279 (17%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
                +   +  +  DE    P  V+ +     +   QG      TP    + + + +  
Sbjct: 108 NAQALRGLYLDDLVLDEPADMPRQVWTQIFRPMLADRQGRALFCGTPQGTDNLLYDAWEQ 167

Query: 64  ASSSD---RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIV-- 118
           A +         R   ++T +   QE      +    E     +          +     
Sbjct: 168 AGADSSGLWSRFRFPASQTGYLPAQELAAARRAMDEAEYLQEFECSFAAAVRGSYYAPLL 227

Query: 119 ---EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPI 175
              + +  I ++            D G     A               V  Y    +   
Sbjct: 228 DAADREGRIRTVPHAPELPVHTAWDLGMDDATAIWFFQVEPSGQ-WRFVDYYEASGEGLA 286

Query: 176 FHVAALKSWG--------KWLP-----------------------WAWPHDGLQHDKRSG 204
            +   L            + +P                          PHD    +  +G
Sbjct: 287 HYAHVLARKARPAGQQALEDIPAQQDGQNELMNRNFTGRGFSYGLHIAPHDIRVRELGTG 346

Query: 205 EQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
           +       + G++     A        +  GI  +   +
Sbjct: 347 QSRWESAAQLGIRFTLAPAL------SLADGIDAVRRHL 379


>gi|163851850|ref|YP_001639893.1| terminase large subunit [Methylobacterium extorquens PA1]
 gi|163663455|gb|ABY30822.1| terminase large subunit [Methylobacterium extorquens PA1]
          Length = 342

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/216 (10%), Positives = 59/216 (27%), Gaps = 12/216 (5%)

Query: 16  VHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +   W +E     +  +   +  I      + ++  P        + ++    +  +V++
Sbjct: 112 IDVCWVEEARTVSKSSWDVLIPTIRKEGSEIWISFNPELEEDETYKRFVKNPPTGAKVVK 171

Query: 74  MTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIV-------INS 126
           +   + P + +  ++  +D          T  +          I   +I+          
Sbjct: 172 IGWQDNPWFPDVLKQEALDLKARDPAAYLTVWDGHCKVVLDGAIYANEIMAATEANRFIR 231

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
           +            D G     A              ++  Y+ R      ++  L++   
Sbjct: 232 VPYDGTKPVHTFWDLGRADMTAIWFAQV--VGFEFRIIDYYQNRGHALGHYLKHLQARPY 289

Query: 187 WLPWAW-PHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
                W PHD       S   ++ Q    G  +   
Sbjct: 290 VYGDHWLPHDATNELLGSERTIAQQMESAGFTVSGA 325


>gi|116623201|ref|YP_825357.1| hypothetical protein Acid_4108 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226363|gb|ABJ85072.1| conserved hypothetical protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 436

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/250 (12%), Positives = 67/250 (26%), Gaps = 16/250 (6%)

Query: 9   DKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLT--PLKGRSPIIEHYLSA 64
           ++ +   + +   DE     ++ +     R+   +            KG   +   +++ 
Sbjct: 119 ERLRGTNLAWFGLDELTYTQQEAWLRLEGRLRDPKATQLCGFAVWTPKGFDWVYRKFITD 178

Query: 65  SSSDRQVIRMTINETPHYNE---QERKRIIDSYPLHEREARTKGEPILGSGR-IFPIVEE 120
                  I+    E  H          R+ DSY     +    G  +   G  ++   + 
Sbjct: 179 PVPGYGAIQARPFENRHLLAKVGDFYDRLKDSYDERFYQQEVLGNYLSMQGGRVYGAFDR 238

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
              I S+    +   +  +DF      +            + V+     R  T       
Sbjct: 239 TTHIQSVRPNPYLPLLWALDFNVDPMSSVI---VQVVKGEVRVLDEIVIRRATTGQACEE 295

Query: 181 LKSWGKWLP---WAWPHDGLQHDKRSGEQLSAQYRR--QGMKMLPECATFDDGSNGVEAG 235
                   P     +        + +G       R        +P        + GV   
Sbjct: 296 FLKRYPTHPKGVLIYGDASGSAQQTTGATDYQMVREYFAVNSNVPVQYKVPKSNPGVRDR 355

Query: 236 ISDMLDRMRS 245
           ++ M  ++RS
Sbjct: 356 VNLMNRQLRS 365


>gi|240112597|ref|ZP_04727087.1| putative phage associated protein [Neisseria gonorrhoeae MS11]
 gi|268598667|ref|ZP_06132834.1| phage terminase [Neisseria gonorrhoeae MS11]
 gi|268582798|gb|EEZ47474.1| phage terminase [Neisseria gonorrhoeae MS11]
          Length = 424

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 111 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 168

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 169 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMSKEDYGNIWEGRPRMVSEGAVYRHEIQ 228

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 229 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 286

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 287 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNAAGIEEG 341

Query: 236 ISDMLDRM 243
           I       
Sbjct: 342 IRAARMLF 349


>gi|293399332|ref|ZP_06643497.1| PBSX family phage terminase, large subunit [Neisseria gonorrhoeae
           F62]
 gi|291610746|gb|EFF39856.1| PBSX family phage terminase, large subunit [Neisseria gonorrhoeae
           F62]
          Length = 426

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 113 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 170

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 171 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQ 230

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 231 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 288

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 289 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNAAGIEEG 343

Query: 236 ISDMLDRM 243
           I       
Sbjct: 344 IRAARMLF 351


>gi|268594527|ref|ZP_06128694.1| phage terminase [Neisseria gonorrhoeae 35/02]
 gi|268547916|gb|EEZ43334.1| phage terminase [Neisseria gonorrhoeae 35/02]
          Length = 426

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 113 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 170

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 171 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQ 230

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 231 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLMSVRIIGYIEDTHRTLDW 288

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 289 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNATGIEEG 343

Query: 236 ISDMLDRM 243
           I       
Sbjct: 344 IRAARMLF 351


>gi|239998675|ref|ZP_04718599.1| putative phage associated protein [Neisseria gonorrhoeae 35/02]
 gi|317163958|gb|ADV07499.1| putative phage associated protein [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 424

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 111 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 168

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 169 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQ 228

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 229 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLMSVRIIGYIEDTHRTLDW 286

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 287 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNATGIEEG 341

Query: 236 ISDMLDRM 243
           I       
Sbjct: 342 IRAARMLF 349


>gi|240014419|ref|ZP_04721332.1| putative phage associated protein [Neisseria gonorrhoeae DGI18]
 gi|240016852|ref|ZP_04723392.1| putative phage associated protein [Neisseria gonorrhoeae FA6140]
 gi|240120865|ref|ZP_04733827.1| putative phage associated protein [Neisseria gonorrhoeae PID24-1]
 gi|254493400|ref|ZP_05106571.1| phage terminase [Neisseria gonorrhoeae 1291]
 gi|226512440|gb|EEH61785.1| phage terminase [Neisseria gonorrhoeae 1291]
          Length = 424

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 111 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 168

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 169 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQ 228

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 229 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 286

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 287 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNAAGIEEG 341

Query: 236 ISDMLDRM 243
           I       
Sbjct: 342 IRAARMLF 349


>gi|319899324|ref|YP_004159421.1| hypothetical protein BARCL_1179 [Bartonella clarridgeiae 73]
 gi|319403292|emb|CBI76851.1| phage-related protein [Bartonella clarridgeiae 73]
          Length = 442

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 68/242 (28%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  D  ++ L      +G      + +T  P +  + + + +      + + 
Sbjct: 125 LCWVDEAEPVTDAAWQILIPTLREEGKDWHSELWVTWNPCRENAAVEKRFRFTKDPNVKG 184

Query: 72  IRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +   + P +  +  +           + +   +GE +      +          E  I
Sbjct: 185 VEINWRDNPKFPAKLNRDRKADLEQRPEQYQYIWEGEYLQAMQGAYYQKLLLEAEQEGRI 244

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
                D          +        A    V       I V+  Y  + Q    H+  + 
Sbjct: 245 TKVPRDPLIQIKIFWDIGGTGAKADATALWVAQFVGREIRVLDYYEAQGQPLSEHIGWIC 304

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  ++ G +        + G   V+  I  +  
Sbjct: 305 QKGYEKALMVLPHDGATKDRVYNVSFESALQQAGFRTQ---IIPNQGIGAVKMRIEAVRR 361

Query: 242 RM 243
             
Sbjct: 362 LF 363


>gi|268686275|ref|ZP_06153137.1| phage terminase [Neisseria gonorrhoeae SK-93-1035]
 gi|268626559|gb|EEZ58959.1| phage terminase [Neisseria gonorrhoeae SK-93-1035]
          Length = 417

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 76/248 (30%), Gaps = 20/248 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   +  VW +E        +      I      + +TL P          +++ 
Sbjct: 104 SIKSFEG--IDIVWVEEGHGVSKKSWDVLTPTIRKEGSEIWITLNPDMETDETYRRFIAM 161

Query: 65  SSSDRQVIRMTINETPHYNEQERKRII---DSYPLHEREARTKGEPILGSGRIFPIVEED 121
            S D  +  +   + P + E   +  +    S    +     +G P + S       E  
Sbjct: 162 PSEDTWLCEINWRDNPWFPEALNRERLKAQRSMNKEDYGNIWEGRPRMVSEGAVYRHEIQ 221

Query: 122 IVINS-----LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              +S     +            D GW+   A    +  RD   + ++       +T  +
Sbjct: 222 DAFHSGRVTLVPYDSSLPVHTVWDLGWND--AMTIGLVQRDLTSVRIIGYIEDTHRTLDW 279

Query: 177 HVAALKSWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           +VA L+     W     PHDG   + ++G+         G       + F   + G+E G
Sbjct: 280 YVAELEKLPYRWGTDFLPHDGRTRNFQTGKSTMEILTGLG-----RKSVFVQNATGIEEG 334

Query: 236 ISDMLDRM 243
           I       
Sbjct: 335 IRAARMLF 342


>gi|208429857|ref|YP_002265410.1| large terminase [Clostridium phage 39-O]
 gi|190683340|gb|ACE81984.1| large terminase [Clostridium phage 39-O]
          Length = 425

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/226 (13%), Positives = 63/226 (27%), Gaps = 20/226 (8%)

Query: 16  VHYVWFDEEPPEDVYFEGLTRINA-----TQGLVTLTLTPLKGRSPIIEHYLSASSSDRQ 70
           +  VW++E    +   E  +   +         V  T  P K ++  +         DR 
Sbjct: 134 IGIVWYEELDQFNGMEEIRSMTQSFIRKNGDNWVFYTFNPPKSKNNWVNEEQLIDREDRL 193

Query: 71  VIRMTINETP--HYNEQERKRIIDSYP--LHEREARTKGEPILGSGRIFPIVEEDIVINS 126
           +   T    P     +Q                +    GE + G+G           I  
Sbjct: 194 IHHSTYLTVPSDWLGQQFIIEAEHLKNVKEEAYKHEYLGE-VTGTGGNVFDNVIIREITK 252

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
            +I        G+DFG+    A      +  ++ +Y++     +  +       +     
Sbjct: 253 EEINNMEEFEYGVDFGFSIDPA-TWCKIHYKNNKLYIIDEIYEQGLSNKKLTDKILEKEP 311

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
            +        +  D    + +S   R  G+ M         G +  
Sbjct: 312 NIY----KKPIVADSADPKSISE-MRGYGLNMQKA----KKGPDSR 348


>gi|319406198|emb|CBI79835.1| phage-related protein [Bartonella sp. AR 15-3]
          Length = 442

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 69/242 (28%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  D  ++ L      +G      + +T  P +  + + + +      + + 
Sbjct: 125 LCWVDEAEPVTDAAWQVLIPTLREEGKEWHSELWVTWNPCRENAAVEKRFRFTKDPNIKG 184

Query: 72  IRMTINETPHYNEQERKR--IIDSYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +   + P +  +  +           + +   +GE +L     +          E  I
Sbjct: 185 VEINWRDNPKFPAKLNRDRTADLEQRPEQYQHIWEGEYLLAMQGAYYQKLLLEAEQEGRI 244

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
                D          +        A    V       I V+  Y  + Q    H+  + 
Sbjct: 245 TTVPRDPLIQVKIFWDIGGTGAKADATALWVAQFVGREIRVLDYYEAQGQPLSEHIGWIC 304

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  ++ G +        + G   V+  I  +  
Sbjct: 305 HKGYEKALMVLPHDGATKDRVYNVSFESALQQAGFRTQ---IIPNQGVGAVKMRIEAVRR 361

Query: 242 RM 243
             
Sbjct: 362 LF 363


>gi|319404714|emb|CBI78316.1| phage-related protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 442

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 68/242 (28%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  D  ++ L      +G      + +T  P +  + + + +      + + 
Sbjct: 125 LCWVDEAEPVTDAAWQILIPTLREEGKEWHSELWVTWNPCRENAAVEKRFRFTKDPNIKG 184

Query: 72  IRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +   + P +  +  +           + +   +GE +      +          E  I
Sbjct: 185 VEINWRDNPKFPAKLNRDRQADLEQRPEQYQHIWEGEYLQAMQGAYYQKLLLEAEQEGRI 244

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
                D          +        A    V       I V+  Y  + Q    H+  + 
Sbjct: 245 TTVPRDPLIQVKIFWDIGGTGAKADATALWVAQFVGREIRVLDYYEAQGQPLSEHIGWVC 304

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  ++ G +        + G   V+  I  +  
Sbjct: 305 QKGYEKALMVLPHDGATKDRVYNVSFESALQQAGFRTQ---IIPNQGVGAVKMRIEAVRR 361

Query: 242 RM 243
             
Sbjct: 362 LF 363


>gi|99080642|ref|YP_612796.1| hypothetical protein TM1040_0801 [Ruegeria sp. TM1040]
 gi|99036922|gb|ABF63534.1| hypothetical protein TM1040_0801 [Ruegeria sp. TM1040]
          Length = 416

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/258 (12%), Positives = 75/258 (29%), Gaps = 23/258 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEP------PEDVYFEGL--TRINATQ--GLVTLTLTPLKGRSP 56
                    +     DE         +  + + +   R+        + +T TP  G   
Sbjct: 110 DPGGIVGFKIARALVDEIDILSKDKAQAAWRKIIARMRLVLPGVVNGIGVTTTPE-GFRF 168

Query: 57  IIEHYLSASSSDRQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKGEPI-LGSGRI 114
           + + +     S+  +++ +  E            +++ YP    +A   GE + L SG +
Sbjct: 169 VYDSFKREPKSNYSMVQASTYENEAFLPPDYISTLLEDYPEELIKAYLMGEFVNLTSGTV 228

Query: 115 FPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
           +   +     ++  I        G DF   +  +   +   +  +  + V   +  + TP
Sbjct: 229 YRSYDRLRHRSTQSIQPREPLHIGQDFNVGNMASVVFV---QRGEDWHAVDELQGLQDTP 285

Query: 175 IFHVAALKSWGKWLPWAWPHDGL--QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
                    +       +P      +    +        R+ G  +             V
Sbjct: 286 HLIEVLCDRYEGHHLTIYPDASGSSRKTVNASTSDIELLRKAGHAIRAPSTNP-----AV 340

Query: 233 EAGISDMLDRMRSGRWKV 250
           +  I  +     +GR  V
Sbjct: 341 KDRILAVNTAFENGRLFV 358


>gi|326693191|ref|ZP_08230196.1| phage terminase, large subunit, PBSX family [Leuconostoc argentinum
           KCTC 3773]
          Length = 430

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/236 (16%), Positives = 74/236 (31%), Gaps = 25/236 (10%)

Query: 20  WFDEE------PPEDVYFEGLTRINATQG--LVTLTLTPLKGRSPIIEHYLSAS--SSDR 69
           W++E              E +       G     +T  P   R  +   +       ++ 
Sbjct: 132 WWEEAYELKSDDSFQTVIESMRGELPIGGFYQHVITFNPWSDRHWLKREFFDVDTRRNNT 191

Query: 70  QVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVINSL 127
                T     H N+   + + +    +   A+    G+  +  G +F  + E    +  
Sbjct: 192 LAFTTTYKNNHHLNDDFIEAMKEMVVRNPNRAKVAVFGDWGISEGLVFDGLFEQRDFSME 251

Query: 128 DIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL-KSWG 185
           +I +   +  G+DFG+ H P A   +  ++ + V+YV   +  +         AL +   
Sbjct: 252 EIAK-LPKSIGLDFGFKHDPTAGEFMAIDQTNRVVYVYDEFYQQGMLTQMIAQALAQHKA 310

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             LP          D       +      G+   P   T   G + V  G+  M  
Sbjct: 311 YGLPI-------TADSAEQRLTTELASVYGV---PNLRTAGKGKDSVIQGVQYMQS 356


>gi|260683200|ref|YP_003214485.1| phage terminase large subunit [Clostridium difficile CD196]
 gi|260686796|ref|YP_003217929.1| phage terminase large subunit [Clostridium difficile R20291]
 gi|260209363|emb|CBA62799.1| phage terminase large subunit [Clostridium difficile CD196]
 gi|260212812|emb|CBE03985.1| phage terminase large subunit [Clostridium difficile R20291]
          Length = 417

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 59/237 (24%), Gaps = 22/237 (9%)

Query: 15  TVHYVWFDEEP-----PEDVYFEGLTRINATQGLVT---LTLTPLKGRSPIIEHYLSASS 66
            + +VW +E         D+  + L  I     L      T  P+     I   Y    +
Sbjct: 133 KLTWVWCEEATELMESDIDILDDRLRGILTNPNLYYQMTFTFNPVSATHWIKRKYFDYKN 192

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D      T  +    +E   +R+           +  G    G      +    I    
Sbjct: 193 DDIFTHHSTYLQNRFIDEAYYRRMQMRKEQDPEGYKVYGLGEWGETGGAILKNYVIHEFP 252

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG- 185
            +           DFG++H  A            +Y+       E      +    S G 
Sbjct: 253 TEFEYFDNMRLSQDFGFNHANAILR--IGFKDGELYICNEIYVHEMDTSEIIKIANSRGL 310

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
           +   + +                  ++  G K          G   V+A I  +   
Sbjct: 311 EKTLFMYCDSAE-------PDRIKMWKSAGYKA----KGVKKGPGSVKAQIDYLKQL 356


>gi|291335343|gb|ADD94958.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C148]
          Length = 234

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/192 (12%), Positives = 50/192 (26%), Gaps = 10/192 (5%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
                +  ++  V  DE      +V+FE +   +   QG      TP    S   + +  
Sbjct: 44  NAMALRGRSLSGVVLDEAAFMDAEVWFEVIRPALADKQGWALFISTPDGTASWFYDLWCY 103

Query: 64  ASSS---DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
                  + +    T  E  +  ++E +               +      +G +     +
Sbjct: 104 CEDDPTNEWKRWCYTTIEGGNVPQEEVEAARAQLDPRTFRQEFEASFENLTGLVAISFSD 163

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR-EQTPIFHVA 179
           D +            + G+DF          +   +D D +YV          T      
Sbjct: 164 DNISTDAKDISIQPLLLGVDFNVDPMSGICAV---KDKDTLYVFDEIMLTGGATTWDFAE 220

Query: 180 ALKSWGKWLPWA 191
            +          
Sbjct: 221 EVTHRYGVDRRV 232


>gi|254975152|ref|ZP_05271624.1| putative phage terminase, large subunit [Clostridium difficile
           QCD-66c26]
 gi|255516959|ref|ZP_05384635.1| putative phage terminase, large subunit [Clostridium difficile
           QCD-97b34]
 gi|255650061|ref|ZP_05396963.1| putative phage terminase, large subunit [Clostridium difficile
           QCD-37x79]
 gi|306519596|ref|ZP_07405943.1| phage terminase large subunit [Clostridium difficile QCD-32g58]
          Length = 413

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 59/237 (24%), Gaps = 22/237 (9%)

Query: 15  TVHYVWFDEEP-----PEDVYFEGLTRINATQGLVT---LTLTPLKGRSPIIEHYLSASS 66
            + +VW +E         D+  + L  I     L      T  P+     I   Y    +
Sbjct: 129 KLTWVWCEEATELMESDIDILDDRLRGILTNPNLYYQMTFTFNPVSATHWIKRKYFDYKN 188

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D      T  +    +E   +R+           +  G    G      +    I    
Sbjct: 189 DDIFTHHSTYLQNRFIDEAYYRRMQMRKEQDPEGYKVYGLGEWGETGGAILKNYVIHEFP 248

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG- 185
            +           DFG++H  A            +Y+       E      +    S G 
Sbjct: 249 TEFEYFDNMRLSQDFGFNHANAILR--IGFKDGELYICNEIYVHEMDTSEIIKIANSRGL 306

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
           +   + +                  ++  G K          G   V+A I  +   
Sbjct: 307 EKTLFMYCDSAE-------PDRIKMWKSAGYKA----KGVKKGPGSVKAQIDYLKQL 352


>gi|255092542|ref|ZP_05322020.1| phage terminase large subunit [Clostridium difficile CIP 107932]
 gi|255314279|ref|ZP_05355862.1| phage terminase large subunit [Clostridium difficile QCD-76w55]
          Length = 416

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 59/237 (24%), Gaps = 22/237 (9%)

Query: 15  TVHYVWFDEEP-----PEDVYFEGLTRINATQGLVT---LTLTPLKGRSPIIEHYLSASS 66
            + +VW +E         D+  + L  I     L      T  P+     I   Y    +
Sbjct: 132 KLTWVWCEEATELMESDIDILDDRLRGILTNPNLYYQMTFTFNPVSATHWIKRKYFDYKN 191

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D      T  +    +E   +R+           +  G    G      +    I    
Sbjct: 192 DDIFTHHSTYLQNRFIDEAYYRRMQMRKEQDPEGYKVYGLGEWGETGGAILKNYVIHEFP 251

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG- 185
            +           DFG++H  A            +Y+       E      +    S G 
Sbjct: 252 TEFEYFDNMRLSQDFGFNHANAILR--IGFKDGELYICNEIYVHEMDTSEIIKIANSRGL 309

Query: 186 KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
           +   + +                  ++  G K          G   V+A I  +   
Sbjct: 310 EKTLFMYCDSAE-------PDRIKMWKSAGYKA----KGVKKGPGSVKAQIDYLKQL 355


>gi|196047612|ref|ZP_03114820.1| phage terminase large subunit [Bacillus cereus 03BB108]
 gi|196021583|gb|EDX60282.1| phage terminase large subunit [Bacillus cereus 03BB108]
          Length = 285

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/222 (14%), Positives = 67/222 (30%), Gaps = 9/222 (4%)

Query: 28  DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQV-IRMTINETPHYNEQE 86
               +   R +     V     P          +L  +     + IR T+++    +E+ 
Sbjct: 4   SFVNQATGRCSVEGSKVWFNCNPGGPYHWFKTEWLDKAKEKNLLHIRFTMDDNLSLSEKV 63

Query: 87  RKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHP 146
           ++R    Y     +    G     SG IF + +ED         E+       D+G  + 
Sbjct: 64  KQRYYKMYSGVFFKRYILGLWAAASGLIFDMFDEDKHKVPTIEREYVEYFVSCDYGTQNA 123

Query: 147 FAAGHLV--WNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSG 204
              G       +  +V Y VK YR   +         + +  +  +    D         
Sbjct: 124 MVYGLWGKCIEKGEEVWYKVKEYRYSGRETEKQKTDQEYYEDFEKFV--GDLPIRGTVVD 181

Query: 205 EQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSG 246
              ++        ++          N V+ GI ++   + +G
Sbjct: 182 PSAASFIAL----LVRNKRKVYKARNNVKEGIGNVGVALNTG 219


>gi|229037838|ref|ZP_04189636.1| Phage terminase large subunit [Bacillus cereus AH1271]
 gi|228727460|gb|EEL78638.1| Phage terminase large subunit [Bacillus cereus AH1271]
          Length = 416

 Score = 89.8 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 37/236 (15%), Positives = 65/236 (27%), Gaps = 20/236 (8%)

Query: 15  TVHYVWFDE-----EPPEDVYFEGLTRINATQG---LVTLTLTPLKGRSPIIEHYLSASS 66
            + ++W +E     E   D+  + L  I         +T T  P+     I + Y     
Sbjct: 125 KLTWIWIEESTELKENDIDILDDRLRGILPNPNLYYQITFTFNPVSSTHWIKKKYFDIEH 184

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D      T       +E   +R++          +  G    G      +    I    
Sbjct: 185 PDIFTHHSTYLTNRFIDEAYHRRMMLRKAQDPEGYQIYGLGEWGEIGGLILKNYRIHDFD 244

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
                        DFG++H  A     W +D ++    + Y   + T      A K    
Sbjct: 245 TSFERFDSMNHAQDFGFNHANAILTGGW-KDGELYICNEIYVHEKDTGEIIEIADKQGIN 303

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                +                  +R+ G K +P         N V+A I  +   
Sbjct: 304 KRLMMYCDSAE-------PDRIKTWRKAGYKAVP----VVKNPNSVKAQIDYLKTL 348


>gi|160897385|ref|YP_001562967.1| PBSX family phage terminase large subunit [Delftia acidovorans
           SPH-1]
 gi|160362969|gb|ABX34582.1| phage terminase, large subunit, PBSX family [Delftia acidovorans
           SPH-1]
          Length = 433

 Score = 89.8 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/244 (13%), Positives = 68/244 (27%), Gaps = 19/244 (7%)

Query: 18  YVWFDEEPPE--DVYFEGLTRINATQ----GLVTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P   + +   +  +          + +T  P +  +P+ + +  +S    + 
Sbjct: 125 LCWVDEAEPVTDEAWTTLIPTLREEGTDWNAELWVTWNPKRKSAPVEKRFKGSSDPRMKY 184

Query: 72  IRMTINETPHYNE--QERKRIIDSYPLHEREARTKGEPILGSGRIFPIV-------EEDI 122
           +R    + P +    +  +    +    +     +G+        +          +  I
Sbjct: 185 VRCNWKDNPKFPALLERVRLRDLAERPEQYAHIWEGDYATVIEGAYFASHIVKARQDNRI 244

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
                D          +        A    +       I V+  Y    Q    H+  ++
Sbjct: 245 GRVPADPLMTLRAFVDIGGTGARADAFAMWIAQFVGKEIRVLDYYEQVGQPLSSHLNWMR 304

Query: 183 SWGKWLPWAW-PHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G      W PHDG   DK       +  R+ G  +       + G    +A I     
Sbjct: 305 EKGYDKAQIWLPHDGATQDKVHDVSYESALRQAGYTVT---VVPNQGKGAAKARIEAGRR 361

Query: 242 RMRS 245
              S
Sbjct: 362 LFGS 365


>gi|167462274|ref|ZP_02327363.1| hypothetical protein Plarl_06915 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382817|ref|ZP_08056660.1| phage-related terminase-like protein large subunit [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321153200|gb|EFX45647.1| phage-related terminase-like protein large subunit [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 423

 Score = 89.5 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 35/237 (14%), Positives = 75/237 (31%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINAT--QGLVTLTLTPLKGRSPIIEHYLSASSS---- 67
           V  VW +E  E   + + E L R+        + L+  P+   +   +H+          
Sbjct: 116 VSIVWIEECSEVKYEGFKELLGRLRHPALDLHMLLSTNPVGEDNWTFKHFFKDELKNHIV 175

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          D      T  +     +    ++  + +Y         +G   + 
Sbjct: 176 LEDTDLYEKRTIVKNDTFYHHSTAEDNLFLPKSYVAQLDELKAYDPDLYRIAREGRFGVN 235

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIG---GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  E       ++      +     GMDFG+     A   L  + +  ++Y+   
Sbjct: 236 GVRVLPQFEVASHEEVIEAISRIRKPIERTGMDFGFEDSYNAVVRLAVDHEQKILYIYWE 295

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T      AL+ + +        + ++ D    + +   +R++G  M P   
Sbjct: 296 YYKNQMTDDRTAEALQEFAR------TKELIKADSAEPKTIR-YFRQKGFNMRPAKK 345


>gi|257891069|ref|ZP_05670722.1| terminase large subunit [Enterococcus faecium 1,231,410]
 gi|257893878|ref|ZP_05673531.1| terminase large subunit [Enterococcus faecium 1,231,408]
 gi|260558861|ref|ZP_05831050.1| terminase large subunit [Enterococcus faecium C68]
 gi|257827429|gb|EEV54055.1| terminase large subunit [Enterococcus faecium 1,231,410]
 gi|257830257|gb|EEV56864.1| terminase large subunit [Enterococcus faecium 1,231,408]
 gi|260075320|gb|EEW63633.1| terminase large subunit [Enterococcus faecium C68]
          Length = 432

 Score = 89.5 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 29/258 (11%), Positives = 71/258 (27%), Gaps = 30/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L              +  P
Sbjct: 111 AQNPERIKSLKDSKFPFAIGWIEELAEFKTEDEVTTITNSLLRGELDDGLFYKFFYSYNP 170

Query: 51  L-KGRSPIIEHYLSASSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y ++    +  +   T  + P  +++    +  +   + R A  + +  
Sbjct: 171 PKRKQSWVNKKYETSFQPKNTFIHHSTYKDNPFISKEFLSEVEAARARNPRRAEWEYDGK 230

Query: 109 LGSGRIFPIVEEDIV---INSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                + P     I    I    +        G+D+G+   P A     +++  + IY +
Sbjct: 231 AIGSGVVPFDNLRIEAGSITDEMVANFDNIRQGLDYGYATDPLAFVRWHYDKKRNCIYAI 290

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +       +KS                     +  +       +    +   
Sbjct: 291 DELYEVKCSNRRAAQWIKSNKYHYQDIIAE-------VEPKSNAEMRNEHDIS---KIRQ 340

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 341 VTKGPDSVEYGEKWLDDL 358


>gi|319407675|emb|CBI81323.1| phage-related protein [Bartonella sp. 1-1C]
          Length = 442

 Score = 89.5 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 69/242 (28%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  D  ++ L      +G      + +T  P +  + + + +      + + 
Sbjct: 125 LCWVDEAEPVTDAAWQILIPTLREEGKEWHSELWVTWNPCRENAAVEKRFRFTEDPNIKG 184

Query: 72  IRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +   + P +  +  +           + +   +GE +      +          E  I
Sbjct: 185 VEINWRDNPKFPAKLNRDRKADLEQRPEQYQHIWEGEYLQAMQGAYYQKLLLEAEQEGRI 244

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
            I   D          +        A    V       I V+  Y  + Q    H+  + 
Sbjct: 245 TIVPRDPLIQVKIFWDIGGTGAKADATALWVAQFVGREIRVLDYYEAQGQPLSEHIGWVC 304

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  ++ G +        + G   V+  I  +  
Sbjct: 305 QKGYEKALMVLPHDGATKDRVYNVSFESALQQAGFRTQ---VIPNQGVGAVKMRIEAVRR 361

Query: 242 RM 243
             
Sbjct: 362 LF 363


>gi|318064394|gb|ADV36428.1| phage terminase large subunit [Edwardsiella phage eiAU]
          Length = 460

 Score = 89.5 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/259 (13%), Positives = 79/259 (30%), Gaps = 23/259 (8%)

Query: 10  KWQSNTVHYVWFDEEPPE------DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           +       +   DE          + Y + L R+        + ++  +G   + + ++S
Sbjct: 146 RLIGVNAAWCVCDEFDTTKPDIAMEAYRKLLGRLRTGNVRQMVIVSTPEGFRAMYQIFIS 205

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI-LGSGRIFPIVEEDI 122
            +   +++I+    +  +  +     +   YP    EA   GE + L  G ++      +
Sbjct: 206 EADDQKRLIKARTTDNHYLPQDYIDTLRAQYPPELIEAYLNGEFVNLTGGAVYRNFSRTL 265

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDS-DVIYVVKNYRCREQTPIFHVAAL 181
                   +    + GMDF       A ++    D  + +++V  +     T     A  
Sbjct: 266 NNCDTVAEDDDTLMIGMDFNVGQMAGAVYVQRIADGVEEMHLVDEFCGLLDTDAMIDAIK 325

Query: 182 KSWGKW-----LPWAWPHDGLQHDKR-SGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           + +        +       G       +     A     G  +             V   
Sbjct: 326 ERYPDHHARGLIEIFPDSSGKNRKTTNANTSDIAMLEDAGFTVSYNSVNP-----AVRDR 380

Query: 236 ISDMLDRMRSG----RWKV 250
           ++D+   + +G    R KV
Sbjct: 381 VNDVNGMILNGKGQRRLKV 399


>gi|126700540|ref|YP_001089437.1| phage terminase large subunit [Clostridium difficile 630]
          Length = 417

 Score = 89.5 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 60/236 (25%), Gaps = 20/236 (8%)

Query: 15  TVHYVWFDEEP-----PEDVYFEGLTRINATQGLVT---LTLTPLKGRSPIIEHYLSASS 66
            + +VW +E         D+  + L  I     L      T  P+     I   Y    +
Sbjct: 133 KLTWVWCEEATELMESDIDILDDRLRGILTNPNLYYQMTFTFNPVSATHWIKRKYFDYKN 192

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D      T  +    +E   +R+           +  G    G      +    I    
Sbjct: 193 DDIFTHHSTYLQNRFIDEAYYRRMQMRKEQDPEGYKVYGLGEWGETGGAILKNYVIHEFP 252

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
            +           DFG++H               +Y+       E      +    S G 
Sbjct: 253 TEFEYFDNMRLSQDFGFNHANVVLR--IGFKDGELYICNEIYVHEMDTSEIIKIANSRGL 310

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                     +  D    +++   ++  G K          G   V+A I  +   
Sbjct: 311 EKTLF-----MYCDSAEPDRIK-MWKSAGYKA----KGVKKGPGSVKAQIDYLKQL 356


>gi|126698524|ref|YP_001087421.1| putative phage terminase, large subunit [Clostridium difficile 630]
 gi|115249961|emb|CAJ67781.1| putative phage terminase, large subunit [Clostridium difficile]
 gi|328887758|emb|CAJ69813.2| putative phage terminase large subunit [Clostridium difficile]
          Length = 413

 Score = 89.5 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 60/236 (25%), Gaps = 20/236 (8%)

Query: 15  TVHYVWFDEEP-----PEDVYFEGLTRINATQGLVT---LTLTPLKGRSPIIEHYLSASS 66
            + +VW +E         D+  + L  I     L      T  P+     I   Y    +
Sbjct: 129 KLTWVWCEEATELMESDIDILDDRLRGILTNPNLYYQMTFTFNPVSATHWIKRKYFDYKN 188

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D      T  +    +E   +R+           +  G    G      +    I    
Sbjct: 189 DDIFTHHSTYLQNRFIDEAYYRRMQMRKEQDPEGYKVYGLGEWGETGGAILKNYVIHEFP 248

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
            +           DFG++H               +Y+       E      +    S G 
Sbjct: 249 TEFEYFDNMRLSQDFGFNHANVVLR--IGFKDGELYICNEIYVHEMDTSEIIKIANSRGL 306

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                     +  D    +++   ++  G K          G   V+A I  +   
Sbjct: 307 EKTLF-----MYCDSAEPDRIK-MWKSAGYKA----KGVKKGPGSVKAQIDYLKQL 352


>gi|192291432|ref|YP_001992037.1| phage terminase, large subunit, PBSX family [Rhodopseudomonas
           palustris TIE-1]
 gi|192285181|gb|ACF01562.1| phage terminase, large subunit, PBSX family [Rhodopseudomonas
           palustris TIE-1]
          Length = 421

 Score = 89.5 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 35/218 (16%), Positives = 69/218 (31%), Gaps = 12/218 (5%)

Query: 14  NTVHYVWFDEEPPE--DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             +  +W DE  P   + +   +  +      + LT  P +  S   + +     +  ++
Sbjct: 101 ARIRLLWVDEAEPVSDEAWNITIPTVREEGSEIWLTWNPDRKASATNKRFRENPPAGAKI 160

Query: 72  IRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +   + P++ E   +  +D  +    +     +GE        +          +  I
Sbjct: 161 VELNWRDNPYFPEILNRTRLDDKANRPDQYGWVWEGEYRSVVAGAYYAKALTQAKEQGRI 220

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
               LD          +        AA   +       I V+  Y  + Q    HVA ++
Sbjct: 221 TFVPLDPLMQVRAYLDIGGAGAKADAAAIWIVQFVGQRINVLDYYEAQGQPLATHVAWMR 280

Query: 183 SWG-KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKML 219
             G        PHDG Q DK       +  R  G  ++
Sbjct: 281 ERGWGKALVVLPHDGAQTDKVHATSYESALREAGFDVI 318


>gi|237745263|ref|ZP_04575744.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|229432492|gb|EEO42704.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
          Length = 425

 Score = 89.1 bits (219), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 35/238 (14%), Positives = 73/238 (30%), Gaps = 28/238 (11%)

Query: 20  WFDEEPPE------DVYFEGLTRINATQG---LVTLTLTPLKGRSPIIEH---YLSASSS 67
           WF+E          ++  + + R             +  P K +   +     Y      
Sbjct: 139 WFEELAEFKNEDEVEMVLDSIYRGKLKDNLRYKGFFSYNPPKMKHNWVNKKYEYTFKEDD 198

Query: 68  DRQVIRMTINETPHYNEQERKRII--DSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
           +  V   T  + P  ++   KR          + +    GEP +G+G +     E   I+
Sbjct: 199 EIFVHHSTYLDNPFISDDFVKRAEAVKLNNPMKYKHTYLGEP-IGNGIVPFDNLEIRTIS 257

Query: 126 SLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
           + +I        G+D+G+   P A     +++   +IY +  +             + S 
Sbjct: 258 NEEIKGLDRFRNGVDWGYGVDPMAFVRWGYDKKKRIIYAIDEFFGVGIKNRELATFIISK 317

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                     + +  D    + +    R   +      +    G+  VE G   + D 
Sbjct: 318 NY-------DELVMCDSAEPKSIDE-LREYDI----SASGAKKGAGSVEYGEKWLADL 363


>gi|318064508|gb|ADV36483.1| phage terminase large subunit [Edwardsiella phage eiDWF]
 gi|318064606|gb|ADV36532.1| phage terminase large subunit [Edwardsiella phage eiMSLS]
          Length = 460

 Score = 88.7 bits (218), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 34/259 (13%), Positives = 79/259 (30%), Gaps = 23/259 (8%)

Query: 10  KWQSNTVHYVWFDEEPPE------DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           +       +   DE          + Y + L R+        + ++  +G   + + ++S
Sbjct: 146 RLIGVNAAWCVCDEFDTTKPDIAMEAYRKLLGRLRTGNVRQMVIVSTPEGFRAMYQIFIS 205

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI-LGSGRIFPIVEEDI 122
            +   +++I+    +  +  +     +   YP    EA   GE + L  G ++      +
Sbjct: 206 EADDQKRLIKARTTDNHYLPQDYIDTLRAQYPPELIEAYLNGEFVNLTGGAVYRNFSRTL 265

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDS-DVIYVVKNYRCREQTPIFHVAAL 181
                   +    + GMDF       A ++    D  + +++V  +     T     A  
Sbjct: 266 NNCDTVAEDDDTLMIGMDFNVGQMAGAVYVQRIADGVEEMHLVDEFCGLLDTDAMIDAIK 325

Query: 182 KSWGKW-----LPWAWPHDGLQHDKR-SGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           + +        +       G       +     A     G  +             V   
Sbjct: 326 ERYPDHHARGLIEIFPDSSGKNRKTTNANTSDIAMLEDAGFTVSYNSVNP-----AVRDR 380

Query: 236 ISDMLDRMRSG----RWKV 250
           ++D+   + +G    R KV
Sbjct: 381 VNDVNGMILNGKGQRRLKV 399


>gi|241895598|ref|ZP_04782894.1| large subunit terminase [Weissella paramesenteroides ATCC 33313]
 gi|241871176|gb|EER74927.1| large subunit terminase [Weissella paramesenteroides ATCC 33313]
          Length = 429

 Score = 88.3 bits (217), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 35/235 (14%), Positives = 74/235 (31%), Gaps = 23/235 (9%)

Query: 20  WFDEEP---PEDVYFEGL--TRINATQGLVT---LTLTPLKGRSPIIEHYLSASSSDRQV 71
           W++E      ++ +   +   R     G      +T  P   R  +   +  A +    V
Sbjct: 131 WWEEAYELKSDESFQTVIESMRGELPAGGFYQHVITFNPWSDRHWLKREFFDADTRRNHV 190

Query: 72  --IRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVINSL 127
                T     H N+     + +    +   A+    G+  +  G +F  + E    +  
Sbjct: 191 LSFTTTYKNNHHLNQDFIDSMEEMVIRNPNRAKVAVYGDWGISEGLVFDGLFEQRDFSME 250

Query: 128 DIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
           +I +   +  G+DFG+ H P A   +  ++ + ++YV   +  +         +L     
Sbjct: 251 EIAK-LPKSVGLDFGFKHDPTAGEFMAIDQRNRIVYVYDEFYQQGMLTQAIAQSLAKHKA 309

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
           +          Q                 +  +P   T   G + V  G+  M  
Sbjct: 310 YGLPITADSAEQRLTTELAS---------VYNVPNLRTAGKGKDSVIQGVQYMQS 355


>gi|134287337|ref|YP_001110720.1| putative terminase large subunit [Clostridium phage phiC2]
 gi|93117175|gb|ABE99465.1| putative terminase large subunit [Clostridium phage phiC2]
          Length = 417

 Score = 88.3 bits (217), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 60/236 (25%), Gaps = 20/236 (8%)

Query: 15  TVHYVWFDEEP-----PEDVYFEGLTRINATQGLVT---LTLTPLKGRSPIIEHYLSASS 66
            + +VW +E         D+  + L  I     L      T  P+     I   Y    +
Sbjct: 133 KLTWVWCEEATELMESDIDILDDRLRGILTNPNLYYQMTFTFNPVSATHWIKRKYFDYKN 192

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D      T  +    +E   +R+           +  G    G      +    I    
Sbjct: 193 DDIFTHHSTYLQNRFIDEAYYRRMQMRKEQDPEGYKVYGLGEWGETGGAILKNYVIHEFP 252

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
            +           DFG++H               +Y+       E      +    S G 
Sbjct: 253 TESEYFDNMRLSQDFGFNHANVVLR--IGFKDGELYICNEIYAHEMDTSEIIKIANSIGL 310

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                     +  D    +++   ++  G K          G   V+A I  +   
Sbjct: 311 EKTLF-----MYCDSAEPDRIK-MWKSAGYKA----KGVKKGPGSVKAQIDYLKQL 356


>gi|49476071|ref|YP_034112.1| phage related protein [Bartonella henselae str. Houston-1]
 gi|49238879|emb|CAF28172.1| phage related protein [Bartonella henselae str. Houston-1]
          Length = 402

 Score = 88.3 bits (217), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 36/242 (14%), Positives = 70/242 (28%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQG-----LVTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  P +  +P+ + + + ++   + 
Sbjct: 86  LCWVDEAEPVTETAWQTLIPTLREEGNDWNAELWVTWNPCRENAPVEKRFRNVNNPHIKG 145

Query: 72  IRMTINETPHYNEQERKRIID--SYPLHEREARTKGEP-ILGSGRIFPI------VEEDI 122
             +T  + P + E+  +                 +GE      G  +         E  I
Sbjct: 146 AEITWRDNPQFPEKLNRDRKADLEQRPEHYNHIWEGEYLQTVEGAYYQKALLEASREGRI 205

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
                D          +        A    V       I V+  Y  + Q    HV  + 
Sbjct: 206 TTVPRDPLMQIRIFWDIGGTGAKADATALWVAQFVGREIRVLDYYEAQGQPLSEHVGWVF 265

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  ++ G +        + G   V+  I  +  
Sbjct: 266 QRGYDKALMVLPHDGATKDRVYNVSFESALQQAGFQTK---VIPNQGVGAVKMRIEAVRR 322

Query: 242 RM 243
             
Sbjct: 323 LF 324


>gi|62362371|ref|YP_224236.1| putative terminase large subunit [Listonella phage phiHSIC]
 gi|58219993|gb|AAW67505.1| putative terminase large subunit [Listonella phage phiHSIC]
          Length = 408

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 68/235 (28%), Gaps = 20/235 (8%)

Query: 14  NTVHYVWFDEE--PPEDVYFEGLTRI-NATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQ 70
             +     +E    PE+ + E L  I    +    +   P K  SP+ + +      D  
Sbjct: 119 AQIDLTIVEEAEDVPENAWVELLPTIFRTDKAECWVIWNPRKKGSPVDKRFRQFKPDDAV 178

Query: 71  VIRMTINETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSL 127
           V+ M   + P +    E  R+   D+ P         G     +        +      +
Sbjct: 179 VVEMNYYDNPFFPKGLEDLRRHDEDTMPPELYAHVWLGAYYEHTEAQVFKNWKV---EQV 235

Query: 128 DIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
           +         G+DFG+   P A        + + +Y+ K               L     
Sbjct: 236 NTNGWEGPYYGLDFGFSQDPTAGVKCWL--NGNDVYIEKEAGKVGLEIDHTADYLIKRID 293

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
            +        +  D    E +S   +R G+   P           VE G+  +  
Sbjct: 294 GI----DDAKVYADSARPESIS-LLKRTGI---PRIEGVPKWKGSVEDGVEWLRS 340


>gi|303251622|ref|ZP_07337796.1| hypothetical protein APP6_0825 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302649620|gb|EFL79802.1| hypothetical protein APP6_0825 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 409

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 63/239 (26%), Gaps = 20/239 (8%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W +E        + +    +      + +T  P K  S     +      + ++I M 
Sbjct: 127 LAWVEEAETVSEVAWQKLEPTVREHNSEIWVTWNPEKRGSATDLRFRRHVPENAKIIEMN 186

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    EQ R                +G           I  +       +    
Sbjct: 187 YSDNPWFPKELEQTRLADKARLDDATYRWIWEGAY--LEQSEAQIFRDKYQELEFEPNPD 244

Query: 133 WV-QIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
           +     G+DFG+ +   A    W  D D +Y+               + +          
Sbjct: 245 FDGPYYGLDFGFANDPTAAIKCWVFDGD-LYIEYEAGQVRLELDETASFISERIPEFEKY 303

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
                   D    E +S   +R G    P           VE GI  +      G+  +
Sbjct: 304 ISRA----DSARPESIS-YLKRHGF---PRIEGVKKWQGSVEDGIEHIKSY---GKVYI 351


>gi|300856304|ref|YP_003781288.1| putative phage terminaselarge subunit [Clostridium ljungdahlii DSM
           13528]
 gi|300436419|gb|ADK16186.1| putative phage terminase, large subunit [Clostridium ljungdahlii
           DSM 13528]
          Length = 410

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/237 (14%), Positives = 74/237 (31%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQG--LVTLTLTPLKGRSPIIEHYLSASSS---- 67
           V  VW +E  E     + E L R+        + L+  P+   +   +H+          
Sbjct: 81  VSIVWIEECSEVKYAGFKELLGRLRHPSLSLHMILSTNPVSKDNWTYKHFFRNDKKKIFI 140

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          +      T ++     E   +++  + +Y         KG   + 
Sbjct: 141 LDDEELYKKGIVIRNNTYYHHSTADDNLFLPESYTEQLDELKTYDPDLYRIARKGRFGIN 200

Query: 111 SGRIFPIVEEDIVI---NSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  E         S+   ++ ++  GMDFG+     A   +  + D+ ++Y+   
Sbjct: 201 GRRVLPQFEVAPHYAVLQSIGNIKNPIKRVGMDFGFETSYNAIVRMCIDDDNKILYIYWE 260

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y     T       +  + +     +       D    + +   Y++QG  M     
Sbjct: 261 YYKNHMTDDRTAIEIAEFKRTQEIIYS------DCAEPKTIK-YYKQQGFNMRGAKK 310


>gi|262380955|ref|ZP_06074093.1| PBSX family phage terminase, large subunit [Bacteroides sp.
           2_1_33B]
 gi|262296132|gb|EEY84062.1| PBSX family phage terminase, large subunit [Bacteroides sp.
           2_1_33B]
          Length = 392

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/242 (11%), Positives = 57/242 (23%), Gaps = 27/242 (11%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKG-RSPI 57
             + +    K +      ++ +E  E     + + + R         +   P       I
Sbjct: 104 FFSTD-DEQKIRGRKRDILYCNEGNEISYLEWQQLVMRTT---LFSVIDYNPSFSDEHWI 159

Query: 58  IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPI 117
            +     +         T  + P   +     I      ++      G            
Sbjct: 160 CDL---NNDPRTYHFISTYKDNPFLEQTIIDEIESLKNKNKVLWAVYGLGQRAMAEGLVF 216

Query: 118 VEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFH 177
            + +IV       +H        + +  P A          D +Y+ +            
Sbjct: 217 PDFEIVDEFPSYAKHVALGLDFGYSY-DPTAIVRCGL--VDDRLYLDEKCYLTHMLTKEI 273

Query: 178 VAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
           +  LK  G      +             +L  +    G+ + P           V  GI 
Sbjct: 274 IKVLKDLG---LVVYADSA-------DPRLIQEISNAGIIIYPADKY----KGSVMGGII 319

Query: 238 DM 239
            M
Sbjct: 320 KM 321


>gi|307252059|ref|ZP_07533958.1| Phage terminase, large subunit, PBSX family [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306860359|gb|EFM92373.1| Phage terminase, large subunit, PBSX family [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 407

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 63/239 (26%), Gaps = 20/239 (8%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W +E        + +    +      + +T  P K  S     +      + ++I M 
Sbjct: 125 LAWVEEAETVSEVAWQKLEPTVREHNSEIWVTWNPEKRGSATDLRFRRHVPENAKIIEMN 184

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    EQ R                +G           I  +       +    
Sbjct: 185 YSDNPWFPKELEQTRLADKARLDDATYRWIWEGAY--LEQSEAQIFRDKYQELEFEPNPD 242

Query: 133 WV-QIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
           +     G+DFG+ +   A    W  D D +Y+               + +          
Sbjct: 243 FDGPYYGLDFGFANDPTAAIKCWVFDGD-LYIEYEAGQVRLELDETASFISERIPEFEKY 301

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
                   D    E +S   +R G    P           VE GI  +      G+  +
Sbjct: 302 ISRA----DSARPESIS-YLKRHGF---PRIEGVKKWQGSVEDGIEHIKSY---GKVYI 349


>gi|322513476|ref|ZP_08066587.1| phage terminase [Actinobacillus ureae ATCC 25976]
 gi|322120735|gb|EFX92618.1| phage terminase [Actinobacillus ureae ATCC 25976]
          Length = 406

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 61/230 (26%), Gaps = 17/230 (7%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
           + W DE        + + +  +      + LT  P K  S   + +      +  ++ M 
Sbjct: 124 FAWVDEAESVSEMAWSKLIPTVREHNSEIWLTWNPEKRDSATDKRFRQFPPDNSVIVEMN 183

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
               P +    EQER                +G           I  +       +    
Sbjct: 184 YTYNPWFPDVLEQERLNDKKRLDDATYRWIWEGAY--LEQSEAQIFRDKYQELEFEPNPD 241

Query: 133 WV-QIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
           +     G+DFG+ +   A    W  D D +Y+    R            +          
Sbjct: 242 FDGSYHGLDFGFANDPTAAIKCWVFDGD-LYIEYEARQVRLELDETAGFISGCIPEFEKY 300

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
                   D    E +S   +R G    P           VE GI  +  
Sbjct: 301 ISRA----DSARPESIS-YLKRHGF---PRIEGVKKWQGSVEDGIEHIKS 342


>gi|49474625|ref|YP_032667.1| phage related protein [Bartonella quintana str. Toulouse]
 gi|49240129|emb|CAF26575.1| phage related protein [Bartonella quintana str. Toulouse]
          Length = 402

 Score = 87.5 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 70/242 (28%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  P +  +P+ + + +  + + + 
Sbjct: 86  LCWVDEAEPVTETAWQTLIPTLREEGKDWNAELWVTWNPCRENAPVEKRFRNVENPNIKG 145

Query: 72  IRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
             +   + P + ++  +                 +GE +      +         +E  I
Sbjct: 146 AEINWRDNPLFPQKLNRDRKADLQQRPENYNHIWEGEYLQSVQGAYYQKALLEAELEGRI 205

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
                D          +        A    V       I V+  Y  + Q    HV  + 
Sbjct: 206 TNVPRDPLMQIKIFWDIGGTGAKADATALWVAQFIGREIRVLDYYEAQGQPLAEHVGWVF 265

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  ++ G +        + G   V+  I  +  
Sbjct: 266 QRGYEKALMVLPHDGATKDRVYNVSFESALQQAGFQTK---VIPNQGIGAVKMRIEAVRR 322

Query: 242 RM 243
             
Sbjct: 323 LF 324


>gi|121602586|ref|YP_988560.1| PBSX family phage terminase large subunit [Bartonella bacilliformis
           KC583]
 gi|120614763|gb|ABM45364.1| putative phage terminase, large subunit, PBSX family [Bartonella
           bacilliformis KC583]
          Length = 402

 Score = 87.5 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 72/242 (29%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  PL+  +P+ + +      + + 
Sbjct: 86  LCWVDEAEPVTETAWQTLIPTLREEGQDWHSELWVTWNPLRENAPVEKRFRLTKDPNIKG 145

Query: 72  IRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +   + P + ++  +  +        +     +G+ +      +          E  I
Sbjct: 146 VEINWRDNPQFPDKLNRDRLADLHQRPEQYGHIWEGDYLQAVQGAYYQKLLLDAEQEGRI 205

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
              S D          +        A    V       I ++  Y  + Q    H+  + 
Sbjct: 206 AHVSRDPLIQIKIFWDIGGTGAKADATALWVAQFIGREIRILDYYEAQGQPLSEHIGWIC 265

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  ++ G +        + G   V+  I  +  
Sbjct: 266 HRGYDKALMVLPHDGATKDRVYNVSFESALQQAGFQTK---IIPNQGLGAVKMRIEAVRR 322

Query: 242 RM 243
             
Sbjct: 323 LF 324


>gi|282601251|ref|ZP_05981204.2| phage terminase, large subunit, PBSX family [Subdoligranulum
           variabile DSM 15176]
 gi|282569696|gb|EFB75231.1| phage terminase, large subunit, PBSX family [Subdoligranulum
           variabile DSM 15176]
          Length = 414

 Score = 87.1 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 32/239 (13%), Positives = 61/239 (25%), Gaps = 21/239 (8%)

Query: 15  TVHYVWFDEEPPED------VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            V   WF+E    D         + + R       +  +  P       +  Y+      
Sbjct: 127 AVGLCWFEELDQFDGPEEVRSVEQSILRGGDWTLTLK-SFNPPAMARSWVNRYVLEPRPG 185

Query: 69  RQVIRMTINETP--HYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
           + V   T  + P     E+           +         GE ++GSG           +
Sbjct: 186 KLVHHSTYRDLPRQFLGERFWADAEHLRKTNPDAYRHEYGGE-VVGSGAAVFDNLTLREV 244

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
              +I        G+D+GW+  P+A   + ++     + +                 L  
Sbjct: 245 PDEEIASFDRLYHGVDWGWYPDPWAYNAVSYDAARRTLVIFDELTRTRTPNRDTARLLVE 304

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
            G              D    +  +  YR  G+           G   V   +  +   
Sbjct: 305 RGVGGDDGGLLTA---DAAEPKSCAD-YRAAGLPCRAA----VKGPGSVRESMKWLQGL 355


>gi|167757386|ref|ZP_02429513.1| hypothetical protein CLORAM_02936 [Clostridium ramosum DSM 1402]
 gi|167703561|gb|EDS18140.1| hypothetical protein CLORAM_02936 [Clostridium ramosum DSM 1402]
          Length = 431

 Score = 87.1 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/258 (15%), Positives = 81/258 (31%), Gaps = 30/258 (11%)

Query: 1   LKAYEQGRDKWQSNTV-----HYVWFDEEPPEDVY------FEGLTRINATQGLVTLTLT 49
            K  +    K +S  V      YVW++E    + Y       + L R    +  V  +  
Sbjct: 115 FKGAD-NPKKLKSTKVFVGYVKYVWYEECDEFESYDKIRNINQSLLR-GGPEYCVFYSFN 172

Query: 50  PLKGRSPIIEHYLSASSSDRQVIRMTINETP--HYNEQERKRIIDSYPLHE--REARTKG 105
           P + +       +     D  +   T  + P     EQ          ++E        G
Sbjct: 173 PPESQRNWCNKQVLIKRPDTYISHTTYLQAPREWLGEQFLIEAEHLKVINEEKYNHDYLG 232

Query: 106 EPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVV 164
           E + G+G       +   I+  +I        G+DFG+   P A   + +++    +++ 
Sbjct: 233 E-VTGTGGEVFTNLDIREISDDEIAVFDRLKNGLDFGYAGDPLAYLKMNYDKTRRRLFIF 291

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                   +    V  +K                 D      ++  ++  G+ ++     
Sbjct: 292 GEVYGTRLSNKKAVKKIKKLNPLNKLV------TADSAEPRTINE-FKLLGLNIVGA--- 341

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE GI  + D 
Sbjct: 342 -KKGPDSVENGIKWLQDL 358


>gi|9630534|ref|NP_046964.1| large terminase subunit [Methanobacterium phage psiM2]
 gi|3249594|gb|AAC27048.1| large terminase subunit [Methanobacterium phage psiM2]
          Length = 468

 Score = 87.1 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 84/258 (32%), Gaps = 15/258 (5%)

Query: 4   YEQGRDKWQSNTVHYVWFDE-----EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPII 58
           +E+ R ++Q ++ HY+ FDE     E      F  L +       + +  T   G     
Sbjct: 156 HEKDRYRYQGSSYHYIAFDELTEFMETQYRFMFRSLRKEVNDHIPLRVRATSNPGGIGHE 215

Query: 59  EHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILG-SGRIFPI 117
                  + ++  I  T  E P+ N  E +  ++      R     G+  +   G +F  
Sbjct: 216 WVKTRFITGEKTFIPSTWRENPYLNRDEYEEALNMLDHVTRRQLKDGDWDVTLQGGVFKR 275

Query: 118 VEEDIVINSLDIPEHWVQIGG-----MDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ 172
              +++ +  +     V+         D      +  G L+     D  YV+   R RE 
Sbjct: 276 EWFEVIDSPPNGLVMSVRYWDFAATKPDGANDPDYTVGLLLGVDKEDYYYVLDVRRFRES 335

Query: 173 TPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
                   L++  +           + +  S  ++   Y R  ++     A    G    
Sbjct: 336 PGKVKSKVLRTAEEDGREVII--AKEEEPGSSGKIVTDYLRSLLQGYTFRADRVTGDKVT 393

Query: 233 EAGISDMLDRMRSGRWKV 250
            A    +     SGR KV
Sbjct: 394 RA--LPVSSYAESGRIKV 409


>gi|262043664|ref|ZP_06016773.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039002|gb|EEW40164.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 464

 Score = 87.1 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/254 (12%), Positives = 68/254 (26%), Gaps = 28/254 (11%)

Query: 11  WQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS--ASS 66
              +    + F E        +      +    G      TP +G++   + +       
Sbjct: 125 LIGSGHVGIVFSEWALSNPSAWAFLRPILADNGGWAFFVSTP-RGKNHFYKMFQGGLKDP 183

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--------REARTKGEPILGS-----GR 113
            +     ++ + T H   +   + +                      +            
Sbjct: 184 DNWFCDHLSADITLHIPPETLAQELREMQAERGEEEGQALFNQEYMCDWNAAIPGAYYSS 243

Query: 114 IFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
           I   +E+   I ++     +      D G     A     +      + V+  Y      
Sbjct: 244 ILVGLEKGGQIGNVPWDPQYEVYTSWDLGIGDATAIWF--YQFIGKEVRVIDYYESSGVG 301

Query: 174 PIFHVAALKSWGKWL--PWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
              +V  L+           +PHD    +  +G        + G++     AT       
Sbjct: 302 LEHYVKILREKPYTYAERHFFPHDVRARELSTGASREETLGKLGIRCKVLPAT------S 355

Query: 232 VEAGISDMLDRMRS 245
           V+ GIS++   +RS
Sbjct: 356 VDDGISEVRMMLRS 369


>gi|255103175|ref|ZP_05332152.1| phage terminase large subunit [Clostridium difficile QCD-63q42]
          Length = 413

 Score = 87.1 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 61/236 (25%), Gaps = 20/236 (8%)

Query: 15  TVHYVWFDEEP-----PEDVYFEGLTRINATQGLVT---LTLTPLKGRSPIIEHYLSASS 66
            + +VW +E         D+  + L  I     L      T  P+     I   Y    +
Sbjct: 129 KLTWVWCEEATELMESDIDILDDRLRGILTNPNLYYQMTFTFNPVSATHWIKRKYFDYKN 188

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D      T  +    +E   +R+           +  G    G      +    I   +
Sbjct: 189 DDIFTHHSTYLQNRFIDEAYYRRMQMRKEQDPEGYKVYGLGEWGETGGAILKNYVIHEFT 248

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
            +           DFG++H               +Y+       E      +    S G 
Sbjct: 249 TEFEYFDNMRLSQDFGFNHANVVLR--IGFKDGELYICNEIYVHEMDTSEIIKIANSIGL 306

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                     +  D    +++   ++  G K          G   V+A I  +   
Sbjct: 307 EKTLF-----MYCDSAEPDRIK-MWKNAGYKA----KGVKKGPGSVKAQIDYLKQL 352


>gi|254523093|ref|ZP_05135148.1| phage terminase, large subunit, pbsx [Stenotrophomonas sp. SKA14]
 gi|219720684|gb|EED39209.1| phage terminase, large subunit, pbsx [Stenotrophomonas sp. SKA14]
          Length = 478

 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/289 (12%), Positives = 72/289 (24%), Gaps = 51/289 (17%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEP-----PEDVYFEGLTRINATQGLVTLTLTPLK--- 52
               +  R K++    +Y+ FDE          +Y     R  A      +  T      
Sbjct: 111 YLNADNDRFKYRGRAWNYIGFDELTLWPTATCYLYLMSRNRTTARDLPRYMRGTTNPDGV 170

Query: 53  GRSPIIEHYLSASSSD---------------------------RQVIRMTINETPHYNEQ 85
           G+  ++E +                                  R+ I   + +  H    
Sbjct: 171 GQRWVMERWGIEEDGGPTCLPVSMMFEEEDGEGGYREVPRTFTRRFIPAKLTDNKHLRGT 230

Query: 86  ERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE------DIVINSLDIPEHWVQIGGM 139
             +  +   P  ER+A   G              E         I  +            
Sbjct: 231 GYRETLMMLPPEERDALLAGRWSGNRVEGAFYFRELQAARAQQRIGKVPFVPGVPVNTFW 290

Query: 140 DFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAW-----PH 194
           D G++   +       +       +  Y+        +   L+  G    + +     PH
Sbjct: 291 DLGYNDFNSIWF--HQQIGLTNRFIHAYQNSGYDISHYTRYLQELGTERGYVYGKHYVPH 348

Query: 195 DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
           D      ++G+ +    R    +M  +        + V  GI+      
Sbjct: 349 DAANTSLQTGKTMIQLLRE---QMAGQSFEIVPRVDHVLVGINQTRAAF 394


>gi|194015441|ref|ZP_03054057.1| phage terminase, large subunit, pbsx family [Bacillus pumilus ATCC
           7061]
 gi|194012845|gb|EDW22411.1| phage terminase, large subunit, pbsx family [Bacillus pumilus ATCC
           7061]
          Length = 437

 Score = 86.8 bits (213), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 37/253 (14%), Positives = 83/253 (32%), Gaps = 38/253 (15%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDE--EPPEDVYFEGLTRINATQGLVTL--TLTPLKGRS 55
            K  ++  +K +S   +  +W +E  E   + + E L R+      + +  +  P+   +
Sbjct: 104 FKGLDK-PEKLKSINNISMIWIEECSEVSYEGFKELLGRLRHPSLPLYMMLSTNPVGQDN 162

Query: 56  PIIEHYLSASS-------------------SDRQVIRMTINETPHYNEQERKRI--IDSY 94
               H+                         D      T  +     +   +++  +  Y
Sbjct: 163 WTYRHFFRDEQLKRFVLDDETLYKKRTVVIKDTYYHHSTAEDNLFLPKSYVEQLDELKEY 222

Query: 95  PLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQI---GGMDFGW-HHPFAAG 150
                    KG   +   ++FP  E     + L+  +   +     GMDFG+     A  
Sbjct: 223 DPDLYRIARKGYFGINGTKVFPQFEVRSHSDVLEAIQQIDRPLKRAGMDFGFVKSYNALI 282

Query: 151 HLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQ 210
            L  + +   +Y+   Y  R +T       LK +          + ++ D    + +   
Sbjct: 283 RLAVDHEKKYLYIYWEYYDRGKTDDETAVDLKEF------IESKELIKADAAEPKTIH-Y 335

Query: 211 YRRQGMKMLPECA 223
           +R++G +M+    
Sbjct: 336 FRQRGFQMVAAHK 348


>gi|187935777|ref|YP_001886932.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           B str. Eklund 17B]
 gi|187723930|gb|ACD25151.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           B str. Eklund 17B]
          Length = 450

 Score = 86.8 bits (213), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 36/237 (15%), Positives = 78/237 (32%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINAT--QGLVTLTLTPLKGRSPIIEHYLSASSS---- 67
           V  VW +E  E   + + E L R+     +  + LT  P+   +   +++          
Sbjct: 117 VSIVWIEECSEVKYEGFKELLGRLRHPTLKLHMILTTNPVSKSNWCYKYFFIDKKKKLFV 176

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          +        ++     +    ++  + ++         KG+    
Sbjct: 177 LDDKDLYKKRIVIKNNTYYHHSLADDNYFLPKSYILQLDDLKTHDKDLWRVARKGQFGTN 236

Query: 111 SGRIFPIVEEDIVINSLDIPEHWV---QIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             ++ P  E+      L++  +        GMDFG+     A   L  + DS ++Y+   
Sbjct: 237 GKKVLPQFEKKPHYKVLEMMHNTKKLLYRVGMDFGFETSYNAVVRLAIDDDSKILYIYWQ 296

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       L+ + K        + ++ D    + +   YR++G  ML    
Sbjct: 297 YYKNQMTDDKTAIELEEFKK------TQERIKADSAEPKTI-TFYRQEGFNMLGAKK 346


>gi|165928475|ref|ZP_02224307.1| P-loop protein [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165919510|gb|EDR36843.1| P-loop protein [Yersinia pestis biovar Orientalis str. F1991016]
          Length = 397

 Score = 86.4 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/236 (11%), Positives = 64/236 (27%), Gaps = 10/236 (4%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD------RQVIRMTIN 77
               D +++ L    ++     L +   KG S   + +    + D       +  +    
Sbjct: 107 ADKPDTWYKVLRPTLSSTRGGALIIGTPKGFSEFHKLWTIGQNKDLQRKGQWKSWQFVTA 166

Query: 78  ETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIG 137
           ++P     E +   +                  SGR++   + ++ +  L          
Sbjct: 167 DSPFVPSAEIEAAKNDMDPKSFAQEYLASFENMSGRVYYPFDRNVHVKPLQFNPKLPIWV 226

Query: 138 GMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK---SWGKWLPWAWPH 194
           G DF      +   L    + ++  V +       T        +    W   +      
Sbjct: 227 GQDFNIDPMSSVI-LQPQPNGELWAVDEVVLFSSNTAEVCDELERRFWRWKSQVTIFPDP 285

Query: 195 DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
            G       GE     ++ +G   +         ++ V A    ++      R  +
Sbjct: 286 AGAYRQHARGESDVDIFKEKGFLRVDYPKKHPPIADRVNAVNRMLMSASGETRLYI 341


>gi|46143644|ref|ZP_00204538.1| COG1783: Phage terminase large subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 407

 Score = 86.4 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 64/239 (26%), Gaps = 20/239 (8%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W +E        + +    +      + +T  P K  S     +      + ++I M 
Sbjct: 125 LAWVEEAETVSEVAWQKLEPTVREHNSEIWVTWNPEKRGSATDLRFRQHVPENAKIIEMN 184

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    EQ R                +G           I  +       +    
Sbjct: 185 YSDNPWFPKELEQTRLADKARLDDATYRWIWEGAY--LEQSEAQIFRDKYQELEFEPNPD 242

Query: 133 WV-QIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
           +     G+DFG+ +   A    W  D D +Y+               + +          
Sbjct: 243 FDGPYHGLDFGFANDPTAAIKCWVFDGD-LYIEYEAGQVRLELDETASFISGRIPEFEKY 301

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
                   D    E +S   +R G    P           VE GI+ +      G+  +
Sbjct: 302 ISRA----DSARPESIS-YLKRHGF---PRIEGVKKWQGSVEDGIAHIKSY---GKVYI 349


>gi|319647234|ref|ZP_08001456.1| YqaT protein [Bacillus sp. BT1B_CT2]
 gi|317390581|gb|EFV71386.1| YqaT protein [Bacillus sp. BT1B_CT2]
          Length = 431

 Score = 86.4 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 33/227 (14%), Positives = 71/227 (31%), Gaps = 34/227 (14%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTL--TPLKGRSPIIEHYLSASSSDR------------ 69
           E   + + E L R+      + +     P+   +   +H+     ++R            
Sbjct: 126 EVKYEGFKELLGRLRHPTLPLHMIFSTNPVGEDNWTYKHFFKDDLNNRFVLDDKELYEKR 185

Query: 70  -------QVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILGSGRIFP---I 117
                       T  +     E   +++  +  Y         KG   +   R+FP    
Sbjct: 186 TIVLNDTYYHHSTAEDNLFLPESYVRQLDELKEYDPDLYRIARKGHFGVNGVRVFPQLEE 245

Query: 118 VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              D V+ ++   +  ++  GMDFG+     A   L  +     +Y+   Y  R  T   
Sbjct: 246 WPHDEVMQAVSNIDCPIKRVGMDFGFEESYNAVVRLAVDHKKKYLYIYWEYYKRGMTDDR 305

Query: 177 HVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
               L+ +          + ++ D    + +   +R+ G  M+    
Sbjct: 306 TAEELQEFKN------TQELIKADSAEPKTI-QYFRQHGFNMVGAHK 345


>gi|307263070|ref|ZP_07544692.1| Phage terminase, large subunit, PBSX family [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|306871696|gb|EFN03418.1| Phage terminase, large subunit, PBSX family [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 407

 Score = 86.4 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 63/239 (26%), Gaps = 20/239 (8%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W +E        + +    +      + +T  P K  S     +      + ++I M 
Sbjct: 125 LAWVEEAETVSEVAWQKLEPTVREHNSEIWVTWNPEKRGSATDLRFRRHVPENAKIIEMN 184

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    EQ R                +G           I  +       +    
Sbjct: 185 YSDNPWFPKELEQTRLADKARLDDATYRWIWEGAY--LEQSEAQIFRDKYQELEFEPNPD 242

Query: 133 WV-QIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
           +     G+DFG+ +   A    W  D D +Y+               + +          
Sbjct: 243 FDGPYHGLDFGFANDPTAAIKCWVFDGD-LYIEYEAGQVRLELDETASFISGRIPEFEKY 301

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
                   D    E +S   +R G    P           VE GI  +      G+  +
Sbjct: 302 ISRA----DSARPESIS-YLKRHGF---PRIEGVKKWQGSVEDGIEHIKSY---GKVYI 349


>gi|319409256|emb|CBI82900.1| phage-related protein [Bartonella schoenbuchensis R1]
          Length = 441

 Score = 86.4 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 70/242 (28%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  PL+  +P+ + + +      + 
Sbjct: 125 LCWVDEAEPVTETAWQTLIPTLREEGENWHCELWVTWNPLRENAPVEKRFRAVKDPHIKG 184

Query: 72  IRMTINETPHYNEQERKRII--DSYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +   + P + ++  +      +    +     +GE +      +          E  I
Sbjct: 185 VEINWRDNPQFPDRLNRAREADFTQRPEQYNHIWEGEYLQAVQGAYYQKLLLEAEQEGRI 244

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
                D          +        A    V       I V+  Y  + Q    H+  + 
Sbjct: 245 THVPRDPLIQIKIFWDIGGTGAKADATALWVAQFIGREIRVLDYYEAQGQPLSEHIGWMC 304

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  +  G +        + G   V+  I  +  
Sbjct: 305 QRGYDKALMVLPHDGATKDRVCNVSFESALQHAGFQTK---IIPNQGVGAVKMRIEAVRR 361

Query: 242 RM 243
             
Sbjct: 362 LF 363


>gi|254431412|ref|ZP_05045115.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
 gi|197625865|gb|EDY38424.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
          Length = 470

 Score = 86.4 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 74/298 (24%), Gaps = 64/298 (21%)

Query: 10  KWQSNTVHYVWFDEE---PPEDVYFEGLTRINATQG---LVTLTLTPLKGRSPIIEH--- 60
           + Q  +      DE    P  D Y +    +    G    V     P       ++    
Sbjct: 108 RLQGRSKICAIHDEAGTQPTPDFYDQLQGVLRGPAGVPTRVIFLANPGGPGHHWLKERFA 167

Query: 61  --------------YLSASSSDRQVIRMTINETPHYNEQERK---RIIDSYPLHEREART 103
                         +          +    +  PH + Q+ K    I+         A  
Sbjct: 168 APAGLPEPMKPRRFWSEEYEKHCIFLTANASINPHVDWQQYKRNVEIVSGGDPAMLAALL 227

Query: 104 KGEPILGSGRI-----FPIVEEDIVINSLDIPEHWVQIGG---MDFGWHHPFAAGHLV-- 153
           +G      G       +        IN  +I     +      MD G+  P  A  +V  
Sbjct: 228 EGRWDTDLGGAFFASCWSPNRCRHAINPGEIYLRGHRPRPFVVMDHGYAAPTVAYLVVPN 287

Query: 154 ---WNRDSDVIYVVKNYR------------------CREQTPIFHVAALKSWG---KWLP 189
               +     + +                          +     +  L+ WG     + 
Sbjct: 288 PPGIDAPKGTLLLADELYLCSSNVSGRRDWARGSCLPSSEQAAAMIEWLQRWGLERGDVR 347

Query: 190 WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGR 247
                     +      ++ ++R  G+ +    A        V AG+  + +RM + R
Sbjct: 348 ILADDAMWNSNGHISGSIAQEFRAAGVTL----ARAQKMKTPVMAGLQMLRNRMHAAR 401


>gi|15837841|ref|NP_298529.1| hypothetical protein XF1239 [Xylella fastidiosa 9a5c]
 gi|9106220|gb|AAF84049.1|AE003958_3 hypothetical protein XF_1239 [Xylella fastidiosa 9a5c]
          Length = 135

 Score = 86.4 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 62/120 (51%), Positives = 85/120 (70%)

Query: 3   AYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
           ++EQG +KWQ++ V ++WFDE+PPEDVYFEG+TR N T  LV +T TPLK  S ++  +L
Sbjct: 9   SFEQGGEKWQADPVDWMWFDEQPPEDVYFEGITRTNRTFWLVCMTFTPLKSISTVVWRFL 68

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDI 122
             +  DR  ++M+I +  HY  ++  RI  SYP +EREART+G P LGSGR+FPI  E I
Sbjct: 69  LENVPDRADMQMSIEDAEHYLVEDCARITASYPPYEREARTQGVPALGSGRVFPIAGEKI 128


>gi|300173892|ref|YP_003773058.1| phage terminase large subunit [Leuconostoc gasicomitatum LMG 18811]
 gi|299888271|emb|CBL92239.1| phage terminase, large subunit, pbsx family [Leuconostoc
           gasicomitatum LMG 18811]
          Length = 427

 Score = 86.0 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 34/237 (14%), Positives = 77/237 (32%), Gaps = 25/237 (10%)

Query: 19  VWFDEEPP------EDVYFEGLTRINATQGLVT---LTLTPLKGRSPIIEHYLSASS--S 67
           +W +E          +   E +  +           LT  P   R  + + +    +  +
Sbjct: 130 LWVEEAYQMELEESFETVDESMRGVIDDPDGFYQTVLTFNPWNERHWLKKRFFDEDTRVN 189

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVIN 125
           +   I  T  + P  +     R+++    + R AR    GE  +  G I          +
Sbjct: 190 NSLAITTTYKDNPFLDVDYVNRLLEMKKRNPRRARVAVDGEWGVAEGLI-YENTIVEKFD 248

Query: 126 SLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
             ++ +    + GMD+G+   P        N  +  IY++K    +          L   
Sbjct: 249 IREVLKGSHIVRGMDWGYGPDPTTFIEYAINTKTKDIYILKEMYKQHMLTDEIFKWL--- 305

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             ++      D        G+++  + R +G++ +            +  G++ + D
Sbjct: 306 --YVHGYQQGDIRADYANGGDRMIQELRNKGIRGMKRAH-----KYEIMFGVTYLQD 355


>gi|293553737|ref|ZP_06674356.1| phage terminase, large subunit, pbsx family [Enterococcus faecium
           E1039]
 gi|291602094|gb|EFF32327.1| phage terminase, large subunit, pbsx family [Enterococcus faecium
           E1039]
          Length = 382

 Score = 86.0 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 30/258 (11%), Positives = 71/258 (27%), Gaps = 30/258 (11%)

Query: 5   EQGRDKWQSNT-----VHYVWFDEEPPE-------DVYFEGLTRINATQG--LVTLTLTP 50
            Q  ++ +S           W +E            +    L              +  P
Sbjct: 61  AQNPERIKSLKDSKFPFAIGWIEELAEFKNEDEVTTITNSLLRGELDDGLFYKFFYSYNP 120

Query: 51  L-KGRSPIIEHYLSASSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI 108
             + +S + + Y ++    +  +   T  + P  +++    +  +   + R A  + +  
Sbjct: 121 PKRKQSWVNKKYETSFQPKNTFIHHSTYKDNPFISKEFLSEVEAARARNPRRAEWEYDGK 180

Query: 109 LGSGRIFPIVEEDIV---INSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVV 164
                I P     I    I    +        G+D+G+   P A     +++  + IY +
Sbjct: 181 AIGSGIVPFDNLRIEAGSITDEMVANFDNIRQGLDYGYATDPLAFVRWHYDKKRNCIYAI 240

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                 + +       +KS                     +  +       +    +   
Sbjct: 241 DELYEVKCSNRRAAQWIKSNKYHYQDIIAE-------VEPKSNAEMRNEHDIS---KIRQ 290

Query: 225 FDDGSNGVEAGISDMLDR 242
              G + VE G   + D 
Sbjct: 291 VTKGPDSVEYGEKWLDDL 308


>gi|295840070|ref|ZP_06827003.1| translation initiation factor IF-2 [Streptomyces sp. SPB74]
 gi|197697038|gb|EDY43971.1| translation initiation factor IF-2 [Streptomyces sp. SPB74]
          Length = 489

 Score = 85.6 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 36/274 (13%), Positives = 78/274 (28%), Gaps = 47/274 (17%)

Query: 8   RDKWQSNTVHYVWFDEEPPED--VYFEGLTRINA---TQGLVTLTLTPLKGRSPIIEHYL 62
            +K+ S+    +  DE        +   +TR+     T   +     P +    + +   
Sbjct: 116 PEKFLSSEFDRIAVDEATQISKTAHETLITRLRGGAPTYKQIVCAANPAQPSHWLKQRAD 175

Query: 63  SASSSDRQVIRMTINETPHYNEQE---------RKRIIDSYPLHEREARTKGEPILGSGR 113
           + +    ++I     + P Y   +             +D+     R     G+     G 
Sbjct: 176 TGT---MRLINSRHRDNPAYVNADGSLTEIGAAYLSKLDALSGVRRLRLRDGQWAAAEGM 232

Query: 114 IFPIVEE-DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ 172
           ++   ++   +I+   IP+ W +   +DFG+ +PF       + D   + + +     ++
Sbjct: 233 VYDGWDDAVHLIDPAPIPKEWPRWWVVDFGFTNPFVLQCWAEDPDG-RLIMYREIYRTQR 291

Query: 173 TPIFHVAALKSW--------GKWLPWAWPHDGLQHD-------------KRSGEQLSAQY 211
               H   +           G                                E  +   
Sbjct: 292 LVEDHARDILRLVRTCAQCCGSKREAHDCQACEACRLEWTEPRPQAVICDHDAEDRATLE 351

Query: 212 RRQGMKMLPECATFDDGSNGVEAGISDMLDRMRS 245
           R  G+   P       G +    GI     RM+ 
Sbjct: 352 RHLGLATRPA----KKGKST---GIQAAQARMKV 378


>gi|16800336|ref|NP_470604.1| hypothetical protein lin1267 [Listeria innocua Clip11262]
 gi|16413741|emb|CAC96498.1| lin1267 [Listeria innocua Clip11262]
          Length = 444

 Score = 85.6 bits (210), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/253 (13%), Positives = 71/253 (28%), Gaps = 38/253 (15%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDE--EPPEDVYFEGLTRINATQGL--VTLTLTPLKGRS 55
            K  ++   K +S   +  +W +E  E     Y E L R+        + LT  P+   +
Sbjct: 110 FKGLDK-PSKLKSIANISIIWVEECSEISYAAYKELLGRLRHPFLKTHIILTSNPVSIDN 168

Query: 56  PIIEHYLSA-------------------SSSDRQVIRMTINETPHYNEQERKRIIDS--Y 94
            +  H+                        ++         +     +     + D   Y
Sbjct: 169 WVYLHFFEDFINKRFILSDSLLYEKRIIKKNNTYYHHSVAEDNYFLTQDYIDDLEDMKNY 228

Query: 95  PLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIG---GMDFGW-HHPFAAG 150
                    +G   +   ++ P +EE      ++   +        GMDFG+     A  
Sbjct: 229 DPDLYRVARQGRFGVLGTKVLPQLEEKDHDWMIEAINNIKNPINRNGMDFGFVESMNALL 288

Query: 151 HLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQ 210
            +  + D   +Y+   Y     T       +K + +     +       D    + +   
Sbjct: 289 SMTIDPDKKDLYIHFEYYANGNTDDVTAQDIKEFKETKEVIF------ADSAEPKTIK-Y 341

Query: 211 YRRQGMKMLPECA 223
           +   G  M     
Sbjct: 342 FSDNGFVMYAAHK 354


>gi|13470687|ref|NP_102256.1| bacteriophage terminase large subunit-like protein [Mesorhizobium
           loti MAFF303099]
 gi|14021429|dbj|BAB48042.1| mll0463 [Mesorhizobium loti MAFF303099]
          Length = 445

 Score = 85.6 bits (210), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 77/301 (25%), Gaps = 63/301 (20%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQG-----------LVTLTLTPL 51
           E+ R K+Q   +H +  DE       +Y     R+                 +     P 
Sbjct: 56  EKDRFKYQGAEIHVLLIDELTHFTEVIYRFLRNRVRMVGIKLPAKYAGRFPRILCGANPG 115

Query: 52  KGRSPIIEHYLSASSS--------------DRQVIRMTINETPHY---NEQERKRIIDSY 94
                 ++      ++               RQ I   + + P     +     R++   
Sbjct: 116 GIGHQFVKATFIDGATAMKVYTTEASEGGMRRQFIPAQLEDNPSMNDNDPGYENRLMGLG 175

Query: 95  PLHEREARTKGEPILGSGRIFPIV-EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV 153
                 A   G+  +  G  F        V+    IP+HW++    D+G   PFA G  V
Sbjct: 176 SESLVRAMRYGDWDVVEGAYFDNFERRRHVVKPFTIPDHWIRFRAGDWGSAKPFAFGWYV 235

Query: 154 WNRD-----------SDVIYVVKNYRCRE----------QTPIFHVAA----LKSWGKWL 188
              D              +   + +   +               H  A    ++      
Sbjct: 236 VASDDTIIAPGVVVPRGALVKYREWYGVKIDKSGKFLPDVGLKLHAEAVGAGVRQRDYDD 295

Query: 189 PWAW-PHDGLQHDKRSGEQLSAQYRR-----QGMKMLPECATFDDGSNGVEAGISDMLDR 242
              +   D     +  G  ++ +  R      G            G      G   +  R
Sbjct: 296 IIVYGVLDPAAFSQDGGPSIAERMTRGTTGSNGSTFRRADNKRTAGRGA-MGGWDQLRGR 354

Query: 243 M 243
           +
Sbjct: 355 L 355


>gi|317499861|ref|ZP_07958099.1| pbsx family Phage terminase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|316898763|gb|EFV20796.1| pbsx family Phage terminase [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 428

 Score = 85.2 bits (209), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 76/237 (32%), Gaps = 38/237 (16%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINAT--QGLVTLTLTPLKGRSPIIEHYLSASSS---- 67
           V  VW +E  E     + E L R+        + L+  P+   +   +++          
Sbjct: 119 VSIVWIEECSEVKYAGFKEILGRLRHPTLSNHIILSTNPVSKGNWCYKYFFQDKKKKVFV 178

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          +      T+++     ++  +++  + ++         +G   + 
Sbjct: 179 LDDEKLYKERTVVVGNTYYHHSTVDDNFFVPKEYVEQLDDLQTHDPDLYRVARQGRFGVN 238

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIG---GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
              +FP    +         +         GMDFG+     AA  ++ + D  ++Y+ + 
Sbjct: 239 GSLVFPQFVVEPANQVEKEIKAIRTPLEKNGMDFGFVTSYNAALRMIVDHDEKILYIYRE 298

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y  R +T       +K         W    ++ D    + +   Y++ G +M     
Sbjct: 299 YYSRNKTDPEIAEDMKD--------WKDIVIKADCAEPKAIR-YYKQSGFRMKACKK 346


>gi|240850378|ref|YP_002971772.1| phage terminase, large subunit [Bartonella grahamii as4aup]
 gi|240267501|gb|ACS51089.1| phage terminase, large subunit [Bartonella grahamii as4aup]
          Length = 444

 Score = 85.2 bits (209), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/242 (14%), Positives = 76/242 (31%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  PL+  +P+ + +  + +   + 
Sbjct: 127 LCWVDEAEPVTETAWQTLIPTLREEGEGWRAELWVTWNPLRENAPVEKRFRFSDNEAIKR 186

Query: 72  IRMTINETPHYNEQERKRIIDS--YPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +  ++ P + +   +  +D         +   +G  +      +          E  I
Sbjct: 187 VEINWSDNPKFPKILNEARLDDLRNRPETYKHIWEGAYLTAVQGAYYQKEMLAAEQEGRI 246

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
              + D          +        A    +       I V+  Y  + Q    HV  L+
Sbjct: 247 GRVARDPLMQIRAFWDIGGTGAKADATAIWIAQFVGREIRVLNYYEAQGQPLSEHVGWLR 306

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +  ++ G +        + G+  V+  I  +  
Sbjct: 307 QNGYEKALMVLPHDGATRDRVHNVSFESALKQAGFQTK---VIPNQGAGAVKIRIETVRR 363

Query: 242 RM 243
            +
Sbjct: 364 VL 365


>gi|52081321|ref|YP_080112.1| Phage terminase, large subunit protein [Bacillus licheniformis ATCC
           14580]
 gi|52786700|ref|YP_092529.1| YqaT [Bacillus licheniformis ATCC 14580]
 gi|52004532|gb|AAU24474.1| Phage terminase, large subunit protein [Bacillus licheniformis ATCC
           14580]
 gi|52349202|gb|AAU41836.1| YqaT [Bacillus licheniformis ATCC 14580]
          Length = 431

 Score = 85.2 bits (209), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 72/227 (31%), Gaps = 34/227 (14%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTL--TPLKGRSPIIEHYLSASSSDR------------ 69
           E   + + E L R+      + +     P+   +   +H+     ++R            
Sbjct: 126 EVKYEGFKELLGRLRHPTLPLHMIFSTNPVGEDNWTYKHFFKDDLNNRFVLDDKELYEKR 185

Query: 70  -------QVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILGSGRIFP---I 117
                       T  +     E   +++  +  Y         KG   +   R+FP    
Sbjct: 186 TIVLNDTYYHHSTAEDNLFLPESYVRQLDELKEYDPDLYRIARKGHFGVNGVRVFPQLEE 245

Query: 118 VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
              D V+ ++   +  ++  GMDFG+     A   L  +     +Y+   Y  R  T   
Sbjct: 246 WPHDEVMQAVSNIDCPIKRVGMDFGFEESYNAVVRLAVDHKKKYLYIYWEYYKRGMTDDR 305

Query: 177 HVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
               L+ +          + ++ D    + +   +R+QG  M+    
Sbjct: 306 TAEELQEFKN------TQELIKADSAEPKTI-QYFRQQGFNMVGAHK 345


>gi|168207201|ref|ZP_02633206.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens E str. JGS1987]
 gi|170661424|gb|EDT14107.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens E str. JGS1987]
          Length = 427

 Score = 84.8 bits (208), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 36/237 (15%), Positives = 79/237 (33%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINAT--QGLVTLTLTPLKGRSPIIEHYLSASS----- 66
           V  +W +E  E     + E L R+        + L+  P+   +   +H+          
Sbjct: 118 VSIIWIEECSEVKYAGFKELLGRLRHPTLSNHIILSTNPVSKGNWSYKHFFQDKRNHFFV 177

Query: 67  --------------SDRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          +      T+++     ++  +++  +  +         KG   + 
Sbjct: 178 LDDEELYIKKNIIIKNTYYHHSTVDDNFFAPKEYIEQLDELKLHDPDLWRIARKGRFGVN 237

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIG---GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
              +FP  E       +D  +H  +     GMDFG+     A   +  + D  V+Y+   
Sbjct: 238 GKLVFPQFEVMKYDKVMDEIKHIKKPLLKNGMDFGFVTSYNALLRMAIDHDKRVLYIYWE 297

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y  R++T I     +K + +           + D    + +   Y+++G +M     
Sbjct: 298 YYTRDKTDIEIAKDIKEFKETREVI------KADCAEPKAIK-FYKQEGFRMKACKK 347


>gi|225220117|ref|YP_002720084.1| phage terminase large subunit [Enterobacteria phage SSL-2009a]
 gi|224986058|gb|ACN74622.1| phage terminase large subunit [Enterobacteria phage SSL-2009a]
          Length = 461

 Score = 84.8 bits (208), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 41/253 (16%), Positives = 84/253 (33%), Gaps = 24/253 (9%)

Query: 10  KWQSNTVHYVWFDE--EPPEDV----YFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           +       ++  DE     +DV    Y + L R+ A      + ++  +G   + + +  
Sbjct: 143 RLIGVNAAWIVADEFDTTKQDVAMAAYHKLLGRLRAGFVRQFVIVSTPEGYRAMYQIFEV 202

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI-LGSGRIFPIVEEDI 122
              S +++IR    +  H        +   YP +  +A   G  + L SG ++ +   + 
Sbjct: 203 EKGSQKRLIRAKTTDNHHLPADFIDTLRSQYPANLIDAYLNGLFVNLTSGAVYKMFNREG 262

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRD------SDVIYVVKNYRCREQTPIF 176
             ++ ++      I GMDF      A  ++   R        D I+ V  +     TP  
Sbjct: 263 NASTEEVHPDDTLIIGMDFNVTKMAAVVYVRRQRITENKEFRDEIHAVDEFVDLFDTPAM 322

Query: 177 HVAALKSWGKW----LPWAWPHDGLQHDKRSGE--QLSAQYRRQGMKMLPECATFDDGSN 230
             A  + + +         +P    +  K         AQ    G ++  +         
Sbjct: 323 IEAIEERYPEHCAAGRVVVYPDSSGKSRKTVNASSSDIAQLEDAGFEVEYDSVNPP---- 378

Query: 231 GVEAGISDMLDRM 243
            V+  +  M   M
Sbjct: 379 -VKDRLIAMNTMM 390


>gi|302385792|ref|YP_003821614.1| phage terminase, large subunit, PBSX family [Clostridium
           saccharolyticum WM1]
 gi|302196420|gb|ADL03991.1| phage terminase, large subunit, PBSX family [Clostridium
           saccharolyticum WM1]
          Length = 428

 Score = 84.8 bits (208), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 40/237 (16%), Positives = 88/237 (37%), Gaps = 38/237 (16%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQ--GLVTLTLTPLKGRSPIIEHYLSASSS---- 67
           V  VW +E  E     + E L R+   +    + L+  P+   + + +H+    S+    
Sbjct: 121 VSIVWIEECSEVKYAGFKEILGRLRHPELSNHIILSTNPVSKSNWVYKHFFQDKSTGYKI 180

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          +      T+++     ++  +++  +  +         KG   + 
Sbjct: 181 LNDEELYTRRIVVIGNTYYHHSTVDDNYFVPQEYVEQLDELQQHDPDLYRIARKGRFGVN 240

Query: 111 SGRIFPIV---EEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
              +FP      +D V   + +  + V+  GMDFG+     A   ++ + D+ ++Y+   
Sbjct: 241 GRLVFPQFVVKPDDEVKTLIKLIRNPVEKNGMDFGFVTSYNAVVRMMIDHDNKILYLYDE 300

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y  R++T     A L  W   L        ++ D    + +   Y++QG ++ P   
Sbjct: 301 YYSRDKTDPEIAADLAKWIGVL--------IKADCAEPKAIR-YYKQQGFRIKPCKK 348


>gi|228947332|ref|ZP_04109625.1| Phage terminase large subunit [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228812331|gb|EEM58659.1| Phage terminase large subunit [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 312

 Score = 84.8 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/236 (14%), Positives = 66/236 (27%), Gaps = 20/236 (8%)

Query: 15  TVHYVWFDE-----EPPEDVYFEGLTRINATQG---LVTLTLTPLKGRSPIIEHYLSASS 66
            + ++W +E     E   D+  + L  I   +     +T T  P+     I + Y     
Sbjct: 25  KLTWIWIEESTELKENDIDILDDRLRGILPNENLYYQITFTFNPVSSTHWIKKKYFDIEH 84

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS 126
            D      T       ++   +R++          +  GE   G      +    +    
Sbjct: 85  PDIFTHHSTYLTNRFIDDAYHRRMMLRKEQDPEGYQVYGEGDWGEIGGVILKNYRVHDFD 144

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGK 186
                        DFG++H  A     W +D ++    + Y   + T      A K    
Sbjct: 145 TSFERFDSMNHSQDFGFNHANAILTGGW-KDGELYICNEIYVHEKDTNEIIEIADKQGLN 203

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
              + +                  +++ G K            N V+A I  +   
Sbjct: 204 KRLFMYCDSAE-------PDRIKMWKKAGYKAT----AVVKNPNSVKAQIDYLKTL 248


>gi|273810556|ref|YP_003344937.1| gp2 [Sodalis phage SO-1]
 gi|258619841|gb|ACV84094.1| gp2 [Sodalis phage SO-1]
          Length = 461

 Score = 84.8 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/253 (15%), Positives = 84/253 (33%), Gaps = 24/253 (9%)

Query: 10  KWQSNTVHYVWFDE--EPPEDV----YFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           +       ++  DE     +DV    Y + L R+ A      + ++  +G   + + +  
Sbjct: 143 RLIGVNAAWIVADEFDTTKQDVALAAYHKLLGRLRAGFVRQFVIVSTPEGYRAMYQIFEV 202

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI-LGSGRIFPIVEEDI 122
              S +++IR    +  H        +   YP +  +A   G  + L SG ++ +   + 
Sbjct: 203 EKDSQKRLIRAKTTDNHHLPADFIDTLRSQYPANLIDAYLNGLFVNLTSGAVYKMFNREE 262

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDS------DVIYVVKNYRCREQTPIF 176
             ++ ++      I GMDF      A  ++   R +      D I+ V  +     TP  
Sbjct: 263 NASTEEVQPEDTLIIGMDFNVTKMAAVVYVRRQRITENKEFLDEIHAVDEFVDLFDTPAM 322

Query: 177 HVAALKSWGKW----LPWAWPHDGL--QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
             A  + +           +P      +    +     AQ    G ++  +         
Sbjct: 323 IEAIEERYPDHCAAGRVVVYPDSSGKSRKTVNASSSDIAQLEDAGFEVEYDSVNPP---- 378

Query: 231 GVEAGISDMLDRM 243
            V+  +  M   M
Sbjct: 379 -VKDRLIAMNTMM 390


>gi|160899533|ref|YP_001565115.1| PBSX family phage terminase large subunit [Delftia acidovorans
           SPH-1]
 gi|160365117|gb|ABX36730.1| phage terminase, large subunit, PBSX family [Delftia acidovorans
           SPH-1]
          Length = 414

 Score = 84.8 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 69/233 (29%), Gaps = 18/233 (7%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      + +T  P K  SP  + +      + +V+ + 
Sbjct: 125 IAWVDEAESVSEVAWQKLAPTVREQGSEIWVTWNPEKDGSPTDKRFRKEPPPNSKVVELN 184

Query: 76  INETPHYNE---QERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P + E   QER+   D            G           I+     +   +    
Sbjct: 185 YSDNPWFPEVLDQERQADRDRLDDQTYAWVWDGAYR--ENSDAQILSGKYRVAEFEPQPG 242

Query: 133 WV-QIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPW 190
           W     G+D+G+   P A            +++                 +      LP 
Sbjct: 243 WDGPYFGLDWGFSQDPTAGVKCWVG--DGRLWIEYEAGKVGLENDDIADYVIQR---LPG 297

Query: 191 AWPHDGLQHDKRSGEQLSAQY---RRQGMKMLPECATFDDGSNGVEAGISDML 240
              H  ++ D    E +S      R    + LP+    +     VE GI+ + 
Sbjct: 298 IEQH-TVRADSARPETISHVKSKGRDGKRQCLPKLEAVEKWKGSVEDGIAHLR 349


>gi|49475449|ref|YP_033490.1| terminase large subunit protein [Bartonella henselae str.
           Houston-1]
 gi|49475495|ref|YP_033536.1| terminase large subunit protein [Bartonella henselae str.
           Houston-1]
 gi|49238255|emb|CAF27468.1| Terminase large subunit protein [Bartonella henselae str.
           Houston-1]
 gi|49238301|emb|CAF27516.1| Terminase large subunit protein [Bartonella henselae str.
           Houston-1]
          Length = 340

 Score = 84.4 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 73/242 (30%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  PL+  +P+   +  +++   + 
Sbjct: 86  LCWVDEAEPVTETAWQTLIPTLREEGEGWRAELWVTWNPLRDNAPVERRFRFSNNEAIKR 145

Query: 72  IRMTINETPHYNEQERKRIIDS--YPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +  ++ P + +   +  +D         +   +G  +      +          E  I
Sbjct: 146 VEINWSDNPKFPKILNEARLDDLKNRPETYKHIWEGAYLTAIQGAYYQKEMLAAEQEGRI 205

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
              + D          +        A    +       I V+  Y  + Q    H+  L+
Sbjct: 206 GRVARDPLMQMRAFWDIGGTGAKADATAIWIAQFVGREIRVLDYYEAQGQPLSEHIGWLR 265

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +     G +          G+  V+  I  +  
Sbjct: 266 RNGYEKALMVLPHDGATKDRVHNVSFESALNDAGFETQVIPH---QGAGAVKMRIEAVRR 322

Query: 242 RM 243
            +
Sbjct: 323 IL 324


>gi|257468179|ref|ZP_05632275.1| putative terminase large subunit - phage associated protein
           [Fusobacterium ulcerans ATCC 49185]
 gi|317062464|ref|ZP_07926949.1| terminase large subunit G2p [Fusobacterium ulcerans ATCC 49185]
 gi|313688140|gb|EFS24975.1| terminase large subunit G2p [Fusobacterium ulcerans ATCC 49185]
          Length = 429

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/202 (13%), Positives = 68/202 (33%), Gaps = 18/202 (8%)

Query: 45  TLTLTPLK-GRSPIIEHYLSASSS-DRQVIRMTINETPHYNEQERKRIIDSYPLHE--RE 100
             +  P +  +  + + Y  ++   +  V   T  + P+ + + ++    +         
Sbjct: 171 FFSYNPPREKQHWVNQKYSFSTKPQNTFVHHSTYLDNPYISTEFKEDAQATKEKDPTTYR 230

Query: 101 ARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSD 159
               GE ++G G I         I   +I        G+D+G+   P A G   W+    
Sbjct: 231 GEFLGE-VVGQGIIPFPNLILRKITDQEIRSFDNFRNGIDWGYGVDPVAFGRWHWDSMRR 289

Query: 160 VIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKML 219
           ++Y V  +   +++       +             + +  D    + ++   R  G++ +
Sbjct: 290 ILYAVDEFYGIQKSNRELATYINKKKYR-------EIITCDSAEPKSIAE-MRSYGVRAV 341

Query: 220 PECATFDDGSNGVEAGISDMLD 241
               +   G   VE G   + +
Sbjct: 342 ----SAKKGKGSVEYGEKWLSE 359


>gi|255590727|ref|XP_002535346.1| conserved hypothetical protein [Ricinus communis]
 gi|223523385|gb|EEF27037.1| conserved hypothetical protein [Ricinus communis]
          Length = 799

 Score = 84.1 bits (206), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/224 (12%), Positives = 63/224 (28%), Gaps = 16/224 (7%)

Query: 30  YFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKR 89
           +     R       +  ++ P     P+   ++    ++ ++I +  +  P +N      
Sbjct: 368 WTCSCRRSGKETSEIWFSMNPELDTDPVYTTFIQKRPANARIIEVNWDRNPFWNAAMEAE 427

Query: 90  IIDS--YPLHEREARTKGEPILGS-GRIFPIVEEDIVINSLDIPEHWVQIGGMD----FG 142
            + S      + +   +G P     G I+      I   +   P     + G       G
Sbjct: 428 RLRSKADDPDDYDHIWEGIPRSAVAGAIYRREMHVIATENRIRPLLADPVLGTHAVFDLG 487

Query: 143 WHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAW-PHDGLQHDK 201
                +      +     +               +   L   G      W PHDG     
Sbjct: 488 IDDKMSITISQADISGLRVVGFHE--DNNYAVEHYCEWLTDNGWKNSVIWLPHDGNARSV 545

Query: 202 RSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRS 245
           ++G        + G ++            GVE GI  +   +++
Sbjct: 546 QTGLTTKQTVEKLGWQVETVP------DIGVEPGIKMVRTALKN 583


>gi|71065561|ref|YP_264288.1| PBSX family phage terminase large subunit [Psychrobacter arcticus
           273-4]
 gi|71038546|gb|AAZ18854.1| phage terminase, large subunit, PBSX family [Psychrobacter arcticus
           273-4]
          Length = 421

 Score = 84.1 bits (206), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 71/239 (29%), Gaps = 18/239 (7%)

Query: 7   GRDKWQSNT-VHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
             D  +  + +   W DE     E  + + L  +      V +T  P    S   + +  
Sbjct: 120 NLDSIKGKSRILLAWVDEAENVSEAAWRKLLPTVREDDSEVWITWNPENKGSATDKRFRQ 179

Query: 64  ASSSDRQVIRMTINETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
                  ++ M  N+ P +    EQER    ++          +G  +  S       + 
Sbjct: 180 VEHE--FIVEMNHNDNPFFPDVLEQERLNDQENLDDATYRWIWEGAYLEASDAQIFNGKF 237

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            +         +    G        P  A +        ++Y+                 
Sbjct: 238 VVREFERHPTWNGPYNGLDFGFSTDPTGATNSW--ESDGILYIEYEACKVGLEIDDTPDY 295

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
           LK     +P    ++ L  D    E +S   +R G+   P+      G   VE GI+ +
Sbjct: 296 LKD---NIPGIEKYE-LIADNARPESIS-YLKRNGI---PKIKACVKGKGSVEDGIAHL 346


>gi|240850562|ref|YP_002971962.1| phage terminase, large subunit [Bartonella grahamii as4aup]
 gi|240267685|gb|ACS51273.1| phage terminase, large subunit [Bartonella grahamii as4aup]
          Length = 441

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 75/242 (30%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  PL+  +P+ + +  + +   + 
Sbjct: 125 LCWVDEAEPVTETAWQTLIPTLREEGEGWRAELWVTWNPLRENAPVEKRFRFSDNEAIKR 184

Query: 72  IRMTINETPHYNEQERKRIIDS--YPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +  ++ P + +   +  +D         +   +G+ +      +          E  I
Sbjct: 185 VEINWSDNPKFPKILNEARLDDLRNRPETYKHIWEGDYLKAVQGAYYQKEMLAAEQEGRI 244

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
              + D          +        A    +       I V+  Y  + Q    H+  L+
Sbjct: 245 GRVARDPLMQIRAFWDIGGTGAKADATAIWIAQFVGREIRVLNYYEAQGQPLSEHIGWLR 304

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +     G +        + G+  V+  I  +  
Sbjct: 305 QNGYEKALMVLPHDGATRDRVHNVSFESALNDAGFETQ---VIPNQGAGAVKMRIEAVRR 361

Query: 242 RM 243
            +
Sbjct: 362 IL 363


>gi|49475696|ref|YP_033737.1| Phage related protein [Bartonella henselae str. Houston-1]
 gi|49238503|emb|CAF27734.1| Phage related protein [Bartonella henselae str. Houston-1]
          Length = 441

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 73/242 (30%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  PL+  +P+   +  +++   + 
Sbjct: 125 LCWVDEAEPVTETAWQTLIPTLREEGEGWRAELWVTWNPLRDNAPVERRFRFSNNEAIKR 184

Query: 72  IRMTINETPHYNEQERKRIIDS--YPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +  ++ P + +   +  +D         +   +G  +      +          E  I
Sbjct: 185 VEINWSDNPKFPKILNEARLDDLKNRPETYKHIWEGAYLTAVQGAYYQKEMLAAEQEGRI 244

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
              + D          +        A    +       I V+  Y  + Q    H+  L+
Sbjct: 245 GRVARDPLMQMRAFWDIGGTGAKADATAIWIAQFVGREIRVLDYYEAQGQPLSEHIGWLR 304

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +     G +          G+  V+  I  +  
Sbjct: 305 RNGYEKALMVLPHDGATRDRVHNVSFESALNDAGFETQVIPH---QGAGAVKMRIEAVRR 361

Query: 242 RM 243
            +
Sbjct: 362 IL 363


>gi|319646329|ref|ZP_08000559.1| phage terminase [Bacillus sp. BT1B_CT2]
 gi|317392079|gb|EFV72876.1| phage terminase [Bacillus sp. BT1B_CT2]
          Length = 425

 Score = 83.3 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 76/237 (32%), Gaps = 38/237 (16%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINAT--QGLVTLTLTPLKGRSPIIEHYLSAS------ 65
           V  VW +E  E   D + E L R+     +  + L+  P+   +   +H+          
Sbjct: 116 VSIVWVEECSEVKYDGFKELLGRLRHPTLKLHMILSTNPVSKGNWSYKHFFKDEANQFFV 175

Query: 66  -------------SSDRQVIRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILG 110
                         ++      T ++     E   +++ D  S+         KG   + 
Sbjct: 176 LDDDELYKKKTIIKNNTYYHHSTADDNLFLPESYIEQLEDLKSHDPDLYRIARKGRFGVN 235

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIG---GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
              + P  E       ++      +     GMDFG+     A   +  + +  ++Y+   
Sbjct: 236 GKLVLPQFEVMEHEKVMNSIRAIDRPILKNGMDFGFVDSYNALVRMAIDHNQKILYIYWQ 295

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       LK   + L        ++ D    + +   +R+QG +M     
Sbjct: 296 YYKNDTTDDKTAEDLKDLKRVL--------IKADSAEPKTIR-FFRQQGFRMKAAKK 343


>gi|52785229|ref|YP_091058.1| hypothetical protein BLi01464 [Bacillus licheniformis ATCC 14580]
 gi|52347731|gb|AAU40365.1| putative protein [Bacillus licheniformis ATCC 14580]
          Length = 425

 Score = 83.3 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 76/237 (32%), Gaps = 38/237 (16%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINAT--QGLVTLTLTPLKGRSPIIEHYLSAS------ 65
           V  VW +E  E   D + E L R+     +  + L+  P+   +   +H+          
Sbjct: 116 VSIVWVEECSEVKYDGFKELLGRLRHPTLKLHMILSTNPVSKGNWSYKHFFKDEANQFFV 175

Query: 66  -------------SSDRQVIRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILG 110
                         ++      T ++     E   +++ D  S+         KG   + 
Sbjct: 176 LDDDELYKKKTIIKNNTYYHHSTADDNLFLPESYIEQLEDLKSHDPDLYRIARKGRFGVN 235

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIG---GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
              + P  E       ++      +     GMDFG+     A   +  + +  ++Y+   
Sbjct: 236 GKLVLPQFEVMEHEKVMNAIRAIDRPILKNGMDFGFVDSYNALVRMAIDHNQKILYIYWQ 295

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       LK   + L        ++ D    + +   +R+QG +M     
Sbjct: 296 YYKNDTTDDKTAEDLKDLKRVL--------IKADSAEPKTIR-FFRQQGFRMKAAKK 343


>gi|52079856|ref|YP_078647.1| Phage terminase, large subunit [Bacillus licheniformis ATCC 14580]
 gi|52003067|gb|AAU23009.1| Phage terminase, large subunit [Bacillus licheniformis ATCC 14580]
          Length = 424

 Score = 83.3 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 76/237 (32%), Gaps = 38/237 (16%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINAT--QGLVTLTLTPLKGRSPIIEHYLSAS------ 65
           V  VW +E  E   D + E L R+     +  + L+  P+   +   +H+          
Sbjct: 115 VSIVWVEECSEVKYDGFKELLGRLRHPTLKLHMILSTNPVSKGNWSYKHFFKDEANQFFV 174

Query: 66  -------------SSDRQVIRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILG 110
                         ++      T ++     E   +++ D  S+         KG   + 
Sbjct: 175 LDDDELYKKKTIIKNNTYYHHSTADDNLFLPESYIEQLEDLKSHDPDLYRIARKGRFGVN 234

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIG---GMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
              + P  E       ++      +     GMDFG+     A   +  + +  ++Y+   
Sbjct: 235 GKLVLPQFEVMEHEKVMNAIRAIDRPILKNGMDFGFVDSYNALVRMAIDHNQKILYIYWQ 294

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       LK   + L        ++ D    + +   +R+QG +M     
Sbjct: 295 YYKNDTTDDKTAEDLKDLKRVL--------IKADSAEPKTIR-FFRQQGFRMKAAKK 342


>gi|254240165|ref|ZP_04933487.1| hypothetical protein PA2G_00806 [Pseudomonas aeruginosa 2192]
 gi|126193543|gb|EAZ57606.1| hypothetical protein PA2G_00806 [Pseudomonas aeruginosa 2192]
          Length = 342

 Score = 83.3 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/200 (15%), Positives = 62/200 (31%), Gaps = 14/200 (7%)

Query: 7   GRDKWQSNTVHYVWFDEEPPE--DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
               ++   V  VW +E        +   +  I      + LTL P          + +A
Sbjct: 116 SIKSFEG--VDIVWVEEAQGVCKKSWDVLIPTIRKDGSEIWLTLNPAMDTDDTYVRFCAA 173

Query: 65  SSSDRQVIRMTINETPHYNE---QERKRIIDSYPLHEREARTKGEP-ILGSGRIFPIVEE 120
              D  +  +   + P + +   QER R   S    + E   +G+P  +  G I+     
Sbjct: 174 PDDDVWLCEINWRDNPWFPDVLNQERLRAKRSMSQEDYEHIWEGKPRTVAEGAIYRHEIL 233

Query: 121 DIVI----NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
           D++       +            D GW+   A       R    + ++       +T  +
Sbjct: 234 DLMESGRVRPVPYDPLLPVHTVWDLGWND--AMTIGFVQRGPMDVRIIDYIEDSHRTLDW 291

Query: 177 HVAALKSWGKWLPWAWPHDG 196
           +VA ++         +    
Sbjct: 292 YVAQIEKRSYRWGIDYLAAR 311


>gi|163868206|ref|YP_001609414.1| phage related protein [Bartonella tribocorum CIP 105476]
 gi|163869068|ref|YP_001610302.1| hypothetical protein Btr_2286 [Bartonella tribocorum CIP 105476]
 gi|161017861|emb|CAK01419.1| phage related protein [Bartonella tribocorum CIP 105476]
 gi|161018749|emb|CAK02307.1| phage-related protein [Bartonella tribocorum CIP 105476]
          Length = 442

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 73/242 (30%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQG-----LVTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  PL+  +P+   +  + +   + 
Sbjct: 125 LCWVDEAEPVTETAWQTLIPTLREEGDGWRAELWVTWNPLRDNAPVESRFRFSDNEAIKR 184

Query: 72  IRMTINETPHYNEQERKRIIDS--YPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +  ++ P + +   +  +D         +   +G  +      +          E  I
Sbjct: 185 VEINWSDNPKFPKILNEARLDDLRNRPETYKHIWEGAYLTAVQGAYYQKEMLAAEQEGRI 244

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
              + D          +        A    +       I V+  Y  + Q    H+  L+
Sbjct: 245 GRVARDPLMQIRAFWDIGGTGAKADATAIWIAQFVGREIRVLDYYEAQGQPLSEHIGWLR 304

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +     G +        + G+  V+  I  +  
Sbjct: 305 HNGYEKALMVLPHDGATRDRVHNVSFESALNDAGFETQ---VIPNQGAGAVKMRIEAVRR 361

Query: 242 RM 243
            +
Sbjct: 362 IL 363


>gi|183600815|ref|ZP_02962308.1| hypothetical protein PROSTU_04416 [Providencia stuartii ATCC 25827]
 gi|188019600|gb|EDU57640.1| hypothetical protein PROSTU_04416 [Providencia stuartii ATCC 25827]
          Length = 413

 Score = 82.9 bits (203), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 34/229 (14%), Positives = 72/229 (31%), Gaps = 17/229 (7%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      + +T  P K  S   + +      +  ++ M 
Sbjct: 126 IAWVDEAESVSEIAWTKLAPTVREAGSEIWVTWNPEKDGSATDKRFRKEPPDNAIIVEMN 185

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    E+ER         +      +G  +  S +     +  +     D+ + 
Sbjct: 186 YDDNPWFPSVLEEERLSDQSRLDPNTYAWIWEGAYLENSDKQVLANKYVVQSFPDDLWKQ 245

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
             + + G DFG+         ++  D D +Y+ +             A      +   W 
Sbjct: 246 ADRLLFGADFGFAKDPNTLIRMFILD-DCLYIEREAYGVGVELDHMPAFYDEIPEARKW- 303

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                ++ D    E +S   +RQG  +             VE GI+ + 
Sbjct: 304 ----PIKADSARPETIS-YLKRQGFNISAA----KKWQGSVEDGITYLR 343


>gi|313499430|gb|ADR60796.1| P-loop protein [Pseudomonas putida BIRD-1]
          Length = 374

 Score = 82.9 bits (203), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/256 (12%), Positives = 72/256 (28%), Gaps = 27/256 (10%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINA------------TQGLVTLTLTPLK 52
             D  + + + +V  DE  +     + E L  + +             +G   L +   K
Sbjct: 124 NYDNLRGSGLFFVLVDEWADCSWAAWEEVLRPMLSTCQYTIPQTGESRKGGHALRIGTPK 183

Query: 53  GRSPIIEHYLSASS---SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPIL 109
           G +   + Y         D +  + T  +  +    E                 +     
Sbjct: 184 GFNHCYDTYRDGQPGGEPDHKSWQYTSLQGGNVPAVELDAARRKMDPRTFRQEYEAGFEN 243

Query: 110 GSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRC 169
            +G ++   +      S  I        GMDF      A  ++V +    +   +  +  
Sbjct: 244 YAGVVYSTFDRAECHTSERIKPGEAIHIGMDFNVMKMAAVVYVVRD---GLPLALDEFHS 300

Query: 170 REQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPECATFDD 227
              TP         +       +P    Q+     + E   +  ++ G  ++ +      
Sbjct: 301 VRDTPDMIEKIKVRFSGHSVSVYPDASGQNTSSKNASESDLSLLKKAGFTVVVDSKNP-- 358

Query: 228 GSNGVEAGISDMLDRM 243
              GV+  I+ +    
Sbjct: 359 ---GVKDRINAVNAMF 371


>gi|153955889|ref|YP_001396654.1| hypothetical protein CKL_3280 [Clostridium kluyveri DSM 555]
 gi|219856242|ref|YP_002473364.1| hypothetical protein CKR_2899 [Clostridium kluyveri NBRC 12016]
 gi|146348747|gb|EDK35283.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
 gi|219569966|dbj|BAH07950.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 450

 Score = 82.9 bits (203), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/237 (12%), Positives = 71/237 (29%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQG--LVTLTLTPLKGRSPIIEHYLSASSS---- 67
           V  VW +E  E   + + E L R+        + L+  P+   +   +H+          
Sbjct: 117 VSIVWIEECSEVKYEGFKELLGRLRHPSLSLHMILSTNPVSKDNWTYKHFFKNEKKKTFI 176

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRIIDS--YPLHEREARTKGEPILG 110
                          +        ++     +   +++ +   Y +       KG   + 
Sbjct: 177 LDDEELYKKRIVVRNNTYYHHSLADDNLFLPKSYIEQLEELKTYDIDLYRIARKGRFGIN 236

Query: 111 SGRIFPIVEEDIVINSLD---IPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             R+ P  E       L      ++ ++  G DFG+     A   L  +    ++Y+   
Sbjct: 237 GRRVLPQFEARPHYEVLQAIGNIKNPIKRVGFDFGFEDSYNALLRLAVDDKEKILYIYWE 296

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       +  +          + ++ D    + +   + +QG  +     
Sbjct: 297 YYKNQMTDDRTAIEIAEFKS------TQELIRADGAEPKTIK-YFNQQGFNIRRAKK 346


>gi|326336497|ref|ZP_08202667.1| terminase large subunit protein [Capnocytophaga sp. oral taxon 338
           str. F0234]
 gi|325691370|gb|EGD33339.1| terminase large subunit protein [Capnocytophaga sp. oral taxon 338
           str. F0234]
          Length = 390

 Score = 82.5 bits (202), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 28/245 (11%), Positives = 63/245 (25%), Gaps = 28/245 (11%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGR-SPI 57
             + +    K +      ++ +E  E     + +   R         +   P       +
Sbjct: 103 FFSTD-SEQKLRGRKRDVLYVNEANELKFIEFQQLKMRTTQ---FTIVDYNPSFSNDHWL 158

Query: 58  IEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPI 117
            E               T  + P   +     I      +    +  G            
Sbjct: 159 CEL---NKDPRTYHFISTYKDNPFLEQTVIDEIESLQHKNRSLWQVYGLGQQAMIEGLIF 215

Query: 118 VEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
            +  IV       +   +  G+DFG+   P A   +      + +Y+ +     +     
Sbjct: 216 EKVTIVEEIPIWAK--KRYLGLDFGFTHDPTAIVEVA--FLDNKVYIDEICYQTQMLTTD 271

Query: 177 HVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGI 236
            + AL+     +                 +L  + +  G  +         G   V  G+
Sbjct: 272 IIEALR--PYRIYKIISESA-------DPRLVKEIKNAGYNIT----AVTKGHGSVMEGL 318

Query: 237 SDMLD 241
           + ML+
Sbjct: 319 TKMLE 323


>gi|226949592|ref|YP_002804683.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           A2 str. Kyoto]
 gi|226841691|gb|ACO84357.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           A2 str. Kyoto]
          Length = 451

 Score = 82.1 bits (201), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 29/237 (12%), Positives = 78/237 (32%), Gaps = 36/237 (15%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINAT--QGLVTLTLTPLKGRSPIIEHYLSASSS---- 67
           V  +W +E  E     + E L R+     +  + L+  P+   +   +H+   +      
Sbjct: 117 VSIIWIEECSEVKYAGFKELLGRLRHPTLELHMILSTNPVSKNNWCYKHFFMDTKKKIFI 176

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILG 110
                          +        ++     +   +++  + +Y +       +G   + 
Sbjct: 177 LDDKELYKNRIIIKNNTYYHHSLADDNLFLPKTYIEQLDELKTYDIDLYRIARRGRFGVN 236

Query: 111 SGRIFPIVEEDIVINS---LDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             ++ P  E+         +   ++ +   GMDFG+     A   L  + ++ ++Y+   
Sbjct: 237 GRKVLPQFEKKPHYEVLQAIQNIKNSIYRVGMDFGFETSYNAIVRLAIDDENKILYIYWQ 296

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
           Y   + T       +  + K        + ++ D    + +   Y+++G  M     
Sbjct: 297 YYKNQMTDDKTAIEIAEFKK------TQELIRSDSAEPKTIK-YYKQEGFNMRGAKK 346


>gi|183598507|ref|ZP_02960000.1| hypothetical protein PROSTU_01901 [Providencia stuartii ATCC 25827]
 gi|188020684|gb|EDU58724.1| hypothetical protein PROSTU_01901 [Providencia stuartii ATCC 25827]
          Length = 411

 Score = 81.7 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 36/229 (15%), Positives = 72/229 (31%), Gaps = 17/229 (7%)

Query: 18  YVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE     E  + +    +      + +T  P K  S   + +      +  V+ M 
Sbjct: 126 IAWVDEAESVSETAWTKLTPTVREAGSEIWVTWNPEKDGSATDKRFRKKQPDNAIVVEMN 185

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    E+ER                +G  +  S +     +  +     D+ + 
Sbjct: 186 YDDNPWFPSVLEEERLNDQARLDAATYAWIWEGAYLENSDKQVLANKYVVQSFPDDLWKK 245

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
             + + G DFG+         ++  D D +Y+ +             A      +   W 
Sbjct: 246 ADRLLFGADFGFAKDLNTLIRMFILD-DCLYIEREAYGVGVELDHMPAFYDEIPEARKW- 303

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                ++ D    E +S   +RQG  +             VE GI+ + 
Sbjct: 304 ----PIKADSARPETIS-YLKRQGFNISAA----KKWQGSVEDGITYLR 343


>gi|284164527|ref|YP_003402806.1| hypothetical protein Htur_1243 [Haloterrigena turkmenica DSM 5511]
 gi|284014182|gb|ADB60133.1| hypothetical protein Htur_1243 [Haloterrigena turkmenica DSM 5511]
          Length = 514

 Score = 81.7 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 39/258 (15%), Positives = 85/258 (32%), Gaps = 34/258 (13%)

Query: 7   GRDKWQSNTVHYVWFDEEPPE-----DVYFEGLTRINATQGLV--TLTLTPLKGRSPIIE 59
             +++  +    +W DE         D+      R+    G      TLT          
Sbjct: 177 SWNRYAGDEFGAIWLDEPSHYETDLHDLLEMLGGRLRGVAGPKVQCWTLTGNGYNDAWEI 236

Query: 60  HYLSASSSD------RQVIRMTINETPHYNEQERKRIIDSYPLHERE-ARTKGEPILGSG 112
                 S+        +++R +  + P+ +   R+R    +   +RE    +G      G
Sbjct: 237 LEQRQDSTGDPIGLAIELVRASTLDNPYLDAGTRERYERQFGDTDREAQALRGGFAAAQG 296

Query: 113 RIFPIVEEDIVINSL----DIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR 168
            ++     D  +       D      ++ G D GW+ P     +      D + V+  + 
Sbjct: 297 LVYTKFSRDTHVIPHAAATDRVIADWRVYGYDHGWNDPRILLEVGKTP-RDQLVVLDEFY 355

Query: 169 CREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
             E      +A L++ GK     +      H+         ++RR G +        +  
Sbjct: 356 ESESHVEDAIAWLEATGKPSGSVYCD----HEPGH----IDKFRRAGYR-------AEAA 400

Query: 229 SNGVEAGISDMLDRMRSG 246
           +  ++ GI+++  R+ + 
Sbjct: 401 TKDIDEGIAEVRKRLEAD 418


>gi|37526791|ref|NP_930135.1| hypothetical protein plu2901 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36786223|emb|CAE15275.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 409

 Score = 81.7 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/230 (13%), Positives = 72/230 (31%), Gaps = 19/230 (8%)

Query: 18  YVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE     E  + +    +  +   + +T  P K  S   +           ++ M 
Sbjct: 127 LAWIDEAESVSETAWKKLRPTVRESGSEIWVTWNPEKDGSATDKRLRKKPPKSSIIVEMN 186

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    E+ER+  ++S    +     +G  +  S +     +  I     D+   
Sbjct: 187 YSDNPWFPDVLEEERQEDLESLDHSDYAWIWEGAYLENSEKQVLANKYKIESFPDDLWMQ 246

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
             + + G DFG+    +    ++  D+  +Y+ +               L     +    
Sbjct: 247 ADRLLFGADFGFARDPSTLLRMFILDN-CLYIDREAYSVGV-------ELDHMPAFYDQV 298

Query: 192 WPHDGL-QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                       +  +  +  +RQG  +             VE GI+ + 
Sbjct: 299 PESRKWPIKADSARPETISYLKRQGFNISAA----KKWQGSVEDGITFLR 344


>gi|331091430|ref|ZP_08340268.1| PBSX family phage terminase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330403986|gb|EGG83536.1| PBSX family phage terminase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 441

 Score = 81.7 bits (200), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 31/279 (11%), Positives = 72/279 (25%), Gaps = 40/279 (14%)

Query: 10  KWQSNTVHYVWFDEEPPE--DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K Q  ++ Y + DE      +V+    +R++        +  P      + + +L     
Sbjct: 108 KIQGASIKYCYGDEVAKWNKEVFQMLKSRLDKPYSCFDGSCNPEHPTHWL-KEFLDNDEL 166

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPLH-EREARTKGEPILGSGRIFPIVEEDIVINS 126
           D  + R TI + P   E+  +++   Y      +    G      G I+    ++     
Sbjct: 167 DIYLQRYTIFDNPFLPEEFVQQLCKEYEGTIYYDRLILGLWKRAEGAIYKRFADNPDKFR 226

Query: 127 LDIPEHWVQIGGM----------------DFGWHHPFAAGHLVWNRDSDVIYVVK----- 165
            ++ +       +                  G     +     +  D   +  +K     
Sbjct: 227 CEVVDELTMETDIKQFRKDDIVSIEIGLDFGGNQSGHSFVARGYTDDYREVIALKSKRIM 286

Query: 166 -----NYRCREQTPIFHVAALKSWGKWLPWAWPH---------DGLQHDKRSGEQLSAQY 211
                               ++                     + + +D      L    
Sbjct: 287 AKDENEDIDSNTLDRLFCEFVQEVIDKYAVIVRRGDYVEYCNVESVYYDNAETV-LGNSI 345

Query: 212 RRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
           R    K  P  +        +   I   +  M +GR+ +
Sbjct: 346 RNAVEKKYPWVSVRKAKKKTINDRIRCTVKLMGAGRFFI 384


>gi|313116026|ref|ZP_07801450.1| phage terminase, large subunit, PBSX family [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310621623|gb|EFQ05154.1| phage terminase, large subunit, PBSX family [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 424

 Score = 81.7 bits (200), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 39/265 (14%), Positives = 76/265 (28%), Gaps = 33/265 (12%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRI-NATQGLVTLTLTPLKGRSPII----- 58
                + NT    +  E  E  E    E   R  ++    V   L P             
Sbjct: 116 DEKLIKGNTYGTAYITEANECSETFIKEVFDRTLSSPDRKVFHDLNPKAEGHWYYENILN 175

Query: 59  ---EHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPL--HEREARTKGEPILGSGR 113
              +               TI +    ++ + + ++ +Y            G+     G 
Sbjct: 176 LHEKKQNENPEYGFNYGHFTIADNMSISDDQLRAVLATYDRSTVWYARDILGKRKAAEGL 235

Query: 114 IFPIV---EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR 170
           ++P     ++  + +             +D+G H+P + G  V + D   + + ++Y   
Sbjct: 236 VYPFFSAGQDTYLFHGDASHIDGQFYVSIDYGTHNPCSMGLWVIH-DGKALRIKESYFDS 294

Query: 171 -----EQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATF 225
                ++T   H A L+   K                S        RR G  +       
Sbjct: 295 RAERVQRTDEEHYAELERLTKGYYIQAVVV-----DPSAASFIETIRRHGKYL------V 343

Query: 226 DDGSNGVEAGISDMLDRMRSGRWKV 250
               N V  GI  +   M++G   +
Sbjct: 344 IPADNDVLNGIRCVASLMQAGLVTI 368


>gi|126015320|gb|ABN70691.1| terminase [Salmonella phage SETP7]
 gi|126015322|gb|ABN70692.1| terminase [Salmonella phage SETP11]
          Length = 423

 Score = 81.7 bits (200), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 38/251 (15%), Positives = 74/251 (29%), Gaps = 29/251 (11%)

Query: 21  FDEEPPED------VYFEGL----------TRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
            DE    +       + + +            I           T  +G   + + ++  
Sbjct: 122 IDELDTLNKDHAEHAWNKVIARNRQLPRTYRPITPKPANTVSVFTTPEGFRFVHDRWVVK 181

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI-LGSGRIFPIVEEDIV 123
            +   ++I+      P   E   + + D+YP    +A   GE + L SG ++   +    
Sbjct: 182 KNPGYEMIQAPTTSNPFLPEDYVQSLRDTYPGQLIDAYIDGEFVNLTSGSVYYAYDRRKN 241

Query: 124 INSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPI---FHVAA 180
            +   I        G DF   H  +    V+ +   V + V        TP         
Sbjct: 242 SSRETIQPGETLYIGQDFNVGHMAS---TVYVQREYVWHAVAELVDMFDTPDVVREITER 298

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSG-EQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
            K  G  +       G             AQ +  G ++  +          V+  ++ +
Sbjct: 299 WKRNGHHIVMYPDASGKNRKSTDASTSDIAQLQNAGFEIRAKSVNP-----AVKDRVASV 353

Query: 240 LDRMRSGRWKV 250
              + SGR  V
Sbjct: 354 NKALESGRLMV 364


>gi|266622260|ref|ZP_06115195.1| phage terminase, large subunit, PBSX family [Clostridium hathewayi
           DSM 13479]
 gi|288866024|gb|EFC98322.1| phage terminase, large subunit, PBSX family [Clostridium hathewayi
           DSM 13479]
          Length = 373

 Score = 81.4 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/257 (12%), Positives = 68/257 (26%), Gaps = 30/257 (11%)

Query: 1   LKAYEQGRDKWQSNT-----VHYVWFDEEPPED------VYFEGLTRINATQGLVTLTLT 49
            +  +    K +S         Y+WF+E    D         + L R    Q  V  +  
Sbjct: 60  FRGAD-DPQKIKSVKLANGYFKYIWFEERAEFDGDSEERTILQSLMR-GGPQYFVFYSWN 117

Query: 50  PLKGRSPIIEHYLSASSSDRQVIRMTINET---PHYNEQERK-RIIDSYPLHEREARTKG 105
           P K  +  +   +  S  +  V              ++   +   +        E    G
Sbjct: 118 PPKSMNSWVNQDILQSKENAIVHHSDYRTVPKEWLGDDFFIEAEDLKETKPKAYEHEYLG 177

Query: 106 EPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFG-WHHPFAAGHLVWNRDSDVIYVV 164
               G+G           I   ++        G+DFG    P A   + ++R    +++ 
Sbjct: 178 I-ATGTGGQVFENVTVRPITEEEMARFDRIYQGLDFGFGADPAAYIKMHYDRTRKRLFLF 236

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                           +K +                     +        G++++     
Sbjct: 237 GEIYAPRLGNTKLADQIKKYNPLNRVVTADS-------EDPRAIDALNELGLRVVGAR-- 287

Query: 225 FDDGSNGVEAGISDMLD 241
              G   V+ G+  + D
Sbjct: 288 --KGPGSVDFGMEFLAD 302


>gi|261368738|ref|ZP_05981621.1| phage terminase, large subunit, PBSX family [Subdoligranulum
           variabile DSM 15176]
 gi|282569160|gb|EFB74695.1| phage terminase, large subunit, PBSX family [Subdoligranulum
           variabile DSM 15176]
          Length = 417

 Score = 81.4 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/240 (11%), Positives = 62/240 (25%), Gaps = 25/240 (10%)

Query: 15  TVHYVWFDEEPPE-------DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
            +  +WF+E               +   R     GL  ++  P          Y      
Sbjct: 133 YIGVLWFEEADQIKGGEDAVRNVQQSALR-GGEFGLTFISFNPPSAARNWANKYALVQRP 191

Query: 68  DRQVIRMTINETP--HYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFPIVEEDIV 123
            ++V   +  E P      +   +          +      GE  +G+G           
Sbjct: 192 GKRVHHSSYLEAPPEWLGPKFLAQAEYIKETKPTKYRHEYLGE-AVGNGTQVFDNIRLEE 250

Query: 124 INSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
           +++  I      + G+D+GW+  P+A     ++  +  +Y+       +         + 
Sbjct: 251 LSAKRIRSFGDALNGVDWGWYPDPWAFNRCAYDAHARTLYIFDELTRLKTNNQDTAKLVM 310

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
              +                        YR  G++          G   V   +  +   
Sbjct: 311 QRIEGWETVTADSAEPKSCGD-------YRDAGIRCREA----VKGPGSVTESMKWLQGL 359


>gi|62327323|ref|YP_224036.1| hypothetical protein BPKS7gp16 [Salmonella phage SS3e]
 gi|57472357|gb|AAW51219.1| hypothetical protein [Salmonella phage SS3e]
          Length = 423

 Score = 81.4 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/251 (15%), Positives = 75/251 (29%), Gaps = 29/251 (11%)

Query: 21  FDEEPPED------VYFEGL----------TRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
            DE    +       + + +            I           T  +G   + + +   
Sbjct: 122 IDELDTLNKDHAEHAWNKVIARNRQLPRTYRPITPKPANTVSVFTTPEGFRFVHDRWAVK 181

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI-LGSGRIFPIVEEDIV 123
                ++I+ +    P   E   + + D+YP    +A   GE + L SG ++   +    
Sbjct: 182 KKPGYEMIQASTTSNPFLPEDYVQSLRDTYPGQLIDAYIDGEFVNLTSGSVYYAYDRRKN 241

Query: 124 INSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
            +   I        G DF   H  +    V+ +   V + V        TP       + 
Sbjct: 242 SSRETIQPGETLYIGQDFNVGHMAS---TVYVQREYVWHAVAELVDMFDTPDVVREITER 298

Query: 184 WGKWLPWAWPH---DGLQHDKRSG-EQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
           WG+       +    G             AQ +  G ++  +          V+  ++ +
Sbjct: 299 WGRQGHHIVMYPDASGKNRKSTDASTSDIAQLQNAGFEIRAKSVNP-----AVKDRVASV 353

Query: 240 LDRMRSGRWKV 250
              + SGR  V
Sbjct: 354 NKALESGRLMV 364


>gi|154504704|ref|ZP_02041442.1| hypothetical protein RUMGNA_02211 [Ruminococcus gnavus ATCC 29149]
 gi|153795186|gb|EDN77606.1| hypothetical protein RUMGNA_02211 [Ruminococcus gnavus ATCC 29149]
          Length = 442

 Score = 81.4 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/279 (12%), Positives = 74/279 (26%), Gaps = 40/279 (14%)

Query: 10  KWQSNTVHYVWFDEEPPE--DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K Q  ++ Y + DE      +V+    +R++ T         P      + + ++     
Sbjct: 108 KIQGASIKYCYGDEIAKWNKEVFQMLKSRLDKTYSCFDGACNPEHPTHWL-KEFIDNVEL 166

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPLH-EREARTKGEPILGSGRIFP---------- 116
           D  + + TI + P  + +  K++   Y      +    G      G I+           
Sbjct: 167 DIYLQKYTIFDNPFLDPEFVKQLCKEYDGTIYYDRLILGLWKRADGAIYKRFADNPEAFK 226

Query: 117 -----IVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVV------ 164
                    D         +      G+DFG +    +     +  +   +  +      
Sbjct: 227 CEIVDEFSPDSEYKQFRKEDITSIEIGLDFGGNQSGHSFVARGYTDNYRDVIALKSRRIT 286

Query: 165 ----KNYRCREQTPIFHVAALKSWGKWLPWAWPH---------DGLQHDKRSGEQLSAQY 211
               K      +        ++   +                 + +  D      L    
Sbjct: 287 AKDEKEDIDSNRLNELFCEFIREVIEQYSVCVKSGDYVQYCNVESVFWDNAETV-LGNSI 345

Query: 212 RRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
           R    K  P  A        +   I   +  M +GR+ +
Sbjct: 346 RNAVEKEFPWIAVKPAKKRPINDRIRCTVKLMGAGRFFI 384


>gi|315160135|gb|EFU04152.1| terminase, large subunit domain protein [Enterococcus faecalis
           TX0312]
          Length = 237

 Score = 81.4 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 52/173 (30%), Gaps = 13/173 (7%)

Query: 74  MTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDI---VINSLDIP 130
            T  + P   +   + +  +   + + A  + +       + P     +    I    + 
Sbjct: 1   STYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGKAIGSGVVPFDNLRVIKGCITDEMVA 60

Query: 131 EHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLP 189
                  G+DFG+   P A     +++  + IY +      + +       L   G    
Sbjct: 61  NFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAIDEIYGVKISNRELAKKLHEKG---- 116

Query: 190 WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
             + +D +  D    +  +      G+           G + VE G   + D 
Sbjct: 117 --YQNDEIFSDSAEPKSNAELVNEHGIN---HIKGVKKGPDSVEYGEQWLDDL 164


>gi|319408093|emb|CBI81746.1| phage related protein [Bartonella schoenbuchensis R1]
 gi|319408856|emb|CBI82513.1| phage related protein [Bartonella schoenbuchensis R1]
          Length = 444

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 73/242 (30%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQGL-----VTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  PL+  +P+   +      + + 
Sbjct: 128 LCWVDEAEPVTETAWQTLIPTLREEGEGWRAELWVTWNPLRENAPVERRFRFTKDQNIKG 187

Query: 72  IRMTINETPHYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +  ++ P + ++ ++  +D             +G+ +      +          E  +
Sbjct: 188 VEVNWSDNPLFPQKLQRVRLDDLQNRPESYNHIWEGDYLKAVQGAYFQKEMLAAEQEGRV 247

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
              + D          +        A    +       I V+  Y  + Q    H+  L+
Sbjct: 248 GRVARDPLMPIRAFWDIGGTGAKADATAIWIAQFVGREIRVLDYYEAQGQPLSEHIGWLR 307

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +     G          + G+  V+  I  +  
Sbjct: 308 CNGYDKALMVLPHDGATRDRVYNVSFESALNEAGFDTQ---VVPNQGAGAVKMRIEAVRR 364

Query: 242 RM 243
            +
Sbjct: 365 IL 366


>gi|237737295|ref|ZP_04567776.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421157|gb|EEO36204.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 446

 Score = 80.6 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/279 (10%), Positives = 69/279 (24%), Gaps = 50/279 (17%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEP--PEDVYFEGLTRINATQGLV--TLTLTPLKGRS 55
            K  +    K +S   + Y+  +E      D   E   R+          +   P+   S
Sbjct: 104 FKGMD-DWRKLKSVKNIDYILIEEADELTIDDIKELRKRLRVKNIRCKLIMMCNPVSRGS 162

Query: 56  PIIEHYLSASSSDR-----------------------------QVIRMTINETPHYNEQE 86
            I + + +    +                               +   T  + PH     
Sbjct: 163 SIYKMFFTEQGYNIDENELYEKRLIKFTDKIILENGEILKQVVMIHHSTYKDNPHLPASF 222

Query: 87  RKRIIDSYPLHEREARTKGEPILGSGRIFP---IVEEDIVINSLDIPEHWVQIGGMDFGW 143
              +        +    +G+       +       ++              Q  G+D+G+
Sbjct: 223 IYELESEKDPRLKRIAKEGKFGADGDLVLYNAVFEKQVYEKYIEGKLGKKDQYRGIDWGY 282

Query: 144 H-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR 202
                    +  N   + +Y+   Y  + +        L+   +     +       D  
Sbjct: 283 STSYTCGLKMAVNTKLNELYIYWEYYNKGKLTKELFKELEPLKEGGKVIY------ADSA 336

Query: 203 SGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
           S + ++  +   G  +         G+  VE     +  
Sbjct: 337 SAQTIAD-FYDAGYNIDGA----TKGNGSVEYHEQLLRS 370


>gi|325529303|gb|EGD06247.1| phage terminase, large subunit [Burkholderia sp. TJI49]
          Length = 411

 Score = 80.6 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/240 (13%), Positives = 62/240 (25%), Gaps = 20/240 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPEDVYFEGLTR--INATQGLVTLTLTPLKGRSPIIEHYL-S 63
                +       WF+E          L R  +      +     P K   PI       
Sbjct: 109 SIKSLEG--FDRAWFEEAQNATEKSLTLLRPTLRKPGSQLWFGWNPGKPTDPIDVLLRGD 166

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDS--YPLHEREARTKGEPILGSGRIFPIVEED 121
               D  V+     + P    + ++ +         +      G     S          
Sbjct: 167 EPPPDSIVVEANFMDNPWLPRELQEEMEYDKRRDPDKYAHVWLGGYQQRSEARVFKNWRV 226

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
                 + PE  V   G D+G+    +      + D + +YV           +      
Sbjct: 227 ---EEFERPEGTVFRLGADWGFASDPSVLI-RCDIDGNRLYVDYEAYQVGCEIVNLPELF 282

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
            S  +   W      +  D    E +S   ++ G    P+      G+  +E G+  +  
Sbjct: 283 MSVPEAEKW-----PITADSARPETIS-HMQKHGF---PKIRAAIKGAKSLEEGVEFLKS 333


>gi|319405798|emb|CBI79424.1| phage related protein [Bartonella sp. AR 15-3]
          Length = 441

 Score = 80.6 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 72/242 (29%), Gaps = 19/242 (7%)

Query: 18  YVWFDEEPPE-DVYFEGLTRINATQG-----LVTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             W DE  P  +  ++ L      +G      + +T  PL+  +P+   +  + +   + 
Sbjct: 125 LCWVDEAEPVTETAWQTLIPTLREEGDGWRAELWVTWNPLRENAPVERRFRFSENEGIKG 184

Query: 72  IRMTINETPHYNEQERKRIIDS--YPLHEREARTKGEPILGSGRIFP-------IVEEDI 122
           + +  ++ P + +   +  +D         +   +G  +      +          E  I
Sbjct: 185 VEINWSDNPKFPQILNEARLDDLKNRAESYQHIWEGGYLKAVQGAYFQKEMLAAEQEGRI 244

Query: 123 VINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALK 182
              + D          +        A    +       I V+  Y  + Q    H+  L+
Sbjct: 245 GRVARDPLMQLRAFWDIGGTGAKADATAIWIAQFVGREIRVLDYYEAQGQPLSEHIGWLR 304

Query: 183 SWGK-WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
             G        PHDG   D+       +     G +        + G   V+  I  +  
Sbjct: 305 QNGYEKALMILPHDGATKDRVHNVSFESALNEAGFETQ---VIPNQGPGAVKMRIEAVRR 361

Query: 242 RM 243
            +
Sbjct: 362 IL 363


>gi|157693524|ref|YP_001487986.1| terminase large subunit [Bacillus pumilus SAFR-032]
 gi|157682282|gb|ABV63426.1| terminase large subunit [Bacillus pumilus SAFR-032]
          Length = 437

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/227 (14%), Positives = 70/227 (30%), Gaps = 34/227 (14%)

Query: 24  EPPEDVYFEGLTRINATQGLVTL--TLTPLKGRSPIIEHYLSASS--------------- 66
           E   + + E L R+      + +  +  P+   +    H+                    
Sbjct: 129 EVSYEGFKELLGRLRHPSLPLYMMLSTNPVGQDNWTYRHFFRDEQLKRFVLDDETLYKKR 188

Query: 67  ----SDRQVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILGSGRIFPIVEE 120
                D      T  +     +   K++  +  Y         KG   +   ++FP  E 
Sbjct: 189 TVVIKDTYYHHSTAEDNLFLPKSYVKQLDELKEYDPDLYRIARKGYFGINGTKVFPQFEV 248

Query: 121 DIVINSLDIPEHWVQI---GGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
               + L+  +   +     GMDFG+     A   L  + +   +Y+   Y  R +T   
Sbjct: 249 RNHADVLEAIQQMDRPLKRAGMDFGFVESYNALIRLAVDHEKKYLYIYWEYYNRGKTDDE 308

Query: 177 HVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
               LK +          + ++ D    + +   +R+ G +M+    
Sbjct: 309 TAVDLKEF------IESKELIKADAAEPKTIH-YFRQLGFQMVAAHK 348


>gi|260753099|ref|YP_003225992.1| phage terminase, large subunit, PBSX family [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258552462|gb|ACV75408.1| phage terminase, large subunit, PBSX family [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 428

 Score = 80.2 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/250 (13%), Positives = 65/250 (26%), Gaps = 18/250 (7%)

Query: 7   GRDKWQSNTVHYVWFDEEPPEDVYF-EGLTRINAT-QGLVTLTLTPLKGRSPIIEHYLSA 64
                +  +    W +E         E L     T    +  +  P     P+       
Sbjct: 114 SIKSLEGFSR--AWVEEAQTLSQRSLELLRPTIRTIDSELWFSWNPRFKTDPVDRMLRGE 171

Query: 65  SSS-DRQVIRMTINETPHYNE--QERKRIIDSYPLHEREARTKGEPILGSGRIFP----- 116
           +      V++      P +     + +R   +    +     +G     +   +      
Sbjct: 172 TPPTGAVVVQANWENNPWFPSPLDQERRDCLANDPDKYRHIWEGGYAEITEGAYYAQALA 231

Query: 117 --IVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
               E+ I + + D       +  +        A    +       I  + +Y  + Q  
Sbjct: 232 KARSEKRIAVVAADPLMTLRAVWDIGGTGAKADATAIWIVQYVGREIRFLDHYEAQGQPL 291

Query: 175 IFHVAALKSWGKW-LPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
             H+  L+S          PHDG QHDK +        R  G  +       + G+    
Sbjct: 292 SAHLHWLRSHDYGGALCILPHDGAQHDKIASTTYEGALREAGFSVR---VIPNQGAGAAM 348

Query: 234 AGISDMLDRM 243
             I       
Sbjct: 349 QRIEAARRLF 358


>gi|225419807|ref|ZP_03762110.1| hypothetical protein CLOSTASPAR_06147 [Clostridium asparagiforme
           DSM 15981]
 gi|225041548|gb|EEG51794.1| hypothetical protein CLOSTASPAR_06147 [Clostridium asparagiforme
           DSM 15981]
          Length = 686

 Score = 80.2 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 36/240 (15%), Positives = 71/240 (29%), Gaps = 21/240 (8%)

Query: 15  TVHYVWFDEEPPE------DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            +  +W +E              + + R       +  +  P K  S     Y+      
Sbjct: 402 YIGILWLEELDQFVGPESVRKIEQSVIRGGDV-AYIFKSFNPPKSASNWANKYIKIPKDS 460

Query: 69  RQVIRMTINETP--HYNEQERKRIIDSYPLHEREARTKGEPIL-GSGRIFPIVEEDIVIN 125
           R V   T  + P     +            +      +   +  GSG       +   I 
Sbjct: 461 RLVTESTYLDVPQKWLGKPFLDEAEFLKETNSDAYENEYMGVANGSGGSVFDNVKIREIT 520

Query: 126 SLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
             +I +    + G+D+GW+  P+A     ++     +Y+ + Y C +Q+       L   
Sbjct: 521 DDEIAQFDHVLNGVDWGWYPDPYAFTRSHYDPARHTLYIWQEYTCNKQSNQQTAEKLIEL 580

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
           G        +D +  D    + +   YR  G+   P     + G    E     +     
Sbjct: 581 G-----ISGNDLITCDSAEEKSVGD-YRAYGLLARPA----EKGPGSREYSFKWLQSLRE 630


>gi|241760933|ref|ZP_04759022.1| phage terminase, large subunit, PBSX family [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241374552|gb|EER64013.1| phage terminase, large subunit, PBSX family [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 428

 Score = 80.2 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/250 (13%), Positives = 65/250 (26%), Gaps = 18/250 (7%)

Query: 7   GRDKWQSNTVHYVWFDEEPPEDVYF-EGLTRINAT-QGLVTLTLTPLKGRSPIIEHYLSA 64
                +  +    W +E         E L     T    +  +  P     P+       
Sbjct: 114 SIKSLEGFSR--AWVEEAQTLSQRSLELLRPTIRTIDSELWFSWNPRFKTDPVDRMLRGE 171

Query: 65  SSS-DRQVIRMTINETPHYNE--QERKRIIDSYPLHEREARTKGEPILGSGRIFP----- 116
           +      V++      P +     + +R   +    +     +G     +   +      
Sbjct: 172 TPPTGAVVVQANWENNPWFPSPLDQERRDCLANDPDKYRHIWEGGYAEITEGAYYAQALA 231

Query: 117 --IVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
               E+ I + + D       +  +        A    +       I  + +Y  + Q  
Sbjct: 232 KARSEKRIAVVAADPLMTLRAVWDIGGTGAKADATAIWIVQYVGREIRFLDHYEAQGQPL 291

Query: 175 IFHVAALKSWGKW-LPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
             H+  L+S          PHDG QHDK +        R  G  +       + G+    
Sbjct: 292 SAHLHWLRSHDYGGALCILPHDGAQHDKIASTTYEGALREAGFSVR---VIPNQGAGAAM 348

Query: 234 AGISDMLDRM 243
             I       
Sbjct: 349 QRIEAARRLF 358


>gi|326789924|ref|YP_004307745.1| phage terminase, large subunit, PBSX family [Clostridium
           lentocellum DSM 5427]
 gi|326540688|gb|ADZ82547.1| phage terminase, large subunit, PBSX family [Clostridium
           lentocellum DSM 5427]
          Length = 419

 Score = 79.8 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 39/267 (14%), Positives = 78/267 (29%), Gaps = 38/267 (14%)

Query: 10  KWQSNTVHYVWFDEEPPE--DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K + +++ Y + DE      +V+    +R++         L P      + E     S++
Sbjct: 107 KLRGSSIKYCYGDEVADWSKEVFEMLKSRLDKPYSCFDGALNPQNPTHWLKE--FLDSNA 164

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPL-HEREARTKGEPILGSGRIFPIV-------- 118
           D  +   TI + P  + +  + +   Y      +   KG      G I+           
Sbjct: 165 DIYLQTYTIFDNPFLDPKFVEELCKEYEGTVYYDRYIKGLWKRAEGAIYRKFADNPKAFY 224

Query: 119 -------EEDIVINSLDIPEHWVQIGGMDFGWHH-PFAAGHLVWNRDSDVIYVVKNYRCR 170
                   +DI +  +          G+DFG +    A       R    + ++++ R  
Sbjct: 225 CKIVDHISDDIGVKQILKSSIMEICVGVDFGGNKSGHAFVVTAKTRGYKDLILLRSERHF 284

Query: 171 EQ---------TPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
            +            F    L  +G      W +      +   + +  +Y        P 
Sbjct: 285 GELLSDDLNNLLLEFIAKVLAEYGPIDYVYWDNAETVLGRGIKKAIGDKY--------PS 336

Query: 222 CATFDDGSNGVEAGISDMLDRMRSGRW 248
                     V   I      M S R+
Sbjct: 337 ITVRPAIKETVNDRIRCTTMLMGSARF 363


>gi|315159929|gb|EFU03946.1| terminase, large subunit domain protein [Enterococcus faecalis
           TX0312]
          Length = 227

 Score = 79.8 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 53/173 (30%), Gaps = 13/173 (7%)

Query: 74  MTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDI---VINSLDIP 130
            T  + P   +   + +  +   + + A  + +       + P     +    I      
Sbjct: 1   STYKDNPFIAQAFIEEVNATRAKNPKRAEWEYDGKAIGSGVVPFDNLRVIKGCITDEMAA 60

Query: 131 EHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLP 189
                  G+DFG+   P A     +++  + IY +      + +        KS G    
Sbjct: 61  NFDNIRNGLDFGYATDPLAFVRWHYDKKKNGIYAIDEIYGVKISNREFANKAKSKG---- 116

Query: 190 WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
             +  D +  D    + ++      G   +P       G + VE G   + D 
Sbjct: 117 --YISDRIAADSAEPKSIAELNSEHG---MPRVFGVKKGPDSVEYGEEWLGDL 164


>gi|146328895|ref|YP_001209648.1| phage terminase, large subunit [Dichelobacter nodosus VCS1703A]
 gi|146232365|gb|ABQ13343.1| phage terminase, large subunit [Dichelobacter nodosus VCS1703A]
          Length = 424

 Score = 79.8 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 30/241 (12%), Positives = 67/241 (27%), Gaps = 23/241 (9%)

Query: 16  VHYVWFDEEPPEDVYFEGLTR--INATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
               W +E          L R  I      +  +  P     PI +        +   + 
Sbjct: 119 FDCAWIEEAQSISKRSLSLLRPTIRKQNSEIWASWNPQLKTDPIDQFLRVDCPENSITVA 178

Query: 74  MTINETPHYNEQERKRIIDSYPLHEREA---------RTKGEPILG--SGRIFPIVEEDI 122
           + + + P  +E+  +   D     +R+A           +        S     ++    
Sbjct: 179 VNLRDNPFASEEIWREYRDDRERAKRKAAAGDKNAWGEFEHIWHGAYRSHSAAQVLAGCY 238

Query: 123 VINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
            +    I  HW    G+D+G+   P        +  + V+Y+ +         +     L
Sbjct: 239 RVADFAIEPHWSIYHGVDWGFASDPTVLVRCYLDEAARVLYIAEEAYGEHVETVDVPQLL 298

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
            +      +            +  +L +  R  G  ++            +E G+S +  
Sbjct: 299 STITNSAQYV------IRADDARPELISHCRNHGFPLMRA---AGKWQGSIEDGVSFLRG 349

Query: 242 R 242
            
Sbjct: 350 L 350


>gi|56551275|ref|YP_162114.1| PBSX family phage terminase large subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56542849|gb|AAV89003.1| phage terminase, large subunit, PBSX family [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 428

 Score = 79.8 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/250 (13%), Positives = 65/250 (26%), Gaps = 18/250 (7%)

Query: 7   GRDKWQSNTVHYVWFDEEPPEDVYF-EGLTRINAT-QGLVTLTLTPLKGRSPIIEHYLSA 64
                +  +    W +E         E L     T    +  +  P     P+       
Sbjct: 114 SIKSLEGFSR--AWVEEAQTLSQRSLELLRPTIRTIDSELWFSWNPRFKTDPVDRMLRGE 171

Query: 65  SSS-DRQVIRMTINETPHYNE--QERKRIIDSYPLHEREARTKGEPILGSGRIFP----- 116
           +      V++      P +     + +R   +    +     +G     +   +      
Sbjct: 172 TPPTGAVVVQANWENNPWFPSPLDQERRDCLTNDPDKYRHIWEGGYAEITEGAYYAQALA 231

Query: 117 --IVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
               E+ I + + D       +  +        A    +       I  + +Y  + Q  
Sbjct: 232 KARSEKRIAVVAADPLMTLRAVWDIGGTGAKADATAIWIVQYVGREIRFLDHYEAQGQPL 291

Query: 175 IFHVAALKSWGKW-LPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
             H+  L+S          PHDG QHDK +        R  G  +       + G+    
Sbjct: 292 SAHLHWLRSHDYGGALCILPHDGAQHDKIASTTYEGALREAGFSVR---VIPNQGAGAAM 348

Query: 234 AGISDMLDRM 243
             I       
Sbjct: 349 QRIEAARRLF 358


>gi|86741139|ref|YP_481539.1| putative phage-related terminase large subunit [Frankia sp. CcI3]
 gi|86568001|gb|ABD11810.1| putative phage-related terminase large subunit [Frankia sp. CcI3]
          Length = 240

 Score = 79.4 bits (194), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 58/183 (31%), Gaps = 16/183 (8%)

Query: 78  ETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIG 137
           + P  +    + +   Y         +G  I+  G ++ + +ED ++             
Sbjct: 2   DNPSLSPAYVEALKKEYVGLWYARFVEGRWIMAEGVVYDMWDEDRMVEDEIPSIVRWVGT 61

Query: 138 GMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR-----CREQTPIFHVAALKSWGKWLPWAW 192
           G+D G  +PF A       D  +  V +         R++T   +  AL+ +   +P   
Sbjct: 62  GVDHGQVNPFNAIVGGIGVDRRLHLVAEYRYESKLARRQKTDAEYSMALQEFHAQVPIPG 121

Query: 193 PHDGLQHD-----KRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGR 247
                          S      Q  R G+          +  N V  GI  +   M + R
Sbjct: 122 TSLRGVRPEYICVDPSAASFVTQLYRDGVS------GVMNADNAVLDGIRMVASLMGNDR 175

Query: 248 WKV 250
            +V
Sbjct: 176 LRV 178


>gi|160915221|ref|ZP_02077434.1| hypothetical protein EUBDOL_01229 [Eubacterium dolichum DSM 3991]
 gi|158433020|gb|EDP11309.1| hypothetical protein EUBDOL_01229 [Eubacterium dolichum DSM 3991]
          Length = 444

 Score = 79.4 bits (194), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 38/252 (15%), Positives = 70/252 (27%), Gaps = 29/252 (11%)

Query: 16  VHYVWFDEEPPE----DVYFEGLT------RINATQGLVTLTLTPLKGRSPIIEHYL--S 63
           +  V  DE        +   E L       R N     +     P K     +  +    
Sbjct: 131 IRLVVLDELTEFFDKGEGEDEILNIVATFVRGNDEDFRMMYLYNPPKNPKAPVNEWCRKM 190

Query: 64  ASSSDRQVIRMTINETP--HYNEQERKRIIDSYPLH--EREARTKGEPILGSGRIFPIVE 119
              +D   I     + P      +                     GE +     I+ + +
Sbjct: 191 EQRADCIHIHTDYRDVPMKWLGRKLIDEAEAMKLADFKMYRWIWLGEAVGLDDLIYYMFD 250

Query: 120 EDIVINSLDIPEHWV-QIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT----- 173
           E+  +   +  ++      G+D+G  +P     +  +  +  I  +  Y    +T     
Sbjct: 251 EEHHVRKTNSEDNITLYGVGVDYGQMNPTTYQVVGLDFSNKRIQGLDEYYHCGRTSGRQK 310

Query: 174 -PIFHVAALKSWGKWLPWAWPH-DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
            P  +    K     +   + H         S   L  + +R     L     F D  N 
Sbjct: 311 SPSEYAKDFKDLIDSIYEQYGHKPVFCFIDPSARGLKEEIKR-----LCPEIQFPDVDNS 365

Query: 232 VEAGISDMLDRM 243
           VE GIS +   +
Sbjct: 366 VELGISRVQKLL 377


>gi|291336835|gb|ADD96368.1| phage terminase large subunit [uncultured organism
           MedDCM-OCT-S09-C20]
          Length = 454

 Score = 79.1 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/262 (12%), Positives = 79/262 (30%), Gaps = 23/262 (8%)

Query: 4   YEQGRDKWQ---SNTVHYVWFDEEPP------EDVYFEGLTRINATQGLVTLTLTPLKGR 54
           Y Q  + +Q      +    +DE         +      L R+   +       +  +G 
Sbjct: 136 YCQSAENYQRIRGQNICAAVWDECDTSPVDTAQKAGEMLLARMRTGELNQLAVASTPEGF 195

Query: 55  SPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI-LGSGR 113
                 ++     D+++IR+   + PH        +  +YP    +A  +G  + L S  
Sbjct: 196 RWAYRTFVENDGPDKRLIRVRTQDNPHLPADFIPSLERNYPSQLIQAYLEGHFVNLASCS 255

Query: 114 IFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKN--YRCRE 171
           ++P  +  +        E+     G+D    +          R  D  +      YR  +
Sbjct: 256 LYPEFDRSLNYCDTQPTENDTIWIGVDLNVGN---CVTQHLVRRGDEFHFFAEKVYRDTQ 312

Query: 172 QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSG---EQLSAQYRRQGMKMLPECATFDDG 228
           Q             +        D     + +    E      ++ G ++  + +     
Sbjct: 313 QIAQGLKEMYPHHFRTGQLVLIPDAASKQRATAAAQESDIGILKKAGHQVKVQSSNPI-- 370

Query: 229 SNGVEAGISDMLDRMRSGRWKV 250
              ++  ++ +   +   + KV
Sbjct: 371 ---IQDRVNAVNALVEQRKIKV 389


>gi|251777966|ref|ZP_04820886.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
 gi|243082281|gb|EES48171.1| phage terminase, large subunit, pbsx family [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
          Length = 417

 Score = 79.1 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/238 (12%), Positives = 72/238 (30%), Gaps = 20/238 (8%)

Query: 15  TVHYVWFDEEPPEDVY------FEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            + Y+W++E    + Y       + L R    +  V  +  P + +       +     D
Sbjct: 132 YIKYIWYEEVDEFEGYDKIRNINQSLMR-GGPKFFVFYSFNPPESQRNWANLEVLDKRED 190

Query: 69  RQVIRMTINETP--HYNEQERKRIIDSYPLHEREARTKGEP-ILGSGRIFPIVEEDIVIN 125
           + +   T    P     E       D    +  +        + G+G           I+
Sbjct: 191 KLIHHSTYLTVPRDWLGEPFITEAEDLKEKNTTKYEHDYLGKVTGTGAEIFDNVVIRKIS 250

Query: 126 SLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
             ++        G+DFGW   P+   ++ +  ++  +Y+       +++       +   
Sbjct: 251 DEEVRSFDRLYRGVDFGWFPDPWTYNNMYYKANTKELYIFDEAHENKKSNKQTYDIMVKK 310

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                   P+  +  D    + ++  Y+  G+           G   VE  +  +   
Sbjct: 311 ----HGVKPNHKVTCDSAENKSIAD-YKTYGLYARGAI----KGQGSVEYSMKWLQSL 359


>gi|153815840|ref|ZP_01968508.1| hypothetical protein RUMTOR_02085 [Ruminococcus torques ATCC 27756]
 gi|145846865|gb|EDK23783.1| hypothetical protein RUMTOR_02085 [Ruminococcus torques ATCC 27756]
          Length = 441

 Score = 78.3 bits (191), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/278 (10%), Positives = 74/278 (26%), Gaps = 38/278 (13%)

Query: 10  KWQSNTVHYVWFDEEPPE--DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K Q  ++ Y + DE      +V+    +R++        +  P      + + +L     
Sbjct: 108 KIQGASIKYCYGDEVAKWNKEVFQMLKSRLDKPYSCFDGSCNPEHPTHWL-KEFLDNIEL 166

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPLH-EREARTKGEPILGSGRIFPIVEED----I 122
           D  + R TI + P   E+  +++   Y      +    G      G I+    ++     
Sbjct: 167 DIYLQRYTIFDNPFLPEEFVQQLCKEYEGTIYYDRLILGMWKRAEGAIYKRFADNPDAYR 226

Query: 123 VINSLDIPEHWVQIGGM------------DFGWHHPFAAGHLVWNRDSDVIYV------- 163
                ++                        G     +     +  +   +         
Sbjct: 227 CEVVEELNPDAEVKQFRKEDITSIEIGLDFGGNQSGHSFVARGYTDNYRDVIALKSRRIM 286

Query: 164 -------VKNYRCREQTPIFHVAALKSWG----KWLPWAWPHDGLQHDKRSGEQLSAQYR 212
                  + +    +    F    ++ +G          + +    +   +   L    R
Sbjct: 287 AKDENEDIDSNMLDKMFCDFVGEVIEEYGVVIRHGDYVEYCNVETVYYDNAETVLGNSIR 346

Query: 213 RQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
               K  P  +        +   I   +  M +GR+ +
Sbjct: 347 NAVEKQYPWISVRKAKKATINDRIRCTVKLMGAGRFFI 384


>gi|212712338|ref|ZP_03320466.1| hypothetical protein PROVALCAL_03426 [Providencia alcalifaciens DSM
           30120]
 gi|212685084|gb|EEB44612.1| hypothetical protein PROVALCAL_03426 [Providencia alcalifaciens DSM
           30120]
          Length = 411

 Score = 78.3 bits (191), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 39/229 (17%), Positives = 74/229 (32%), Gaps = 17/229 (7%)

Query: 18  YVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE     E  + +    +      + +T  P K  S   + +   +S D   + M 
Sbjct: 127 LCWVDEAETVSETAWQKLDPTVREDNSEIWVTWNPEKDGSATDKRFRKNASDDCITVEMN 186

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    E  R++  +           +G  +  S +     + +I   S D+ + 
Sbjct: 187 YSDNPWFPSVLEGVRQKDRERLDDATYAWVWEGAYLENSEKQVLAGKYEIRSFSDDLWKK 246

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
             + + G DFG+          +  D D +Y+               A      +   W 
Sbjct: 247 ADRLLFGADFGFAKDPNTLLRQFILD-DCLYIEYEMYGLGIELDHMPAFYDKIPESRKW- 304

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                ++ D    E +S   RRQG  +             VE GI+ + 
Sbjct: 305 ----SIKADSARPETIS-YLRRQGFNISAA----KKWQGSVEDGITFLR 344


>gi|295189275|gb|ADF83462.1| putative large terminase [Lactobacillus phage LBR48]
          Length = 277

 Score = 78.3 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 75/224 (33%), Gaps = 21/224 (9%)

Query: 22  DEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSAS--SSDRQVIRMTINET 79
           DE    + + +           +TLT  P   R  +   +        D      T    
Sbjct: 4   DELIKREKWKKEFF------KQITLTFNPWSERHWLKPMFFDPETRKPDVFARTTTFRVN 57

Query: 80  PHYNEQERKRIIDSYPLHEREART--KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIG 137
              ++Q+R+R +D Y  + R A+    G   +  G +F     +    +  + E      
Sbjct: 58  EWLDKQDRQRYLDLYRTNPRRAQIVCDGNWGVAEGLVFENWVVEDFDVNKVVAESDGVGH 117

Query: 138 GMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDG 196
           GMDFG+   P        NR++  I++ K    +  T       L          +    
Sbjct: 118 GMDFGFTHDPTTFAEAAINRETKDIWIFKELYQKAMTTQDIFDWLDDN------HYLKSD 171

Query: 197 LQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
           +  D     +L  + + +G++          G + ++ GI+ + 
Sbjct: 172 IGADCAE-PRLIDELQAKGVR---RMHASIKGPDSIDYGINFLQ 211


>gi|296117130|ref|ZP_06835723.1| phage terminase, large subunit [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976225|gb|EFG83010.1| phage terminase, large subunit [Gluconacetobacter hansenii ATCC
           23769]
          Length = 404

 Score = 78.3 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/245 (13%), Positives = 64/245 (26%), Gaps = 16/245 (6%)

Query: 1   LKAYEQGRDKWQS-NTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPI 57
            +   +  +  +S   V   W +E            L  I A    +  T  P +  +P+
Sbjct: 99  FRGLGRNVEAIKSTEKVDICWVEEAQSLSRASLDILLPTIRAPGSEIWFTYNPEREDAPM 158

Query: 58  IEHYLS-ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFP 116
            +   +     D  V  +   + P +  +                    E    +     
Sbjct: 159 HQMMRALRDDPDAIVRHVGWRDNPWFPPELDAERRRMLRHDPDSYDHVWEGECRTRSDAV 218

Query: 117 IVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPI 175
           +    + +     P       G+D+G+   P            D+++V            
Sbjct: 219 VFGGHVEVAEFTTPPDARLYFGVDWGFARDPTVMVRCFI--ADDIVHVDHEVFATGVEMD 276

Query: 176 FHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
              A          W      ++ D    E +S    R G +M             V+ G
Sbjct: 277 DLAALFDHVPGAREW-----PVRADASRPETISYLATRFGFRMTAAA----KWPGSVQDG 327

Query: 236 ISDML 240
           I+ + 
Sbjct: 328 IARLR 332


>gi|304406787|ref|ZP_07388442.1| phage terminase, large subunit, PBSX family [Paenibacillus
           curdlanolyticus YK9]
 gi|304344320|gb|EFM10159.1| phage terminase, large subunit, PBSX family [Paenibacillus
           curdlanolyticus YK9]
          Length = 439

 Score = 77.9 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/272 (13%), Positives = 76/272 (27%), Gaps = 31/272 (11%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGL-VTLTLTPLKGRSPIIEHYLS 63
              + + N+   V+  E  E  +    E   R  A+    +   L P           L 
Sbjct: 116 DAARIKGNSYGTVYITEVNECHQSFVQEAFDRTLASSKRQLFFDLNPKPPSHWFYRDVLD 175

Query: 64  ASSS--------DRQVIRMTINETPHYNEQERKRIIDSYPLH--EREARTKGEPILGSGR 113
                              T+       +   + ++ +Y       +A   G+    +GR
Sbjct: 176 YQDELLKRGENSGYNYAHFTVMGNLSIPDDRLRAVLSTYDKGSLWYQADILGKRTAATGR 235

Query: 114 IFPIVEED---IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRC- 169
           I+         +  + +          G+D G      A         + + ++  Y   
Sbjct: 236 IYTGYTSKDVVVTRSDIKDYRFIEFSIGIDIGGTDATVATLTGMTAKYENVVLLDGYYHK 295

Query: 170 ----REQTPIFHVAA----LKSWGKWLPWAWPHD---GLQHDKRSGEQLSAQYRRQGMKM 218
                  T   +       +  W +  P             DK   + L+ + RR+G+ +
Sbjct: 296 QGKESGFTHDRYAKEVVNKIVEWSETYPAFLSCAHIFAESADKLFRQALANELRRRGINI 355

Query: 219 LPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
               A   +G   +   I      +  GR+KV
Sbjct: 356 QVVAAYKKEG---IVDRIRLTNILINQGRYKV 384


>gi|13471711|ref|NP_103278.1| hypothetical protein msl1767 [Mesorhizobium loti MAFF303099]
 gi|14022455|dbj|BAB49064.1| msl1767 [Mesorhizobium loti MAFF303099]
          Length = 90

 Score = 77.9 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/61 (55%), Positives = 45/61 (73%)

Query: 1  LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
           K++E+GR+KWQ  T+H VWFDEEPP D+Y EGLTR NAT G+  +T TPL G S ++  
Sbjct: 18 FKSFEKGREKWQGETLHGVWFDEEPPLDIYSEGLTRTNATSGITIVTFTPLLGMSDVVLL 77

Query: 61 Y 61
          +
Sbjct: 78 F 78


>gi|13471714|ref|NP_103281.1| hypothetical protein mll1771 [Mesorhizobium loti MAFF303099]
 gi|14022458|dbj|BAB49067.1| mll1771 [Mesorhizobium loti MAFF303099]
          Length = 254

 Score = 77.9 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/61 (55%), Positives = 45/61 (73%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K++E+GR+KWQ  T+H VWFDEEPP D+Y EGLTR NAT G+  +T TPL G S ++  
Sbjct: 182 FKSFEKGREKWQGETLHGVWFDEEPPLDIYSEGLTRTNATSGITIVTFTPLLGMSDVVLL 241

Query: 61  Y 61
           +
Sbjct: 242 F 242


>gi|134288591|ref|YP_001110830.1| hypothetical protein SPSV3_gp30 [Salmonella phage SETP3]
 gi|125631956|gb|ABN47359.1| hypothetical protein [Salmonella phage SETP3]
 gi|126015316|gb|ABN70689.1| terminase [Salmonella phage SETP5]
 gi|126015318|gb|ABN70690.1| terminase [Salmonella phage SETP12]
          Length = 423

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/251 (14%), Positives = 73/251 (29%), Gaps = 29/251 (11%)

Query: 21  FDEEPPED------VYFEGL----------TRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
            DE    +       + + +            I           T  +G   + + ++  
Sbjct: 122 IDELDTLNKDHAEHAWNKVIARNRQLPRTYRPITPKPANTVSVFTTPEGFRFVHDRWVVK 181

Query: 65  SSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI-LGSGRIFPIVEEDIV 123
            +   ++I+      P   E   + + D+YP    +A   GE + L S  ++   ++   
Sbjct: 182 KNPGYEMIQAPTTSNPFLPEDYVQSLRDTYPGRLIDAYIDGEFVNLTSDSVYYAYDQRKN 241

Query: 124 INSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPI---FHVAA 180
            +   I        G DF   H  +    V+ +   V + V        TP         
Sbjct: 242 SSRETIQPGETLYIGQDFNVGHMAS---TVYVQRGYVWHAVAELVDMLDTPEVVREITER 298

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSG-EQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
            K  G  +       G             AQ    G ++  +          V+  ++ +
Sbjct: 299 WKRHGHHIVMYPDATGKNRKSTDASTSDIAQLHNAGFEIRAKSVNP-----AVKDRVASV 353

Query: 240 LDRMRSGRWKV 250
              + SGR  V
Sbjct: 354 NKALESGRLMV 364


>gi|299534276|ref|ZP_07047625.1| phage terminase, large subunit, PBSX family [Comamonas testosteroni
           S44]
 gi|298717734|gb|EFI58742.1| phage terminase, large subunit, PBSX family [Comamonas testosteroni
           S44]
          Length = 436

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/252 (11%), Positives = 67/252 (26%), Gaps = 20/252 (7%)

Query: 7   GRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
                +       W++E     +         + A    +     P     P+     +A
Sbjct: 118 SVKSLEGFKR--AWWEEAQTATQRSLDLLRPTMRAPGSQLWFGWNPRFAMDPVDRMLRAA 175

Query: 65  SSS-DRQVIRMTINETPHYNEQERKRIIDS--YPLHEREARTKGEPILGSGRIFPIV--- 118
                  V++    + P +  +  +  +D       + +   +G     +   +      
Sbjct: 176 ELPTGALVVQANWRDNPWFPAELEQERLDCLRQQPDKYDHIWEGGYETVNEGAYFAKQLT 235

Query: 119 --EEDIVINSLDIPEHWVQIGGMDFGWH--HPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
             + +  +  +           +D G    +  +    +       + V+  Y  + Q  
Sbjct: 236 AAKAEGRLGVVAADPSMRLRAYVDIGGTGRNADSFAMWIVQFVGLQVRVLDYYEAQGQPM 295

Query: 175 IFHVAALKSWGKW---LPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
             HV  L   G     L    PHDG + D       +++ RR G  +       + G   
Sbjct: 296 ATHVQWLHDRGYKSDRLDIWLPHDGDRSDVVFAVTPASELRRLGYTVT---TIPNQGKGA 352

Query: 232 VEAGISDMLDRM 243
               +       
Sbjct: 353 ALKRVEAARQLF 364


>gi|319786769|ref|YP_004146244.1| phage terminase, large subunit, PBSX family [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465281|gb|ADV27013.1| phage terminase, large subunit, PBSX family [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 439

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/256 (14%), Positives = 65/256 (25%), Gaps = 24/256 (9%)

Query: 7   GRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINAT--------QGLVTLTLTPLKGRSPII 58
                +    H  W +E         GL R               +     P +   P+ 
Sbjct: 117 SIKSLEG--FHRAWVEEAQSLSSTSLGLLRPTIRWEDAGRGLTSEMWFGWNPRRKTDPVD 174

Query: 59  EHYLSASSS-DRQVIRMTINETPHYNEQERKRIIDS--YPLHEREARTKGEPILGSGRIF 115
                        V+R   ++ P +     +  +D       + E   +G     +   +
Sbjct: 175 VLLRGPEPPTGAAVVRANWSDNPWFPSVLEQERLDCLRSMPDQYEHIWEGGYATAATGAY 234

Query: 116 P-------IVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR 168
                     E  I   + D          +        A    +       + V+  Y 
Sbjct: 235 FAQALVTAKSEGRIGRVAADPLMTTRAYWDIGGTGAKADACAIWIVQFVGREVRVLDYYE 294

Query: 169 CREQTPIFHVAALKSWGKWL-PWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
            + Q    HVA L+S G        PHDG  +DK       +  ++ G  +         
Sbjct: 295 AQGQPLATHVAWLRSRGYERAQCVLPHDGAANDKVHQVSYQSALQQAGFDVRVIPNM--- 351

Query: 228 GSNGVEAGISDMLDRM 243
           G+      I  +    
Sbjct: 352 GAGAASKRIEAVRRLF 367


>gi|62362215|ref|YP_224140.1| gp2 [Enterobacteria phage ES18]
 gi|58339058|gb|AAW70473.1| gp2 [Enterobacteria phage ES18]
          Length = 439

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/245 (12%), Positives = 70/245 (28%), Gaps = 27/245 (11%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      + +T  P K  S   + +         ++ M 
Sbjct: 127 VAWVDEAESVSSTAWKKLRPTVREEGSEIWVTWNPEKDGSATDKLFRKNPPKSSMIVEMN 186

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
             + P +    E+ER+  + +    +     +G  +  S +     +  +     ++   
Sbjct: 187 YVDNPWFPAVLEEERQEDLANLDYADYAWIWEGAYLENSDKQVLANKYVVQSFEDNLWRK 246

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV-----------AA 180
             + + G DFG+    +    ++  D++ +Y+                            
Sbjct: 247 SERLLFGADFGFAKDPSTLIRMFILDNN-LYIEYEAYGNGVELDDMWKFYAGKTDATPKQ 305

Query: 181 LKSW----GKWLPWAWPHDGL-QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           LK W        P              S  +  +  + QG  +             VE G
Sbjct: 306 LKDWKVTDDTKFPGIPEARKWPIKADNSRPETISHIKGQGFNISAA----QKWQGSVEDG 361

Query: 236 ISDML 240
           I+ + 
Sbjct: 362 ITFLR 366


>gi|148557330|ref|YP_001264912.1| bacteriophage terminase large (ATPase) subunit-like protein
           [Sphingomonas wittichii RW1]
 gi|148502520|gb|ABQ70774.1| Bacteriophage terminase large (ATPase) subunit and inactivated
           derivatives-like protein [Sphingomonas wittichii RW1]
          Length = 225

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/61 (60%), Positives = 45/61 (73%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            KAYEQGR KWQ +T++ +WFDEEPP D+Y EGLTR NAT G   LT TPLKG S ++  
Sbjct: 161 FKAYEQGRAKWQGDTLNGIWFDEEPPLDIYVEGLTRTNATGGFAMLTFTPLKGMSEVVRM 220

Query: 61  Y 61
           +
Sbjct: 221 F 221


>gi|253991059|ref|YP_003042415.1| phage terminase large subunit [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782509|emb|CAQ85673.1| similar to phage terminase large subunit [Photorhabdus asymbiotica]
          Length = 411

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/229 (15%), Positives = 75/229 (32%), Gaps = 17/229 (7%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +  +   + +T  P K  S   + +         ++ M 
Sbjct: 127 LAWVDEAESVSEIAWKKLRPTVRESGSEIWVTWNPEKDGSATDKRFRKKPPRSSIIVEMN 186

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    E+ER+  ++S    +     +G  +  S +     +  I     D+   
Sbjct: 187 YSDNPWFPDVLEEERQEDLESLEHSDYAWIWEGAYLENSEKQVLANKYKIESFPDDLWMK 246

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
             + + G DFG+         ++  D+  +Y+ +             A      +   W 
Sbjct: 247 ADRLLFGADFGFAKDPNTLLRMFILDN-CLYIDREACRVGVELDHIPAFYDKVPESRKW- 304

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                ++ D    E +S   +RQG  +             VE GI+ + 
Sbjct: 305 ----PIKADSARPETIS-YLKRQGFNISAA----KKWQGSVEDGITFLR 344


>gi|304384818|ref|ZP_07367164.1| PBSX family phage terminase [Pediococcus acidilactici DSM 20284]
 gi|304329012|gb|EFL96232.1| PBSX family phage terminase [Pediococcus acidilactici DSM 20284]
          Length = 432

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/264 (14%), Positives = 86/264 (32%), Gaps = 24/264 (9%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTL-TLTPLKGRSPIIEHYLS 63
             +  +  ++  V + E     ++   E   R  A +    L  L P     PIIE +  
Sbjct: 119 SANSIRGLSLGSVAYSEMNLLDKEFIDESFRRTAAAKIRYHLADLNPPAPHDPIIETFKE 178

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR--TKGEPILGSGRIFPIVEED 121
                   +  T+++ P  +EQ  K + +    +    +    G  ++  G I+ + ++ 
Sbjct: 179 Y---GAHWLHWTMSDNPVMSEQRLKEMEEQLKRNPYRYKRDWLGLRVMPQGVIYSMFDDK 235

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFA----AGHLVWNRDSDVIYVVKN--YRCREQTP- 174
            + +   + E        D G +            V + D     + +   Y        
Sbjct: 236 DMTDQALVGEPVEMFFAGDAGQNDATTLSCNIVTRVVDGDGARFVLNRVANYYHSGTETG 295

Query: 175 -----IFHVAALKSWGKWLPWAWP-HDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
                  +   L+ +  W    +  +        + + L A+  + G+   P     ++ 
Sbjct: 296 ETKAMSTYAEELRQFINWCHQKYQLYYSDIVIDPAAKTLRAELEKLGIMSSPANNNGNEK 355

Query: 229 SNGV---EAGISDMLDRMRSGRWK 249
              V   E GI  + + M + +++
Sbjct: 356 VGSVRGIEVGIERLQNLMTNQQFR 379


>gi|300021692|ref|YP_003754303.1| hypothetical protein Hden_0155 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523513|gb|ADJ21982.1| protein of unknown function DUF264 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 500

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 78/310 (25%), Gaps = 69/310 (22%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPE--DVYFEGLTRIN-----------ATQGLVTLTLTPL 51
           E+   K+Q   +H +  DE       +Y    +R+                 +     P 
Sbjct: 113 EKDIYKYQGAEIHVLLIDELTHFTESMYRFLRSRVRMVGLKLQEAWKRRFPRILAGANPG 172

Query: 52  KGRSPIIEHYLSASSS--------------DRQVIRMTINETPHY---NEQERKRIIDSY 94
                 ++      +                RQ IR  + + P     +    +++    
Sbjct: 173 NVGHLWVKSTFVDGAESYAVRDMEPEDGGMKRQFIRAVLEDNPSMTTDDPGYEQKLSGLG 232

Query: 95  PLHEREARTKGEPILGSGRIFPIV-EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV 153
                +A   G+  +  G  F     E  VI    +PE W ++   D+G   PF+ G   
Sbjct: 233 SKSLVQAMRFGDWDVIEGAFFDCWATERHVIRPFAVPELWTKLMSGDWGSAKPFSFGWWT 292

Query: 154 WNRD---------------SDVIYVVKNYRCRE---------QTPIFHVAALKSWG---K 186
              D                  +   + +   +          T       L       +
Sbjct: 293 VVSDDFEAETALGRKIVLPRGCLVRYREWYGMQTGKPNTGLKLTAEQVALGLVDREPTTE 352

Query: 187 WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA------GISDML 240
            + +             G  ++ + R    +       F    N          G   + 
Sbjct: 353 KIDYRVLDPAAFTADG-GPSIADRMRDA-ARTKTRSLVFRRADNARVPARGAMGGWDQVR 410

Query: 241 DRM---RSGR 247
            RM     GR
Sbjct: 411 QRMIGDEEGR 420


>gi|317473130|ref|ZP_07932428.1| phage terminase [Anaerostipes sp. 3_2_56FAA]
 gi|316899354|gb|EFV21370.1| phage terminase [Anaerostipes sp. 3_2_56FAA]
          Length = 499

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/241 (14%), Positives = 73/241 (30%), Gaps = 23/241 (9%)

Query: 15  TVHYVWFDEEPPED------VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            +  +W +E              + + R       +  +  P K +      Y+      
Sbjct: 215 YIGILWLEELDQFTGPESVRKIEQSVIR-GGEYAYIFKSFNPPKSKGNWANKYIKIPKET 273

Query: 69  RQVIRMTINETP--HYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
           R V   T  + P     +           ++    +    GE   G+G           I
Sbjct: 274 RLVTHSTYMDIPKKWLGKPFLDEAEFLKEVNPAAYDNEYMGE-ANGNGGQVFDNVTIREI 332

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
              +I +      G+D+GW+  P+  G + ++     +Y+   YRC ++        LK 
Sbjct: 333 TDEEIAQFDRIYNGVDWGWYPDPYHFGRMHYDAARMTLYIFMEYRCNKKGNKETAEELKK 392

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
            G        +D +  D    + +   YR  G+         + G   V+  +  +    
Sbjct: 393 RG-----ITGNDLITCDSAEEKSVGD-YRAYGLLARGA----EKGPGSVDYSMKWLQSLR 442

Query: 244 R 244
            
Sbjct: 443 E 443


>gi|170752064|ref|YP_001758324.1| PBSX family phage terminase large subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170658586|gb|ACB27641.1| phage terminase, large subunit, PBSX family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 440

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/245 (11%), Positives = 62/245 (25%), Gaps = 27/245 (11%)

Query: 16  VHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           V   W +E     +  +   +  I      + ++           + +++   +  +V++
Sbjct: 112 VDVCWVEEARTVSKTSWDVLIPTIRKEGSEIWISFNTELAEDETYKRFVAKPPTGARVVK 171

Query: 74  MTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDI-------VINS 126
           +   + P + +  R+  +D          T       +     I   +I           
Sbjct: 172 IGWEDNPWFPDVLRQEALDLKARDPIAYETVWGGNCKAVLDGAIYANEILAATTAKRFTK 231

Query: 127 LDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW-- 184
           +            D G     +              ++  Y  R      ++ +LK    
Sbjct: 232 VPYDPTKPVHTFWDLGRADKTSIWFAQI--VGFEFRLIDFYENRGHALGHYLESLKERAL 289

Query: 185 -------GKWLPWAW-PHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGI 236
                  G      W PHD       S   +  Q    G ++             V AGI
Sbjct: 290 PVEQGGKGYVYGEHWLPHDARNELLASERTIEQQMWAAGHRVRITPRLT------VAAGI 343

Query: 237 SDMLD 241
                
Sbjct: 344 DAARK 348


>gi|260463788|ref|ZP_05811985.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259030385|gb|EEW31664.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 209

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/61 (55%), Positives = 45/61 (73%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K++E+GR+KWQ  T+H VWFDEEPP D+Y EGLTR NAT G+  +T TPL G S ++  
Sbjct: 137 FKSFEKGREKWQGETLHGVWFDEEPPLDIYSEGLTRTNATGGITIVTFTPLLGMSDVVLL 196

Query: 61  Y 61
           +
Sbjct: 197 F 197


>gi|253990592|ref|YP_003041948.1| Phage terminase, large subunit [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782042|emb|CAQ85206.1| Phage terminase, large subunit [Photorhabdus asymbiotica]
          Length = 405

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/229 (15%), Positives = 75/229 (32%), Gaps = 17/229 (7%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +  +   + +T  P K  S   + +         ++ M 
Sbjct: 121 LAWVDEAESVSEIAWKKLRPTVRESGSEIWVTWNPEKDGSATDKRFRKKPPRSSIIVEMN 180

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    E+ER+  ++S    +     +G  +  S +     +  I     D+   
Sbjct: 181 YSDNPWFPDVLEEERQEDLESLEHSDYAWIWEGAYLENSEKQVLANKYKIESFPDDLWMK 240

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWA 191
             + + G DFG+         ++  D+  +Y+ +             A      +   W 
Sbjct: 241 ADRLLFGADFGFAKDPNTLLRMFILDN-CLYIDREACRVGVELDHIPAFYDKVPESRKW- 298

Query: 192 WPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                ++ D    E +S   +RQG  +             VE GI+ + 
Sbjct: 299 ----PIKADSARPETIS-YLKRQGFNISAA----KKWQGSVEDGITFLR 338


>gi|169633422|ref|YP_001707158.1| putative phage terminase [Acinetobacter baumannii SDF]
 gi|169152214|emb|CAP01118.1| conserved hypothetical protein; Putative phage terminase
           [Acinetobacter baumannii]
          Length = 432

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/265 (13%), Positives = 90/265 (33%), Gaps = 28/265 (10%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINATQGLVTL---TLTPLK 52
           ++ E+  +      + +   DE         +  + + + R+   Q  +       T  +
Sbjct: 111 RSMEK-PNTIVGFKIGHALIDELDVMTKVKAQQAWRKIIARMRYKQAGLLNGIDVATTPE 169

Query: 53  GRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKG 105
           G     E ++  ++          +I+ +  +   +  +     + +SYP     A  KG
Sbjct: 170 GFKFTHEQFVKEANQSDAKRALYGMIQASTYDNEANLPDDYIASLFESYPPQLISAYLKG 229

Query: 106 EPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
           + + L SG ++P  +  +     +I  +   + GMDF      A  +++ +        +
Sbjct: 230 QFVNLTSGAVYPDFDRTLNHTDEEIRPNEALLIGMDFNVLKMAAVVYVIRD---GKPRAL 286

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPEC 222
                   TP      ++ +        P    Q      S E   A  +++G+++    
Sbjct: 287 DELVGVRDTPTMADLLIEKFPNHEMTIIPDAAGQATSSKKSSESDHAILKQKGLRVEVNS 346

Query: 223 ATFDDGSNGVEAGISDMLDRMRSGR 247
                    ++  I+ +   + +G+
Sbjct: 347 TNP-----NIKDRINAVNALILNGK 366


>gi|292496028|gb|ADE29129.1| terminase [uncultured virus]
          Length = 509

 Score = 76.0 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 44/268 (16%), Positives = 88/268 (32%), Gaps = 32/268 (11%)

Query: 8   RDKWQSNTVHYVWFDEEPPE-----DVYFEGLTRINATQGLV--TLTLTPLKGRSPII-- 58
            +++  ++   VW DE         D+     +R+    G      TLT     +     
Sbjct: 176 WNRYAGDSYGGVWADEVGHYGDDLHDLLEMLGSRLRGVGGPQTQLWTLTGNGKNAAFDII 235

Query: 59  ----EHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHERE-ARTKGEPILGSGR 113
               +        + + ++ +  E P+ ++ E++R    Y    RE     G    G G 
Sbjct: 236 ERGLDANGDKIGLNIETVKASTLENPYLSDSEKERFKRQYGNTSREGQALHGGFSAGEGN 295

Query: 114 IFPIVEED-IVINSLDIPEHWVQIGGMDFGW-----------HHPFAAGHLVWNRDSDVI 161
           +    +   I  ++ D  E+ V   G+D  +               AA  + ++R +   
Sbjct: 296 LLNRDQLSFIDKSNYDGGENLVFYIGVDLAYVESKGKAKANDSDYTAAVLVGYDRSNGKA 355

Query: 162 YVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPE 221
           YV+   R R  T    +  L  +   +P          D  + +    + +R    +   
Sbjct: 356 YVLDVERERGMTLQQSITWLSQFAXRVP---QPTVKIEDVAAQKWFIQEAKR---TVEGT 409

Query: 222 CATFDDGSNGVEAGISDMLDRMRSGRWK 249
             +   G+   +  I+DM      G  K
Sbjct: 410 IQSVSPGNQSKQERITDMSVLFERGDVK 437


>gi|226313130|ref|YP_002773024.1| hypothetical protein BBR47_35430 [Brevibacillus brevis NBRC 100599]
 gi|226096078|dbj|BAH44520.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 469

 Score = 76.0 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 34/282 (12%), Positives = 70/282 (24%), Gaps = 42/282 (14%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEE--PPEDVYF-EGLTRINATQGLVTLTLTPLKGRSPI 57
            K+ +          +  VW DE     E  +       +    G    T TP  G +  
Sbjct: 129 FKSAD-NPKTLVGKGLDGVWLDEASKMKEQTWSGYLSYALADKGGWSVWTTTPE-GMNWF 186

Query: 58  IEHY--------------LSASSSDRQVIRMTINETP-HYNEQERKRIIDSYPLHEREAR 102
                                +  +      T  + P    ++  +R+I++ P    +  
Sbjct: 187 YHDIVLNGQHTQAGGQLDEYRNDPEWCNFYWTSKDNPLPELQKNIQRMIETMPKRYVDRE 246

Query: 103 TKGEPILGSGRIFPIVEEDIVINS-------LDIPEHWVQIGGMDFGWHHPFAAGHLVWN 155
                 +  G+++   +  I +                    G D+G+ +P         
Sbjct: 247 IFARFDVFFGQVYEEFDRSIHVVPRALCEQKFKDGHFVHIEAGKDWGFTNPGVTLVGAMT 306

Query: 156 RDSDVIYVVKNYRCREQTP--IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRR 213
             +  +++V      +             +  K L   W       D          Y  
Sbjct: 307 A-NGELWIVDAIYKAQMEILVPGSSDCWVAQDKELMKKWKIKLFWCDS-ENASNIKTYLT 364

Query: 214 QGMKMLPECATFDDGSNGVEAGISDMLDRMR----SGRWKVF 251
            G+                  GI  +    +    +GR  +F
Sbjct: 365 NGLPARAAQKHLK-------EGIRAVSILFKVKSDNGRPNIF 399


>gi|239502405|ref|ZP_04661715.1| putative phage terminase [Acinetobacter baumannii AB900]
          Length = 427

 Score = 75.6 bits (184), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/264 (13%), Positives = 90/264 (34%), Gaps = 28/264 (10%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINATQGLVTL---TLTPLK 52
           ++ E+  +      + +   DE         +  + + + R+   Q  +       T  +
Sbjct: 106 RSMEK-PNTIVGFKIGHALIDELDVMTKVKAQQAWRKIIARMRYKQAGLLNGIDVATTPE 164

Query: 53  GRSPIIEHYLSASS------SDRQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKG 105
           G     E ++  ++      +   +I+ +  +   +  +     + +SYP     A  KG
Sbjct: 165 GFKFTHEQFVKEANLSDAKRALYGMIQASTYDNEVNLPDDYIASLFESYPPQLISAYLKG 224

Query: 106 EPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
           + + L SG ++P  +  +     +I  +   + GMDF      A  +++ +        +
Sbjct: 225 QFVNLTSGAVYPDFDRTLNHTDEEIRPNEALLIGMDFNVLKMAAVVYVIRD---GKPRAL 281

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPEC 222
                   TP      ++ +        P    Q      S E   A  R++G+++    
Sbjct: 282 DELVGVRDTPTMADLLIEKFPNHEMTIIPDAAGQATSSKKSSESDHAILRQKGLRVEVNS 341

Query: 223 ATFDDGSNGVEAGISDMLDRMRSG 246
                    ++  I+ +   + +G
Sbjct: 342 TNP-----NIKDRINAVNALILNG 360


>gi|200389400|ref|ZP_03216011.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|199601845|gb|EDZ00391.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
          Length = 439

 Score = 75.6 bits (184), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 30/245 (12%), Positives = 70/245 (28%), Gaps = 27/245 (11%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      + +T  P K  S   + +         ++ M 
Sbjct: 127 VAWVDEAESVSSTAWKKLRPTVREEGSEIWVTWNPEKDGSATDKLFRKNPPKSSIIVEMN 186

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
             + P +    E+ER+  + +    +     +G  +  S +     +  +     ++   
Sbjct: 187 YVDNPWFPAVLEEERQEDLANLDYADYAWIWEGAYLENSDKQVLANKYVVQSFEDNLWRK 246

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV-----------AA 180
             + + G DFG+    +    ++  D++ +Y+                            
Sbjct: 247 SERLLFGADFGFAKDPSTLIRMFILDNN-LYIEYEAYGNGVELDDMWKFYAGKTDATPKQ 305

Query: 181 LKSW----GKWLPWAWPHDGL-QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           L+ W        P              S  +  +  + QG  +             VE G
Sbjct: 306 LEDWKATDDTKFPGIPEARKWPIKADNSRPETISHIKGQGFNISAA----QKWQGSVEDG 361

Query: 236 ISDML 240
           I+ + 
Sbjct: 362 ITFLR 366


>gi|322617167|gb|EFY14073.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322617525|gb|EFY14424.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322624846|gb|EFY21675.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322630396|gb|EFY27166.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322634576|gb|EFY31309.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322639287|gb|EFY35979.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322641951|gb|EFY38570.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322646142|gb|EFY42657.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322651994|gb|EFY48357.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322656167|gb|EFY52464.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322659319|gb|EFY55566.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322665779|gb|EFY61962.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322669983|gb|EFY66124.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322673970|gb|EFY70067.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322678727|gb|EFY74783.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322683477|gb|EFY79491.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322687552|gb|EFY83522.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323193612|gb|EFZ78817.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323198519|gb|EFZ83621.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323203541|gb|EFZ88564.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323208431|gb|EFZ93370.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323213567|gb|EFZ98357.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323218397|gb|EGA03107.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323219724|gb|EGA04205.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323224576|gb|EGA08856.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323232391|gb|EGA16494.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323235576|gb|EGA19660.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323241265|gb|EGA25301.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323245007|gb|EGA29009.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323250125|gb|EGA34019.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323253910|gb|EGA37735.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323258780|gb|EGA42436.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323262838|gb|EGA46389.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323264213|gb|EGA47720.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323270910|gb|EGA54348.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 439

 Score = 75.2 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 30/245 (12%), Positives = 70/245 (28%), Gaps = 27/245 (11%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      + +T  P K  S   + +         ++ M 
Sbjct: 127 VAWVDEAESVSSTAWKKLRPTVREEGSEIWVTWNPEKDGSATDKLFRKNPPKSSIIVEMN 186

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
             + P +    E+ER+  + +    +     +G  +  S +     +  +     ++   
Sbjct: 187 YVDNPWFPAVLEEERQEDLANLDYADYAWIWEGAYLENSDKQVLANKYIVQSFEDNLWRK 246

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV-----------AA 180
             + + G DFG+    +    ++  D++ +Y+                            
Sbjct: 247 SERLLFGADFGFAKDPSTLIRMFILDNN-LYIEYEAYGNGVELDDMWKFYAGKTDATPKQ 305

Query: 181 LKSWG----KWLPWAWPHDGL-QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           L+ W        P              S  +  +  + QG  +             VE G
Sbjct: 306 LEDWEVTDDAKFPGIPEARKWPIKADNSRPETISHIKGQGFNISAA----QKWQGSVEDG 361

Query: 236 ISDML 240
           I+ + 
Sbjct: 362 ITFLR 366


>gi|238912006|ref|ZP_04655843.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
          Length = 439

 Score = 75.2 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 30/245 (12%), Positives = 70/245 (28%), Gaps = 27/245 (11%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      + +T  P K  S   + +         ++ M 
Sbjct: 127 VAWVDEAESVSSTAWKKLRPTVREEGSEIWVTWNPEKDGSATDKLFRKNPPKSSIIVEMN 186

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
             + P +    E+ER+  + +    +     +G  +  S +     +  +     ++   
Sbjct: 187 YVDNPWFPAVLEEERQEDLANLDYADYAWIWEGAYLENSDKQVLANKYIVQSFEDNLWRK 246

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV-----------AA 180
             + + G DFG+    +    ++  D++ +Y+                            
Sbjct: 247 SERLLFGADFGFAKDPSTLIRMFILDNN-LYIEYEAYGNGVELDDMWKFYAGKTDATPKQ 305

Query: 181 LKSWG----KWLPWAWPHDGL-QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           L+ W        P              S  +  +  + QG  +             VE G
Sbjct: 306 LEDWEVTDDAKFPGIPEARKWPIKADNSRPETISHIKGQGFNISAA----QKWQGSVEDG 361

Query: 236 ISDML 240
           I+ + 
Sbjct: 362 ITFLR 366


>gi|296101689|ref|YP_003611835.1| hypothetical protein ECL_01325 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|296103539|ref|YP_003613685.1| hypothetical protein ECL_03201 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295056148|gb|ADF60886.1| hypothetical protein ECL_01325 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057998|gb|ADF62736.1| hypothetical protein ECL_03201 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 365

 Score = 75.2 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 30/230 (13%), Positives = 65/230 (28%), Gaps = 19/230 (8%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      + +T  P +  S   + +   +  D   + M 
Sbjct: 77  LCWVDEAESVSEIAWQKLSPTVREEGSEIWVTWNPERDGSATDKRFRKEAGDDCITVEMN 136

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
             + P +    E ER+               +G  +  S +     +  I   S  + + 
Sbjct: 137 YTDNPWFPDVLEGERQNDQRRLDPATYAWVWEGAYLENSDKQVLAGKYRIAEFSDQLWKE 196

Query: 133 WVQ-IGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPW 190
             +   G DFG+   P            + +Y+      ++               +   
Sbjct: 197 ADRLFFGADFGFAKDPNTLVRSFI--LHNRLYIEYEAYGQQTELDHMPEL------YDTI 248

Query: 191 AWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
               D       +  +  +  +RQG  +       +     VE GI+ + 
Sbjct: 249 PGSRDWPIKADSARPETISYLKRQGFNISAA----EKWQGSVEDGIAHLR 294


>gi|325953894|ref|YP_004237554.1| phage terminase, large subunit, PBSX family [Weeksella virosa DSM
           16922]
 gi|323436512|gb|ADX66976.1| phage terminase, large subunit, PBSX family [Weeksella virosa DSM
           16922]
          Length = 446

 Score = 75.2 bits (183), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 27/228 (11%), Positives = 62/228 (27%), Gaps = 22/228 (9%)

Query: 7   GRDKWQSNT-VHYVWFDEEP--PEDVYFEGLTRIN---ATQGLVTLTLTPLKGRSPIIEH 60
             +K +S   +  +W +E     E+ + +   RI     +   + LT  P+  R  I   
Sbjct: 110 DSEKIKSVAGITKIWLEEATEFTEEDFDQLDLRIRGHVDSFYQIILTFNPIHERHWIKRK 169

Query: 61  YLSASSSDRQVIR-------MTINETPHYNEQERKRIIDSYPL--HEREARTKGEPILGS 111
           +        +           T  +    +EQ ++++        +      KGE  +  
Sbjct: 170 FWDTPEEGGEYDPEMMFNLVTTYRDNKFLDEQYKQKLEKLINSNINLYRVYVKGEWGIEQ 229

Query: 112 GRIF---PIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVI---YVVK 165
                      E  V  S+     +      DF           +     D     +V+K
Sbjct: 230 NDNMWLYAFSNEKHVKPSIPFLPTYDVYLSFDFNKDPLTCLAFQMSPNKGDHHSFIHVIK 289

Query: 166 NYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSG-EQLSAQYR 212
            +  ++            +   + +         +   G + +     
Sbjct: 290 EFGGKKSLEDLCTEIKMYFPGSILYVTGDSSGNTEGVVGYQSIHDSAY 337


>gi|225574768|ref|ZP_03783378.1| hypothetical protein RUMHYD_02845 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037968|gb|EEG48214.1| hypothetical protein RUMHYD_02845 [Blautia hydrogenotrophica DSM
           10507]
          Length = 428

 Score = 75.2 bits (183), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 35/247 (14%), Positives = 77/247 (31%), Gaps = 20/247 (8%)

Query: 5   EQGRDKWQSNTV-----HYVWFDEEP--PEDVYFEGLTRIN-----ATQGLVTLTLTPLK 52
           E+ R+K +S T        VW +E     +  +     R+           + +T  P+ 
Sbjct: 112 EKQREKLKSITFQRGKLTDVWIEEATEITQADFEIIDDRLRGELPPDQFYQIRMTFNPVN 171

Query: 53  GRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
               I + +     S+      T  +    +     R+     +     +  G    G  
Sbjct: 172 KNHWIKKVFFDTPDSNVLTHHSTYLDNRFIDAAYHARMARRKEVDPEGYQIYGLGNWGEV 231

Query: 113 RIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ 172
               +    +   S ++ ++     G DFG++H  A   L   +D ++  + + Y   ++
Sbjct: 232 GGLILHNWAVENISQNLDDYDDIAIGQDFGFNHANAILLLGM-KDDNIYILQEIYVFEKE 290

Query: 173 TPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
           T      A+K              +  D    +++ A ++  G +               
Sbjct: 291 TAEIIPLAIKD------GIPIKRTMWCDSAEPDRIKA-WKTAGFRARAVSKEHTTEKKYQ 343

Query: 233 EAGISDM 239
            A I  +
Sbjct: 344 SAQIDWL 350


>gi|168236450|ref|ZP_02661508.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|194735659|ref|YP_002113600.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|194711161|gb|ACF90382.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197290245|gb|EDY29601.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
          Length = 439

 Score = 75.2 bits (183), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 30/245 (12%), Positives = 70/245 (28%), Gaps = 27/245 (11%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      + +T  P K  S   + +         ++ M 
Sbjct: 127 VAWVDEAESVSSTAWKKLRPTVREEGSEIWVTWNPEKDGSATDKLFRKNPPKSSIIVEMN 186

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
             + P +    E+ER+  + +    +     +G  +  S +     +  +     ++   
Sbjct: 187 YVDNPWFPAVLEEERQEDLANLDYADYAWIWEGAYLENSDKQVLANKYVVQSFEDNLWRK 246

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV-----------AA 180
             + + G DFG+    +    ++  D++ +Y+                            
Sbjct: 247 SERLLFGADFGFAKDPSTLIRMFILDNN-LYIEYEAYGNGVELDDMWKFYAGKTDATPKQ 305

Query: 181 LKSWG----KWLPWAWPHDGL-QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           L+ W        P              S  +  +  + QG  +             VE G
Sbjct: 306 LEDWEVTDDAKFPGIPEARKWPIKADNSRPETISHIKGQGFNISAA----QKWQGSVEDG 361

Query: 236 ISDML 240
           I+ + 
Sbjct: 362 ITFLR 366


>gi|162135133|ref|YP_001595874.1| hypothetical protein [Pseudomonas phage YuA]
 gi|161513980|emb|CAO77806.1| hypothetical protein [Pseudomonas phage YuA]
          Length = 515

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/293 (11%), Positives = 77/293 (26%), Gaps = 62/293 (21%)

Query: 10  KWQSNTVHYVWFDEEPPEDV-----YFEGLTRINATQGLVTLTLTPLK---GRSPIIEHY 61
            +  +   ++ ++E                 R            T      G + +   +
Sbjct: 157 NYHGHAYPWIGWEELCNWADDKCYTVMMSCCRSTKPGMPRCYRATTNPYGPGHNWVKARF 216

Query: 62  LSAS---------------SSDRQVIRMTINETP---HYNEQERKRIIDS-YPLHEREAR 102
                                 R  I  +I E     H + +   +I  +     E  A 
Sbjct: 217 RLPHMRGRVILDAMRDGEREPPRVAIHGSIYENQILLHADPEYISKIRAAARNPSELAAW 276

Query: 103 TKGEPILGSGRIFPIVEEDIVINSLD-----IPEHWVQIGGMDFGWHHPFAAGHLV---- 153
             G   + +G +F  +    V          IP+ W      D+G   PFA         
Sbjct: 277 LHGSWDIIAGGMFDDIYRGDVHVVPSVPLSVIPKRWKIDRSFDWGSSKPFAVLWWAESNG 336

Query: 154 ---------WNRDSDVIYVVKNYRC----REQTPIFHVAALKSWGKWLPWAWPHDGLQH- 199
                    + +    +Y+++ +      R +      + +    K     W  +G    
Sbjct: 337 EPFEWNGRVYGKVRGDLYLIQEWYGWNGTRNEGVRMLASEVAQGVKDREEDWALEGRVKP 396

Query: 200 --------DKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
                   D  +G  ++    ++G++  P       G    + G   +   ++
Sbjct: 397 GPADSSIFDVENGNSIAVDMEKKGVRWTPAD----KGPGSRKQGWEQIRKLLK 445


>gi|85059645|ref|YP_455347.1| hypothetical protein SG1667 [Sodalis glossinidius str. 'morsitans']
 gi|84780165|dbj|BAE74942.1| hypothetical phage protein [Sodalis glossinidius str. 'morsitans']
          Length = 413

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 62/231 (26%), Gaps = 21/231 (9%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      V +T  P    S   + +   S      + M 
Sbjct: 126 LCWVDEAETVSEIAWQKLDPTVREPGSEVWVTWNPETEGSATDKRFRKDSDDAIIAVEMN 185

Query: 76  INETPHY---NEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
             + P +    EQ R+R +            +G  +  + +     +        D+ + 
Sbjct: 186 YMDNPWFHSVLEQVRQRDLRMLDSATYAWIWEGAYLENANKQVMSGKYVFETFPDDLWKQ 245

Query: 133 WVQ-IGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPW 190
             +   G DFG+   P     +      + +Y+                 L    ++   
Sbjct: 246 ADRLFFGADFGFAQDPNTLIRMFI--LDNRLYIEYEAYGVGV-------ELDEMPQFYDA 296

Query: 191 AWPHDGL-QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                        S  +  +   RQG  +             VE GI+ + 
Sbjct: 297 IPEVRRWPIKGDSSRPETISWLSRQGFNIDAA----VKWQGSVEDGITYLR 343


>gi|149408241|ref|YP_001294520.1| hypothetical protein ORF012 [Pseudomonas phage M6]
          Length = 515

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/293 (11%), Positives = 77/293 (26%), Gaps = 62/293 (21%)

Query: 10  KWQSNTVHYVWFDEEPPEDV-----YFEGLTRINATQGLVTLTLTPLK---GRSPIIEHY 61
            +  +   ++ ++E                 R            T      G + +   +
Sbjct: 157 NYHGHAYPWIGWEELCNWADDKCYTVMMSCCRSTKPGMPRCYRATTNPYGPGHNWVKARF 216

Query: 62  LSAS---------------SSDRQVIRMTINETP---HYNEQERKRIIDS-YPLHEREAR 102
                                 R  I  +I E     H + +   +I  +     E  A 
Sbjct: 217 RLPHMRGRVILDAMRDGEREPPRVAIHGSIYENQILLHADPEYISKIRAAARNPSELAAW 276

Query: 103 TKGEPILGSGRIFPIVEEDIVINSLD-----IPEHWVQIGGMDFGWHHPFAAGHLV---- 153
             G   + +G +F  +    V          IP+ W      D+G   PFA         
Sbjct: 277 LHGSWDIIAGGMFDDIYRGDVHVVPSVPLSVIPKRWKIDRSFDWGSSKPFAVLWWAESNG 336

Query: 154 ---------WNRDSDVIYVVKNYRC----REQTPIFHVAALKSWGKWLPWAWPHDGLQH- 199
                    + +    +Y+++ +      R +      + +    K     W  +G    
Sbjct: 337 EPFEWNGRVYGKVRGDLYLIQEWYGWNGTRNEGVRMLASEVAQGVKDREEDWALEGRVKP 396

Query: 200 --------DKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
                   D  +G  ++    ++G++  P       G    + G   +   ++
Sbjct: 397 GPADSSIFDVENGNSIAVDMEKKGVRWTPAD----KGPGSRKQGWEQIRKLLK 445


>gi|317485514|ref|ZP_07944391.1| phage terminase [Bilophila wadsworthia 3_1_6]
 gi|316923194|gb|EFV44403.1| phage terminase [Bilophila wadsworthia 3_1_6]
          Length = 434

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/251 (11%), Positives = 62/251 (24%), Gaps = 23/251 (9%)

Query: 9   DKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
           D    +  + + F E        +      +    G      T          +  +A  
Sbjct: 121 DTLVGSPPYGIVFSEYSLTNPLSWAYLKPILEENGGWAIFNFTSRGRNHAATLYEYAAGE 180

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSY--------PLHEREARTKGEPILGSGRIFP-- 116
                 R+ + ET  +  ++ + I                       +        +   
Sbjct: 181 ESWFAQRLPVTETSVFTPEQVEEIRKEMHRTYGEEDGEALFRQEYMCDLDAPVVGAYYGK 240

Query: 117 ---IVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
                 ++  I  +            D G     A    V       I+++  Y    Q 
Sbjct: 241 LLARAADEGRITGVPYDPAAPVFTAWDLGMDDSTAI--WVAQCVGREIHLIDYYEANGQP 298

Query: 174 PIFHVAALKSWGKWLPWAW-PHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGV 232
              +   ++  G   P  + PHD    +  +G+         G+ + P           V
Sbjct: 299 LAHYADWVRGRGYGRPTHYLPHDARARELGTGKSREEVL--AGLDIGPVLVVPQQ---SV 353

Query: 233 EAGISDMLDRM 243
             GI+ +   +
Sbjct: 354 ADGINAVRTIL 364


>gi|260596962|ref|YP_003209533.1| hypothetical protein CTU_11700 [Cronobacter turicensis z3032]
 gi|260216139|emb|CBA28942.1| hypothetical protein CTU_11700 [Cronobacter turicensis z3032]
          Length = 409

 Score = 73.7 bits (179), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/230 (13%), Positives = 65/230 (28%), Gaps = 19/230 (8%)

Query: 18  YVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      + +T  P +  S     Y      D   + M 
Sbjct: 127 LCWVDEAETVSEVAWQKLDPTVREDDSEIWVTWNPERDGSATDRRYRKEPGDDCITVEMN 186

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
             + P +    E  R++              +G  +  S +     +  +   S ++ + 
Sbjct: 187 YIDNPWFPRVLEGVRRKDQKRLDPATYAWVWEGAYLENSNKQVLAGKYRVAEFSDELWKE 246

Query: 133 WVQ-IGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPW 190
             +   G DFG+   P            + +Y+      ++       A           
Sbjct: 247 AERLFFGADFGFAKDPNTLVRSFI--LHNRLYIEYEAYGQQTELDHMPAL-----YDTVP 299

Query: 191 AWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                 ++ D    E +S   +RQG  +             VE GI+ + 
Sbjct: 300 GAREWPIKADSARPETIS-YLKRQGFNISAAD----KWQGSVEDGIAHLR 344


>gi|294492319|gb|ADE91075.1| phage terminase, large subunit, PBSX family [Escherichia coli
           IHE3034]
          Length = 471

 Score = 73.3 bits (178), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|298381518|ref|ZP_06991117.1| phage terminase large subunit [Escherichia coli FVEC1302]
 gi|298278960|gb|EFI20474.1| phage terminase large subunit [Escherichia coli FVEC1302]
          Length = 470

 Score = 73.3 bits (178), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/210 (12%), Positives = 61/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S        E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-FKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGSDHYLWDGDGVGAGLRRQ 307


>gi|260868683|ref|YP_003235085.1| putative terminase large subunit [Escherichia coli O111:H- str.
           11128]
 gi|293446697|ref|ZP_06663119.1| phage terminase large subunit [Escherichia coli B088]
 gi|257765039|dbj|BAI36534.1| putative terminase large subunit [Escherichia coli O111:H- str.
           11128]
 gi|291323527|gb|EFE62955.1| phage terminase large subunit [Escherichia coli B088]
 gi|323177130|gb|EFZ62720.1| phage terminase, large subunit, PBSX family [Escherichia coli 1180]
          Length = 471

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|324019922|gb|EGB89141.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           117-3]
          Length = 471

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 61/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    +      +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKCIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|91211665|ref|YP_541651.1| terminase large subunit [Escherichia coli UTI89]
 gi|117624554|ref|YP_853467.1| phage terminase large subunit [Escherichia coli APEC O1]
 gi|218559279|ref|YP_002392192.1| Terminase large subunit [Escherichia coli S88]
 gi|91073239|gb|ABE08120.1| terminase large subunit [Escherichia coli UTI89]
 gi|115513678|gb|ABJ01753.1| phage terminase large subunit [Escherichia coli APEC O1]
 gi|148566126|gb|ABQ88401.1| phage terminase large subunit [Enterobacteria phage CUS-3]
 gi|218366048|emb|CAR03793.1| Terminase large subunit [Escherichia coli S88]
 gi|307626097|gb|ADN70401.1| terminase large subunit [Escherichia coli UM146]
 gi|323948780|gb|EGB44679.1| phage terminase large subunit [Escherichia coli H252]
          Length = 471

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|237704849|ref|ZP_04535330.1| terminase large subunit [Escherichia sp. 3_2_53FAA]
 gi|226901215|gb|EEH87474.1| terminase large subunit [Escherichia sp. 3_2_53FAA]
 gi|315288241|gb|EFU47640.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           110-3]
          Length = 471

 Score = 72.9 bits (177), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|218296139|ref|ZP_03496908.1| protein of unknown function DUF264 [Thermus aquaticus Y51MC23]
 gi|218243516|gb|EED10045.1| protein of unknown function DUF264 [Thermus aquaticus Y51MC23]
          Length = 426

 Score = 72.9 bits (177), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 34/250 (13%), Positives = 71/250 (28%), Gaps = 20/250 (8%)

Query: 12  QSNTVHYVWFDEEPPE----DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL-SASS 66
           +         DE         V+ E +      +       +  KGR+   E +  +   
Sbjct: 113 RGRAYDLAIIDEAAFAPSLARVWEEAILPTLLDRLGSAWIASTPKGRNAFYELWNLTLDD 172

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED---IV 123
                     +  P  +++E  R+  +            E +   GR+F     +   ++
Sbjct: 173 PAWAHFHEPSHRNPFLSQEELARMAATMTRERYRQEILAEWVDAEGRVFSEDALEAALLL 232

Query: 124 INSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT-PIFHVAALK 182
               D         G+D      + A  ++       +  V+ +R    T     VAAL 
Sbjct: 233 QGPEDPRPGERYAAGVDLARSQDYTAVAVLRLGAQLELVRVERWRGLSYTLTARKVAALL 292

Query: 183 SWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT--FDDG--SNGVEAGISD 238
           +        +           G+      R +  ++ P   T   DDG  +   E  +  
Sbjct: 293 AR-------YEAYAHVDATGVGDAAWEGIRAEWPRVRPIRITGGRDDGRETRSKENLVGR 345

Query: 239 MLDRMRSGRW 248
           +   + +   
Sbjct: 346 LQSALETQEL 355


>gi|68250076|ref|YP_249188.1| phage terminase large subunit [Haemophilus influenzae 86-028NP]
 gi|68058275|gb|AAX88528.1| predicted phage terminase large subunit [Haemophilus influenzae
           86-028NP]
          Length = 447

 Score = 72.9 bits (177), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/227 (10%), Positives = 59/227 (25%), Gaps = 12/227 (5%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++       + + 
Sbjct: 116 IDVVWVEEGENVSKESWDILIPTIREDGSQIIVSFNPKNILDDTYQRFVIHPPERCKSVL 175

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVINSLDIPE 131
           +   + P++ ++  + +               +GEP+  S                 +  
Sbjct: 176 VNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIECAVDAHLKL 235

Query: 132 HWVQIGGMDFGWH--------HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
            +   G    G+         +  A  H     D +V           +T    V     
Sbjct: 236 GFTAKGMKKVGFDVADEGADSNDNAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKAD 295

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
              +           H KR  + L  +    G  +      +  G  
Sbjct: 296 LIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKK 342


>gi|260856407|ref|YP_003230298.1| putative terminase large subunit [Escherichia coli O26:H11 str.
           11368]
 gi|257755056|dbj|BAI26558.1| putative terminase large subunit [Escherichia coli O26:H11 str.
           11368]
          Length = 470

 Score = 72.9 bits (177), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/213 (13%), Positives = 59/213 (27%), Gaps = 19/213 (8%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S       E     
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKRE----- 219

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSD---VIYVVKNYRCREQTPIFHVAAL 181
                            GW    A        D+      Y  ++    ++     +  +
Sbjct: 220 -----WLEAATDAHTKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDI 274

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
                W       DG  H    G+ + A  RRQ
Sbjct: 275 NEGADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|268589862|ref|ZP_06124083.1| phage terminase, large subunit, PBSX family [Providencia rettgeri
           DSM 1131]
 gi|291314845|gb|EFE55298.1| phage terminase, large subunit, PBSX family [Providencia rettgeri
           DSM 1131]
          Length = 470

 Score = 72.9 bits (177), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/210 (15%), Positives = 60/210 (28%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   V   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--VDVCWVEEAEAVTKESWDILIPTIRKPNSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++     + PH+ +  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTANYTDNPHFPDVLRLEMEECKRKNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P   G            VVK            +  +   
Sbjct: 224 ATDAHKKLGWKAKGAIIATHDPSDVGGDAKGYAMRHGSVVKRIS------EGLLMDVNDG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ L A  RRQ
Sbjct: 278 ADWATEKAIQDGADHFLWDGDGLGAALRRQ 307


>gi|207270776|ref|YP_002261418.1| gp2 [Listeria phage P40]
 gi|204307991|gb|ACI00362.1| gp2 [Listeria phage P40]
          Length = 430

 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 34/243 (13%), Positives = 63/243 (25%), Gaps = 25/243 (10%)

Query: 18  YVWFDEEPPEDVYFEGLTRIN--------ATQGLVTLTLTPL-KGRSPIIEHYLSASS-S 67
           Y+ ++E        E  T             + LV     P       + +H +S     
Sbjct: 140 YLIYEEAEQFSNADEMETITVSWLRGDYGDIKPLVFYCYNPPKFRGHWLNKHVVSLRHSP 199

Query: 68  DRQVIRMTINET-----PHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDI 122
           +  V   T             E   +R +    L+    R                  + 
Sbjct: 200 NDLVHHSTFVAVANSHPEWLGEAFLRRALALKKLNPNRYRHVFLGEDVMTGNEVFPNLEY 259

Query: 123 VINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAAL 181
                    H     G D G+   P     + ++R  D +Y+VK               +
Sbjct: 260 RPIDPSEYHHLTPHEGFDEGYTTDPSVWLQVYYDRKRDTLYIVKEVFLYHAKTKVIAETI 319

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
           +   +       HD       +  ++  +    G+           G   V+ GI  + D
Sbjct: 320 RRKQEG-----KHDTEIKGDSANPRVLDELEEYGLY----TYGVKKGKGSVDHGIKWLSD 370

Query: 242 RMR 244
           R +
Sbjct: 371 RTK 373


>gi|222032743|emb|CAP75482.1| Terminase large subunit [Escherichia coli LF82]
          Length = 470

 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|150021340|ref|YP_001306694.1| hypothetical protein Tmel_1462 [Thermosipho melanesiensis BI429]
 gi|149793861|gb|ABR31309.1| protein of unknown function DUF264 [Thermosipho melanesiensis
           BI429]
          Length = 421

 Score = 72.5 bits (176), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 27/216 (12%), Positives = 61/216 (28%), Gaps = 14/216 (6%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRI-NATQGLVTLTLTPLKGRSPII 58
           ++        +   V+ V   E     + VY + +T +   T   V L  TP  G +   
Sbjct: 119 RSTAHNGKYLRGRKVNLVVLTEAAFIKDSVYEQVITPMKLDTGAPVILESTPN-GMNYFY 177

Query: 59  EHYLS--ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFP 116
           E Y     +         T+ + P  +++E +      P +        E +      FP
Sbjct: 178 EEYQRGLKNKKHTISFHATVYDNPFLDQEEIENAKAKTPDYVWRQEYLAEFVDDDTVFFP 237

Query: 117 IVEEDIVINSLDI---PEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
                            +      G+D   +  +    ++ +   +   + + +R  +  
Sbjct: 238 WKILVEAFEDYKPEGYKDGRKYSIGVDLAKYRDYTVIIVL-DVTEEPFKIAEFHRFNQIP 296

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSA 209
               +  +             D        G+ +S 
Sbjct: 297 YEEVIRIVNDLQAKYRAQVYLDA----TGVGDPISE 328


>gi|157159763|ref|YP_001457081.1| PBSX family phage terminase large subunit [Escherichia coli HS]
 gi|300935792|ref|ZP_07150755.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           21-1]
 gi|157065443|gb|ABV04698.1| phage terminase, large subunit, pbsx family [Escherichia coli HS]
 gi|300459025|gb|EFK22518.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           21-1]
          Length = 471

 Score = 72.5 bits (176), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINDG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|13559866|ref|NP_112076.1| terminase large subunit [Enterobacteria phage HK620]
 gi|13517602|gb|AAK28891.1|AF335538_43 terminase large subunit [Salmonella phage HK620]
          Length = 470

 Score = 72.5 bits (176), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|41057280|ref|NP_958178.1| gene 2 protein [Enterobacteria phage Sf6]
 gi|191165541|ref|ZP_03027382.1| phage terminase, large subunit, pbsx family [Escherichia coli B7A]
 gi|218695968|ref|YP_002403635.1| Terminase large subunit [Escherichia coli 55989]
 gi|331678314|ref|ZP_08378989.1| phage terminase, large subunit, PBSX family [Escherichia coli H591]
 gi|33334159|gb|AAQ12192.1| gene 2 protein [Shigella phage Sf6]
 gi|190904464|gb|EDV64172.1| phage terminase, large subunit, pbsx family [Escherichia coli B7A]
 gi|218352700|emb|CAU98482.1| Terminase large subunit [Escherichia coli 55989]
 gi|324114096|gb|EGC08069.1| phage terminase large subunit [Escherichia fergusonii B253]
 gi|331074774|gb|EGI46094.1| phage terminase, large subunit, PBSX family [Escherichia coli H591]
          Length = 470

 Score = 72.5 bits (176), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|66392134|ref|YP_239275.1| putative phage terminase large subunit [Xanthomonas phage Xp15]
 gi|62529244|gb|AAX84927.1| putative phage terminase large subunit [Xanthomonas phage Xp15]
          Length = 473

 Score = 72.5 bits (176), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/315 (10%), Positives = 74/315 (23%), Gaps = 70/315 (22%)

Query: 3   AYEQGRDKWQSNTVHYVWFDEEPPEDV----YFEGLTRINATQG---------LVTLTLT 49
            +E      Q   + ++  DE          +     R+ +             +  T  
Sbjct: 109 QFENDIYTHQGAQIGFLIIDEATHFTPPMIRFIRSRVRLGSMIIPPKWKALFPRILYTAN 168

Query: 50  PLKGRSPIIEH----------YLSASSSD---RQVIRMTINETPHY---NEQERKRIIDS 93
           P        +           + +        R+ I   + +       +   R R+   
Sbjct: 169 PGGVGHHYFKSNFVDIGSGHVFQAPEDEGSMLREYIPAKLEDNKVMMETDPDYRARLKGM 228

Query: 94  YPLHEREARTKGEPIL--GSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGH 151
                 +A  +G+  +    G       +  V++   IP  W    G D+G   P A   
Sbjct: 229 GDSATVQAMLEGDWEVVSAGGIADLWRSKIHVVHPFKIPHTWKIDRGYDYGSSKPAAYLL 288

Query: 152 LV---------------WNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDG 196
                            W     V  + ++Y   ++     + A++   +   +      
Sbjct: 289 FAESDGSEFRDQQGRVCWVPAGTVFVIGEDYIANKRQEGLRLTAIEQGRRMARYEAESGY 348

Query: 197 LQHDKRSG------------EQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR-- 242
               +                 ++      G+                  G+     R  
Sbjct: 349 QNRIQPGPADNAIFSAEPGHRTVADDIGIHGVTFTRSNKN----PGSRIEGLQLFRTRLK 404

Query: 243 ------MRSGRWKVF 251
                 M +  + VF
Sbjct: 405 AATERPMENPGFFVF 419


>gi|325497784|gb|EGC95643.1| gene 2 protein [Escherichia fergusonii ECD227]
          Length = 470

 Score = 72.5 bits (176), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|323936486|gb|EGB32774.1| phage terminase large [Escherichia coli E1520]
          Length = 470

 Score = 72.1 bits (175), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|158422462|ref|YP_001523754.1| putative DNA packaging protein GP3 [Azorhizobium caulinodans ORS
           571]
 gi|158329351|dbj|BAF86836.1| putative DNA packaging protein GP3 [Azorhizobium caulinodans ORS
           571]
          Length = 203

 Score = 72.1 bits (175), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 38/61 (62%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K+Y+QGR K+Q    H VW DEEPP DVY E L R+  T GL+  T TPL+G + I   
Sbjct: 137 FKSYDQGRKKFQGTAKHVVWLDEEPPADVYQEALMRLMTTSGLMLCTFTPLEGMTDIAAQ 196

Query: 61  Y 61
           +
Sbjct: 197 F 197


>gi|168260952|ref|ZP_02682925.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|205349913|gb|EDZ36544.1| phage terminase, large subunit, pbsx family [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
          Length = 471

 Score = 72.1 bits (175), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 63/210 (30%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I  T   + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKTFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|291334416|gb|ADD94071.1| hypothetical protein GobsU_33659 [uncultured phage
           MedDCM-OCT-S04-C1035]
 gi|291334470|gb|ADD94124.1| hypothetical protein GobsU_33659 [uncultured phage
           MedDCM-OCT-S04-C1161]
          Length = 223

 Score = 72.1 bits (175), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 18/155 (11%), Positives = 44/155 (28%), Gaps = 9/155 (5%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
             D  +   +     DE    D  ++ E +   ++  +G      TP    +   + Y  
Sbjct: 61  NSDGLRGIYLDGCVIDEYANIDGKLFAEIIRPALSDRKGYCVFIGTPAGMNNNFYDLYQH 120

Query: 64  -ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGS-----GRIFPI 117
              + D    +   ++T   + +E ++  +     +     + + I        G     
Sbjct: 121 ANGAEDWFNYKAKASDTKIVDPEELEKAKEVMGEKKYLQEFECDWIANIEGAIYGEEIAK 180

Query: 118 VEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHL 152
           +E+   I  +            D G     +    
Sbjct: 181 IEDKNQIARVPYDPTLPVSTAWDLGVADHSSIIFF 215


>gi|194015756|ref|ZP_03054372.1| phage terminase, large subunit, pbsx family [Bacillus pumilus ATCC
           7061]
 gi|194013160|gb|EDW22726.1| phage terminase, large subunit, pbsx family [Bacillus pumilus ATCC
           7061]
          Length = 438

 Score = 72.1 bits (175), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 67/227 (29%), Gaps = 35/227 (15%)

Query: 24  EPPEDVYFEGLTRINAT--QGLVTLTLTPLKGRSPIIEHYLSASSSDR------------ 69
           E   + + E L R+        + L+  P+   +    H+     ++R            
Sbjct: 129 EVKYEGFKELLGRLRHPTLDLHMILSTNPVGQDNWTYRHFFKDDQNNRFILDDERLYKER 188

Query: 70  -------QVIRMTINETPHYNEQERKRI--IDSYPLHEREARTKGEPILGSGRIFPIVEE 120
                       T  +         K++  +  Y         KG   +   R+ P  + 
Sbjct: 189 TIAINDTYYHHSTAEDNLFLPVSYIKQLDELKEYDPDLYRIARKGHFGINGIRVLPQFKV 248

Query: 121 DIVINSLDIPEHWVQI---GGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIF 176
               + +    +  +     GMDFG+     A   L  + +   +Y+   Y  R +T   
Sbjct: 249 QPHEDVMMAISNINRPLLRAGMDFGFVDSYNAVVRLAVDHEKKYLYIYWEYYDRGKTDDV 308

Query: 177 HVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
            V  LK + +                  + ++  +R+ G  M+    
Sbjct: 309 TVEDLKEFVETKELI-------KADNEQKTIA-YFRKMGYNMVAAHK 347


>gi|326203479|ref|ZP_08193343.1| hypothetical protein Cpap_1523 [Clostridium papyrosolvens DSM 2782]
 gi|325986299|gb|EGD47131.1| hypothetical protein Cpap_1523 [Clostridium papyrosolvens DSM 2782]
          Length = 429

 Score = 72.1 bits (175), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 44/274 (16%), Positives = 78/274 (28%), Gaps = 54/274 (19%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED----VYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHY 61
              K+QS     +  DE    D     Y +   R  N     + ++  P       ++  
Sbjct: 66  DVSKYQSAEYDIIRIDEGTHMDEARITYMKSRIRGANGYPKQMKISTNPGGIGHKFLKKR 125

Query: 62  LSASSSD---------------------RQVIRMTINETPHYNEQE--RKRIIDSYPLHE 98
                 +                     R  I   + +     E++      +   P  E
Sbjct: 126 FRIGVENENEIFTDYVGKDKNGVDRYITRCYIPAKVYDNIFLMEKDPNYITNLMQLPERE 185

Query: 99  REARTKGEPILGSGRIFPIVEEDIVINSLD-------IPEHWVQIGGMDFGWHHPFAAGH 151
           R+A  +G   +   + FP  + DI     +       IP+HW +    D G+  PFA   
Sbjct: 186 RDALLEGSWDIFDDQAFPEFDPDIHTYDPEKTFKNGQIPKHWKRWRSADNGYDDPFAFYW 245

Query: 152 LVWNRDSDVIYVVKNYRCREQTPIFHVA-----------------ALKSWGKWLPWAWPH 194
              + +   ++  + Y   E+ P                       L    K L     H
Sbjct: 246 HAID-EHGHVWTYREYTRSEKDPKVAYKDQAAEVVSRSTYLNEETGLLEPEKILYTVIGH 304

Query: 195 DGLQHDKR-SGEQLSAQYRRQGMKMLPECATFDD 227
           D    ++R   + +   Y   G+      AT   
Sbjct: 305 DAFFSNERLDAKSIEEFYNEGGLYGFVPTATDRK 338


>gi|262039737|ref|ZP_06013017.1| phage terminase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259042904|gb|EEW43895.1| phage terminase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 432

 Score = 72.1 bits (175), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 30/245 (12%), Positives = 72/245 (29%), Gaps = 27/245 (11%)

Query: 18  YVWFDEEPPEDV--YFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE        + +    +      + +T  P K  S   + +         ++ M 
Sbjct: 127 VAWVDEAESVSATAWKKLRPTVRENGSEIWVTWNPEKDGSATDKLFRKNPPKSSMIVEMN 186

Query: 76  INETPHYNE---QERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P + +   +ER   +++    +     +G  +  S +     +  +     D+ + 
Sbjct: 187 YSDNPWFPDVLEEERLEDLENLDYADYAWIWEGAYLENSDKQVLANKYVVQSFEDDLWKK 246

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV-----------AA 180
             + + G DFG+    +    ++  D++ +Y+                            
Sbjct: 247 SERLLFGADFGFAKDPSTLIRMFILDNN-LYIEYEAYGNGVELDDMWKFYAGKTDATPKQ 305

Query: 181 LKSW----GKWLPWAWPHDGL-QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           L+ W        P              S  +  +  + QG  +             VE G
Sbjct: 306 LEDWRVTDEAKFPGIPEARKWPIKADNSRPETISHIKGQGFNISAA----QKWQGSVEDG 361

Query: 236 ISDML 240
           I+ + 
Sbjct: 362 ITCLR 366


>gi|260580755|ref|ZP_05848581.1| phage terminase large subunit [Haemophilus influenzae RdAW]
 gi|260092572|gb|EEW76509.1| phage terminase large subunit [Haemophilus influenzae RdAW]
          Length = 447

 Score = 71.7 bits (174), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 24/227 (10%), Positives = 59/227 (25%), Gaps = 12/227 (5%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++       + + 
Sbjct: 116 IDVVWVEEGENVSKESWDILIPTIREDGSQIIVSFNPKNILDDTYQRFVIHPPERCKSVL 175

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVINSLDIPE 131
           +   + P++ ++  + +               +GEP+  S                 +  
Sbjct: 176 VNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIEYAVDAHLKL 235

Query: 132 HWVQIGGMDFGWH--------HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
            +   G    G+         +  A  H     D +V           +T    V     
Sbjct: 236 GFTAKGMKKVGFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKAD 295

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
              +           H KR  + L  +    G  +      +  G  
Sbjct: 296 LIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKK 342


>gi|300897414|ref|ZP_07115839.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           198-1]
 gi|300358826|gb|EFJ74696.1| phage terminase, large subunit, PBSX family [Escherichia coli MS
           198-1]
          Length = 470

 Score = 71.7 bits (174), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGSDHYLWDGDGVGAGLRRQ 307


>gi|209548746|ref|YP_002280663.1| phage terminase, large subunit, PBSX family [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534502|gb|ACI54437.1| phage terminase, large subunit, PBSX family [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 424

 Score = 71.7 bits (174), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 33/254 (12%), Positives = 71/254 (27%), Gaps = 22/254 (8%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSA 64
                +  T   +W +E            +  I      +  +  P    +P+ +  +  
Sbjct: 107 SIKSLEGATK--LWIEEGQNITNGTLNNVIPTIRTEGSEIWTSFNPSVIEAPVWQRLVVK 164

Query: 65  SSSDRQVIRMTINETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE- 120
              D  V+++  N+ P +    E+ER+    +      +   +G P+  +       E  
Sbjct: 165 PPPDSVVVKVNHNDNPWFPKVLEEERRHHFVTMDRATYDNIWEGVPMAFTAGAIFREEMA 224

Query: 121 ---------DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE 171
                     +  +          +G    G   P A    V   +   +  +  +    
Sbjct: 225 AMEKQGRIGKVPHDPTKPVIAVFDMGHAASGKGDPHAIT-FVQQGNGTAVNAIGYWEGNN 283

Query: 172 QT-PIFHVAALKSWGKWL-PWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGS 229
           +  P      L      +     PHD  + +  +G+         G  +     T  D  
Sbjct: 284 KPLPTVVQEELIGRPYTISKVVMPHDANRTNSHTGKTDVEIVEGFGFTVEMLERTN-DLD 342

Query: 230 NGVEAGISDMLDRM 243
             V   +  +L  M
Sbjct: 343 RDVNN-LRTVLPLM 355


>gi|168239626|ref|ZP_02664684.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197287704|gb|EDY27095.1| phage terminase, large subunit, pbsx family protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
          Length = 470

 Score = 71.3 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 62/210 (29%), Gaps = 13/210 (6%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILVPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSW 184
            +    +   +  G     H P               Y  ++    ++     +  +   
Sbjct: 224 ATDAHKKLGWKAKGAVVSAHDPS------DTGPDAKGYASRHGSVVKRIAEGLLMDINEG 277

Query: 185 GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
             W       DG  H    G+ + A  RRQ
Sbjct: 278 ADWATSLAIEDGADHYLWDGDGVGAGLRRQ 307


>gi|261402679|ref|YP_003246903.1| protein of unknown function DUF264 [Methanocaldococcus vulcanius
           M7]
 gi|261369672|gb|ACX72421.1| protein of unknown function DUF264 [Methanocaldococcus vulcanius
           M7]
          Length = 437

 Score = 71.3 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/262 (11%), Positives = 70/262 (26%), Gaps = 24/262 (9%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRIN-ATQGLVTLTLTPLKGRSPI 57
            ++ +      +  + H V  DE     +DV    +  +       +    TP       
Sbjct: 130 FRSAD-NPTSIRGESYHLVILDEAAFIKDDVVKYVIKPLLIDYDAPLIEISTPNGHNHFY 188

Query: 58  IEHYLSASSSDRQV-IRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRI 114
               +  +  +R +  R      P   +   + I   +       +     E I     +
Sbjct: 189 ESFLMGENRQNRHISFRFPTWSNPFLPKSVIEEIKREFGEDSLVWKQEFCAEFIDDQDAV 248

Query: 115 FPIVEEDIVINSLDI-----PEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRC 169
           F        I+S         +    + G+D   +  +    ++   ++    V    R 
Sbjct: 249 FKWEYIQQCIDSNIELLTVGEKGHRYVMGVDLAKYQDYTVIIILDVSENPYKLVYFE-RF 307

Query: 170 REQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGS 229
           +++   + V  +K            D        G+ +  Q        +P   T     
Sbjct: 308 KDKPYSYVVERIKELYIKFKPVVCVDS----TGVGDPVVEQLED--CNPIPFKFTNQ--- 358

Query: 230 NGVEAGISDMLDRMRSGRWKVF 251
                 I+ +   +      +F
Sbjct: 359 -SKMQLITKLQTALERKEV-IF 378


>gi|16273317|ref|NP_439561.1| terminase large subunit-like protein [Haemophilus influenzae Rd
           KW20]
 gi|1175785|sp|P44184|Y1410_HAEIN RecName: Full=Uncharacterized protein HI_1410
 gi|1574247|gb|AAC23058.1| predicted coding region HI1410 [Haemophilus influenzae Rd KW20]
          Length = 394

 Score = 71.3 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/227 (10%), Positives = 59/227 (25%), Gaps = 12/227 (5%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++       + + 
Sbjct: 63  IDVVWVEEGENVSKESWDILIPTIREDGSQIIVSFNPKNILDDTYQRFVIHPPERCKSVL 122

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVINSLDIPE 131
           +   + P++ ++  + +               +GEP+  S                 +  
Sbjct: 123 VNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIEYAVDAHLKL 182

Query: 132 HWVQIGGMDFGWH--------HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
            +   G    G+         +  A  H     D +V           +T    V     
Sbjct: 183 GFTAKGMKKVGFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKAD 242

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
              +           H KR  + L  +    G  +      +  G  
Sbjct: 243 LIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKK 289


>gi|282878109|ref|ZP_06286910.1| phage terminase, large subunit, PBSX family [Prevotella buccalis
           ATCC 35310]
 gi|281299767|gb|EFA92135.1| phage terminase, large subunit, PBSX family [Prevotella buccalis
           ATCC 35310]
          Length = 423

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/254 (11%), Positives = 72/254 (28%), Gaps = 44/254 (17%)

Query: 15  TVHYV---WFDEE---PPEDVYFEGLTRINATQ--GLVTLTLTPLKGRSPIIEHYLSASS 66
           ++H +     DE      E  +   +  I        + + + P      + + ++  + 
Sbjct: 120 SIHGITTFVVDEAEEWVSEKEFETIMLSIRQKGIQNRIFIIMNPTDNNHWVYKRFIENTH 179

Query: 67  SDRQV---------------IRMTINET-PHYNEQERKRIIDSYPLHEREARTKGEPILG 110
            +                  I  T  +   + +++    + D    +  +          
Sbjct: 180 KEVMYDGIPVQISTHPNVLHIHTTYLDNLENLSQEFINEVEDMKANNPEKYAHTVMGRWA 239

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHP--FAAGHLVWNRDSDVIYVVKNYR 168
                 + +   V+             G+DFG+ +    A    + +   D +YV + + 
Sbjct: 240 DVAEGAVFKHIGVVKEFPKW-CKKVAIGLDFGYTNDVSAAMMCGMID---DNLYVDELFY 295

Query: 169 CREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
                    + AL  +                  +  +L  +    G+K+ P     + G
Sbjct: 296 RTNMLSSDLIKALHRYEMK----------VFSDSADPRLVQEIHNGGIKIYP----VEKG 341

Query: 229 SNGVEAGISDMLDR 242
           +  + AGI  M   
Sbjct: 342 AGSIIAGIDKMKSL 355


>gi|238027682|ref|YP_002911913.1| gp2 [Burkholderia glumae BGR1]
 gi|237876876|gb|ACR29209.1| gp2 [Burkholderia glumae BGR1]
          Length = 489

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/251 (13%), Positives = 65/251 (25%), Gaps = 34/251 (13%)

Query: 19  VWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPII-----------EHYLSAS 65
            W DE      + +   L  I      + ++  P +   P             +      
Sbjct: 169 AWVDEAENVSRESWDVLLPTIREPGSEIIVSFNPNRENDPTWADLVGPYVDRLDEDGCYE 228

Query: 66  SSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
            +D  +IR    + P + E+                R              I      + 
Sbjct: 229 DADTLIIRANYTDNPWFTEELELERAKMERTDLDRYRWIWLGKFNRRSDELIFAGKWRVE 288

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHV------- 178
            ++ P +     G D+G+       +  W R +D+I   + +  +               
Sbjct: 289 DIEAPPNTRFFFGADWGFAVDPTTLNRCWVRGNDLIIDYEAHGKQVDLDEIWKLFAGREG 348

Query: 179 ---AALKSW----GKWLPWAWPHDGL--QHDKRSGEQLSAQYRRQGMKMLPECATFDDGS 229
                +K W        P          + D    E +S   ++ G  +           
Sbjct: 349 MRPEQIKQWKPVDEFKYPGIPGARKWKIKADCARPETISHVAKQ-GFNIDAA----KKWG 403

Query: 230 NGVEAGISDML 240
             VE GI+ + 
Sbjct: 404 GSVEDGIAFLR 414


>gi|206599988|ref|YP_002242062.1| gp5 [Mycobacterium phage Konstantine]
 gi|206287076|gb|ACI12421.1| gp5 [Mycobacterium phage Konstantine]
          Length = 569

 Score = 71.0 bits (172), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/289 (12%), Positives = 72/289 (24%), Gaps = 57/289 (19%)

Query: 6   QGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           Q  D      +  V  DE     E V+ + L    A         T  +G++ I + Y+ 
Sbjct: 144 QDPDSLVGEALSGVHLDEAAKMKEIVWTQMLMPSLADFKGWARFTTTPEGKNWIYDTYMD 203

Query: 64  ASSS---------------------------------------DRQVIRMTINETPHYN- 83
           A                                          D +++  T++E P    
Sbjct: 204 AIKPHKQGWNAFRIPSWYNTGYGALHGDPDGPQPPYPEPTIDTDVKILTRTMDENPGLTA 263

Query: 84  -----------EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN--SLDIP 130
                      + E  +  DS  +         E     G++F   + +           
Sbjct: 264 FEVAKAMNLTIDSEILQQADSNTIATFNQEFAAEFTDFVGKVFKGFDAETHCRRLPFHRE 323

Query: 131 EHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPW 190
             W  +  +D+G+ +P     +        I ++         P      +         
Sbjct: 324 SSWETVACVDYGFSNPNVWLLVQIGP-WGEINIINELYQENLAPDEFADEILRRDLLPDS 382

Query: 191 AWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDM 239
                         + L   +R+ G ++     T  D  N     I  +
Sbjct: 383 CTSFYPDPALPGYTKTLETIFRKAGKRVRARPHTGGD-LNDRLNLIRAV 430


>gi|256826731|ref|YP_003150690.1| phage terminase, large subunit, PBSX family [Cryptobacterium curtum
           DSM 15641]
 gi|256582874|gb|ACU94008.1| phage terminase, large subunit, PBSX family [Cryptobacterium curtum
           DSM 15641]
          Length = 426

 Score = 70.6 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/226 (12%), Positives = 57/226 (25%), Gaps = 22/226 (9%)

Query: 20  WFDEEPPEDVYF--EGLTRINATQGLVTLTL---TPLKGRSPIIEH--YLSASSSDRQVI 72
           WF+E    + +       R     G    T     P +     +              V 
Sbjct: 132 WFEELDEFNGWDDISSTLRTYRRGGSRFWTFYSYNPPRSLWSWVNKKALEMQRKRGCVVD 191

Query: 73  RMTINET------PHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
             T  +           E+  +        H         GE I G+G         + +
Sbjct: 192 HSTYLDVIDGGHSDWLGEKFIEDADYEKEEHPTGYRWEFLGE-ITGTGGSVFENVVQVSL 250

Query: 125 NSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
           +  ++        G+D+GW   P+      W      + + +       TP    A ++ 
Sbjct: 251 SDKEVESFDNLRCGVDWGWFPDPWRFVMCEWQPARRRLVLFRELSANRTTPQDTGAMVRE 310

Query: 184 W-----GKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECAT 224
                  +     +  D +  D      +    R+ G+        
Sbjct: 311 ALTYRDARHKEPTYHRDAVWCDSAEPSSIDIYRRQCGLNARAADKG 356


>gi|213157748|ref|YP_002320546.1| terminase [Acinetobacter baumannii AB0057]
 gi|213056908|gb|ACJ41810.1| terminase [Acinetobacter baumannii AB0057]
 gi|323517214|gb|ADX91595.1| putative phage terminase [Acinetobacter baumannii TCDC-AB0715]
          Length = 323

 Score = 70.6 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/250 (14%), Positives = 77/250 (30%), Gaps = 31/250 (12%)

Query: 8   RDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINATQGLVTL---TLTPLKGRSPII 58
                   + +   DE         +  + + + R+   Q  +       T  +G     
Sbjct: 4   PATIVGFKIGHALIDELDVMAKVKAQQAWRKIIARMRYKQAGLLNGIDVATTPEGFKFTY 63

Query: 59  EHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKGEPI-LG 110
           E ++  ++          +I+ +  +   +  +     + +SYP     A  +G+ + L 
Sbjct: 64  EQFVKEANKSEAKRKLYGMIQASTYDNEANLPDDYISSLYESYPPQLISAYLRGQFVNLT 123

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR 170
           SG ++P  +  +     +I +    + GMDF      A  +++          +      
Sbjct: 124 SGAVYPDFDRVLNHTDEEIKKGEPLLIGMDFNVLKMAAVVYVI---REGKPRALDELVGV 180

Query: 171 EQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPECATFDDG 228
             TP       + +        P    Q        E   A  ++ G K+          
Sbjct: 181 RDTPTMCQLINERFPDHDITVIPDASGQATSSKNFSESDHAILKKNGFKVE--------- 231

Query: 229 SNGVEAGISD 238
            NGV  GI D
Sbjct: 232 VNGVNPGIKD 241


>gi|169796738|ref|YP_001714531.1| putative phage terminase [Acinetobacter baumannii AYE]
 gi|169149665|emb|CAM87555.1| conserved hypothetical protein; putative phage terminase
           [Acinetobacter baumannii AYE]
          Length = 437

 Score = 70.6 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 81/256 (31%), Gaps = 25/256 (9%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINATQGLVTL---TLTPLK 52
           ++ E+         + +   DE         +  + + + R+   Q  +       T  +
Sbjct: 113 RSMEK-PATIVGFKIGHALIDELDVMAKVKAQQAWRKIIARMRYKQASLLNGIDVATTPE 171

Query: 53  GRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKG 105
           G     E ++  ++          +I+ +  +   +  +     + +SYP     A  +G
Sbjct: 172 GFKFTYEQFVKEANKSEAKRKLYGMIQASTYDNEANLPDDYISSLYESYPPQLISAYLRG 231

Query: 106 EPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
           + + L SG ++P  +  +     +I +    + GMDF      A  +++          +
Sbjct: 232 QFVNLTSGAVYPDFDRVLNHTDEEIKQGEPLLIGMDFNVLKMAAVVYVI---REGKPRAL 288

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHD--KRSGEQLSAQYRRQGMKMLPEC 222
                   TP       + +        P    Q    K   E   A  ++ G K+    
Sbjct: 289 DELVGVRDTPTMCYLIKERFPDHDITVIPDASGQATSSKGFSESDHAILKKNGFKVEVNG 348

Query: 223 ATF--DDGSNGVEAGI 236
                 D  N V A I
Sbjct: 349 VNPGIKDRINAVNAQI 364


>gi|146329916|ref|YP_001210224.1| BcepGomrgp04 [Burkholderia phage BcepGomr]
 gi|145321092|gb|ABP63575.1| BcepGomrgp04 [Burkholderia phage BcepGomr]
          Length = 510

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/293 (11%), Positives = 72/293 (24%), Gaps = 75/293 (25%)

Query: 17  HYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT- 75
            + + DE        + L        +V  T  P       ++      +    V++ T 
Sbjct: 161 DWPYIDEHG-----NQCLLP--EMPLMVFSTTNPYGPGHNWVKRQFIDIAPPGVVVKTTK 213

Query: 76  -----------------------INETPHYNEQERKRIIDSYPLHEREARTKGEPILGSG 112
                                    E  +   +    +      ++R+A   G+  + +G
Sbjct: 214 DVFNPRTQKREPVTKTQVRLFGSYKENIYLTPEYVAELESIKDPNKRKAWLHGDWNVVAG 273

Query: 113 RIFPIVEED--IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV----------------- 153
                +  +   V    +IP  W      D+G  HPF  G                    
Sbjct: 274 GAIDDLWREEVHVKPRFNIPASWRVDRSFDWGSTHPFYVGWWAEANGDTATITNPDGTET 333

Query: 154 -WNRDSDVIYVVKNYRCR---------EQTPIFHVAALKSWGKWL--------PWAWPHD 195
            W      + +   +            +         +K     L        P      
Sbjct: 334 YWTPARGSLILFHEWYGTEEIGTNKGLKLGAKAVAKGIKEIEAQLWRENRILTPVRAGPA 393

Query: 196 ---GLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRS 245
                   ++  + ++      G+   P   +    +N    G+  + DR+ +
Sbjct: 394 DGQIYNVIQKDVDTIAKVMEDNGVMWKPADKSAGARTN----GLQLLRDRLEA 442


>gi|148826888|ref|YP_001291641.1| phage terminase large subunit [Haemophilus influenzae PittGG]
 gi|148718130|gb|ABQ99257.1| predicted phage terminase large subunit [Haemophilus influenzae
           PittGG]
          Length = 366

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/227 (10%), Positives = 59/227 (25%), Gaps = 12/227 (5%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++       + + 
Sbjct: 116 IDVVWVEEGENVSKESWDILIPTIREDGSQIIVSFNPKNILDDTYQRFVIHPPERCKSVL 175

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVINSLDIPE 131
           +   + P++ ++  + +               +GEP+  S                 +  
Sbjct: 176 VNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIEYAVDAHLKL 235

Query: 132 HWVQIGGMDFGWH--------HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
            +   G    G+         +  A  H     D +V           +T    V     
Sbjct: 236 GFTAKGMKKVGFDVADEGADSNANAFVHGSVVLDIEVWKNGDVIDSANRTNQSAVKFKAD 295

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
              +           H KR  + L  +    G  +      +  G  
Sbjct: 296 LIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKK 342


>gi|215484220|ref|YP_002326447.1| Terminase-like family protein [Acinetobacter baumannii AB307-0294]
 gi|213985731|gb|ACJ56030.1| Terminase-like family protein [Acinetobacter baumannii AB307-0294]
          Length = 413

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 82/256 (32%), Gaps = 32/256 (12%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINATQGLVTL---TLTPLK 52
           ++ E+         + +   DE         +  + + + R+   Q  +       T  +
Sbjct: 89  RSMEK-PATIVGFKIGHALIDELDVMAKVKAQQAWRKIIARMRYKQAGLLNGIDVATTPE 147

Query: 53  GRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKG 105
           G     E ++  ++          +I+ +  +   +  +     + +SYP     A  +G
Sbjct: 148 GFKFTYEQFVKEANKSEAKRKLYGMIQASTYDNEANLPDDYISSLYESYPPQLISAYLRG 207

Query: 106 EPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
           + + L SG ++P  +  +     +I +    + GMDF      A  +++          +
Sbjct: 208 QFVNLTSGAVYPDFDRVLNHTDEEIKKGEPLLIGMDFNVLKMAAVVYVI---REGKPRAL 264

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPEC 222
                   TP       + +        P    Q        E   A  ++ G K+    
Sbjct: 265 DELVGVRDTPTMCQLINERFPDHDITVIPDASGQATSSKNFSESDHAILKKHGFKVE--- 321

Query: 223 ATFDDGSNGVEAGISD 238
                 +NGV  GI D
Sbjct: 322 ------TNGVNPGIKD 331


>gi|227113418|ref|ZP_03827074.1| Terminase large subunit [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 472

 Score = 69.8 bits (169), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/143 (13%), Positives = 44/143 (30%), Gaps = 7/143 (4%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   V   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--VDICWVEEAEAVTKESWDILIPTIRKPGSEIWVSFNPKNILDDTYQRFVVTPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            D  ++ +   + PH+ E  R  + +    +         GEP+  S     I  E +  
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASEMAI-IKREWLEA 223

Query: 125 NSLDIPEHWVQIGGMDFGWHHPF 147
            +    +   +  G     H P 
Sbjct: 224 ATDAHIKLGWKAKGAIVAAHDPS 246


>gi|224796473|ref|YP_002641230.1| phage terminase, large subunit, pbsx family [Borrelia spielmanii
           A14S]
 gi|224497687|gb|ACN53304.1| phage terminase, large subunit, pbsx family [Borrelia spielmanii
           A14S]
          Length = 450

 Score = 69.4 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/204 (9%), Positives = 57/204 (27%), Gaps = 10/204 (4%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E     ++   E L R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHKETLLEVLKRLRKGKSIIIFDTNPESPAHFFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQERK--RIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +    +    +  +    +     GE I+    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIETQEKLYKHSPAYKARVLYGEWIVNESSL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT--PIFHVAALKS 183
             +     + I           A   L    +    Y+ ++ +    +         +++
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERTFEKFYAYIYQDQKPVNDSLMLNSIQVLIEN 333

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQL 207
           +     +    D  + D    + +
Sbjct: 334 FNVNTVYIEERDSTKGDGILTKTI 357


>gi|291334530|gb|ADD94183.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C1201]
 gi|291334650|gb|ADD94297.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C695]
          Length = 223

 Score = 69.4 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/155 (10%), Positives = 44/155 (28%), Gaps = 9/155 (5%)

Query: 7   GRDKWQSNTVHYVWFDEEPPED--VYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLS 63
             D  +   +     DE    D  ++ E +   ++  +G      TP    +   + Y  
Sbjct: 61  NSDGLRGIYLDGCVIDEYANIDGKLFAEIIRPALSDRKGYCVFIGTPAGMNNNFYDLYQH 120

Query: 64  -ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGS-----GRIFPI 117
              + D    +   +ET   +++E  +  +     +     + + I        G     
Sbjct: 121 ANGAEDWFNYKAKASETKIVDQEELDKAKEVMGEKKYLQEFECDWIANIEGAIYGEEIAK 180

Query: 118 VEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHL 152
           +++   +  +            D G     +    
Sbjct: 181 LDDKKQLARVPYDPTLPVSTAWDLGVADHSSIIFF 215


>gi|301170180|emb|CBW29784.1| predicted phage terminase large subunit [Haemophilus influenzae
           10810]
          Length = 447

 Score = 69.4 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/230 (11%), Positives = 62/230 (26%), Gaps = 18/230 (7%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++       + + 
Sbjct: 116 IDVVWVEEGENVSKESWDILIPTIREDGSQIIVSFNPKNILDDTYQRFVIHPPERCKSVL 175

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVINSLDIPE 131
           +   + P++ ++  + +               +GEP+  S                 +  
Sbjct: 176 VNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKL 235

Query: 132 HWVQIGGMDFGWH--------HPFAAGHLVWNRDSDVI---YVVKNYRCREQTPIFHVAA 180
            +   G    G+         +  A  H     D +V    YV+       +T    V  
Sbjct: 236 GFTTKGMKKVGFDVADEGADSNANAFVHGSVVLDIEVWKNGYVID---SANRTNQSAVKF 292

Query: 181 LKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
                 +           H KR  + L  +    G  +      +  G  
Sbjct: 293 KADLIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKGKK 342


>gi|293608730|ref|ZP_06691033.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829303|gb|EFF87665.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 430

 Score = 69.4 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 81/256 (31%), Gaps = 32/256 (12%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINATQGLVTL---TLTPLK 52
           ++ E+         + +   DE         +  + + + R+   Q  +       T  +
Sbjct: 106 RSMEK-PATIVGFKIGHALIDELDVMAKVKAQQAWRKIIARMRYKQAGLLNGIDVATTPE 164

Query: 53  GRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKG 105
           G     E ++  ++          +I+ +  +   +  +     + +SYP     A  +G
Sbjct: 165 GFKFTYEQFVKEANKSEAKRKLYGMIQASTYDNEANLPDDYISSLYESYPPQLISAYLRG 224

Query: 106 EPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
           + + L SG ++P  +  +     +I +    + GMDF      A  +++          +
Sbjct: 225 QFVNLTSGAVYPDFDRVLNHTDEEIKKGEPLLIGMDFNVLKMAAVVYVI---REGKPRAL 281

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPEC 222
                   TP       + +        P    Q        E   A  ++ G K+    
Sbjct: 282 DELVGVRDTPTMCQLINERFPDHDITVIPDASGQATSSKNFSESDHAILKKNGFKVE--- 338

Query: 223 ATFDDGSNGVEAGISD 238
                  NGV  GI D
Sbjct: 339 ------VNGVNPGIKD 348


>gi|260556008|ref|ZP_05828228.1| PBSX family phage terminase, large subunit [Acinetobacter baumannii
           ATCC 19606]
 gi|260410919|gb|EEX04217.1| PBSX family phage terminase, large subunit [Acinetobacter baumannii
           ATCC 19606]
          Length = 435

 Score = 69.4 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 81/256 (31%), Gaps = 32/256 (12%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINATQGLVTL---TLTPLK 52
           ++ E+         + +   DE         +  + + + R+   Q  +       T  +
Sbjct: 111 RSMEK-PATIVGFKIGHALIDELDVMAKVKAQQAWRKIIARMRYKQAGLLNGIDVATTPE 169

Query: 53  GRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKG 105
           G     E ++  ++          +I+ +  +   +  +     + +SYP     A  +G
Sbjct: 170 GFKFTYEQFVKEANKSEAKRKLYGMIQASTYDNEANLPDDYISSLYESYPPQLISAYLRG 229

Query: 106 EPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
           + + L SG ++P  +  +     +I +    + GMDF      A  +++          +
Sbjct: 230 QFVNLTSGAVYPDFDRVLNHTDEEIKKGEPLLIGMDFNVLKMAAVVYVI---REGKPRAL 286

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPEC 222
                   TP       + +        P    Q        E   A  ++ G K+    
Sbjct: 287 DELVGVRDTPTMCQLINERFPDHDITVIPDASGQATSSKNFSESDHAILKKNGFKVE--- 343

Query: 223 ATFDDGSNGVEAGISD 238
                  NGV  GI D
Sbjct: 344 ------VNGVNPGIKD 353


>gi|257895570|ref|ZP_05675223.1| phage terminase [Enterococcus faecium Com12]
 gi|257832135|gb|EEV58556.1| phage terminase [Enterococcus faecium Com12]
          Length = 438

 Score = 69.4 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 41/246 (16%), Positives = 72/246 (29%), Gaps = 20/246 (8%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTL-TPLKGRSPIIEHYLSASSSDRQVI-RMTINETPH 81
              +D   E   R  A +    L    P     P +E       S R +    T N+ P 
Sbjct: 143 LLHKDFINECFRRTFAAEWRYHLGEQNPPAPNHPNLELLERFEKSGRFLFRHWTPNDNPI 202

Query: 82  YNEQERKRIIDSYPLHER--EARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGM 139
            +E+ +K + D     E   E    G  +L  G IF + ++      +            
Sbjct: 203 LSEERKKELFDELSSSEYLLERDWYGHRVLPQGVIFAMFDKKNKATEIKGNIVETFFTA- 261

Query: 140 DFGWHHPFAAGHLVWNRDSDVIYVVKN--YRCREQTP------IFHVAALKSWGKWLPWA 191
           D G          V        Y+ +   Y               +   +K + +W    
Sbjct: 262 DGGQADATTCAFWVVTHHEGKFYLYRLANYYHSGTETGETKAMSTYAKEIKKFVEWCYTK 321

Query: 192 WPH-DGLQHDKRSG--EQLSAQYRRQGMKMLPECATFDDGSNG----VEAGISDMLDRMR 244
           W H             + L  +    G++         D  +     +E GI  + + M 
Sbjct: 322 WKHLPRWNWFFVDPACKTLRTELDLIGIETDKADNNSSDKVSSNGLKIEVGIERLQNTMT 381

Query: 245 SGRWKV 250
           SG++ +
Sbjct: 382 SGQFII 387


>gi|50914907|ref|YP_060879.1| terminase large subunit [Streptococcus pyogenes MGAS10394]
 gi|50903981|gb|AAT87696.1| Terminase large subunit [Streptococcus pyogenes MGAS10394]
          Length = 212

 Score = 69.4 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/162 (14%), Positives = 51/162 (31%), Gaps = 19/162 (11%)

Query: 93  SYPLHEREART--KGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAA 149
            Y  + R AR    GE  +  G +F   E         I        GMDFG+   P   
Sbjct: 1   MYKTNPRRARIVCDGEWGVAEGLVFDNFEVVDFDVEKTIQRVKETSAGMDFGFTQDPTTL 60

Query: 150 GHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSA 209
             +  +  +  +++   +  +       V  ++       +              ++L A
Sbjct: 61  ICVAVDLVNKELWLYNEHYQKAMLTDHIVKMIRDKNMHKSYIAADSAE-------KRLIA 113

Query: 210 QYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKVF 251
           + + +G+  +        G   +  G+  M        +K++
Sbjct: 114 EIKSKGVSGIVASL---KGKGSIMQGVQFMQG------FKIY 146


>gi|261881105|ref|ZP_06007532.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
 gi|270332111|gb|EFA42897.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
          Length = 423

 Score = 69.4 bits (168), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 29/254 (11%), Positives = 72/254 (28%), Gaps = 44/254 (17%)

Query: 15  TVHYV---WFDEE---PPEDVYFEGLTRINATQ--GLVTLTLTPLKGRSPIIEHYLSASS 66
           ++H +     DE      E  +   +  I        + + + P      + + ++  + 
Sbjct: 120 SIHGITTFVVDEAEEWVSEKEFETIMLSIRQKGIQNRIIIVMNPTDNNHWVYKRFIENTH 179

Query: 67  SDRQV---------------IRMTINET-PHYNEQERKRIIDSYPLHEREARTKGEPILG 110
            +                  I  T  +   + +++    + D    +  +          
Sbjct: 180 KEVMYDGVPVQISTHPNVLHIHTTYLDNLENLSQEFINEVEDMKANNPEKYAHTVMGRWA 239

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHP--FAAGHLVWNRDSDVIYVVKNYR 168
                 + +   V+             G+DFG+ +    A    + +   D +YV + + 
Sbjct: 240 DVAEGAVFKHIGVVKEFPKW-CKKVAIGLDFGYTNDVSAAMMCGMID---DNLYVDELFY 295

Query: 169 CREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
                    + AL  +                  +  +L  +    G+K+ P     + G
Sbjct: 296 RTSMLSSDLIKALHRYEMK----------VFSDSADPRLVQEIHNGGIKIYP----VEKG 341

Query: 229 SNGVEAGISDMLDR 242
           +  + AGI  M   
Sbjct: 342 AGSIIAGIDKMKSL 355


>gi|117621599|ref|YP_853855.1| hypothetical protein BAPKO_2028 [Borrelia afzelii PKo]
 gi|110890985|gb|ABH02150.1| hypothetical protein BAPKO_2028 [Borrelia afzelii PKo]
          Length = 450

 Score = 69.0 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 43/159 (27%), Gaps = 8/159 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E     ++   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHKETLLEVMKRLRKGKSIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQERK--RIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +    +    +  +    +     GE +L    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIETQEKLYKHFPAYKARVLYGEWVLNESSL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
             +     + I           A   L    D    Y+ 
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAVCVLERTFDKFYAYIY 312


>gi|319776448|ref|YP_004138936.1| phage terminase large subunit [Haemophilus influenzae F3047]
 gi|319897217|ref|YP_004135412.1| phage terminase large subunit [Haemophilus influenzae F3031]
 gi|329123931|ref|ZP_08252483.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
 gi|317432721|emb|CBY81084.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3031]
 gi|317451039|emb|CBY87270.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3047]
 gi|327468126|gb|EGF13613.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
          Length = 447

 Score = 69.0 bits (167), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 26/228 (11%), Positives = 59/228 (25%), Gaps = 13/228 (5%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++       + + 
Sbjct: 116 IDVVWVEEGENVSKESWDILIPTIREDGSQIIVSFNPKNILDDTYQRFVIHPPERCKSVL 175

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVINSLDIPE 131
           +   + P++ ++  + +               +GEP+  S                 +  
Sbjct: 176 VNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKL 235

Query: 132 HWVQIGGMDFGWH--------HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
            +   G    G+         +  A  H       +V           +T    V     
Sbjct: 236 GFTTKGMKKVGFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKAD 295

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQL-SAQYRRQGMKMLPECATFDDGSN 230
              +           H KR  + L    +   G    PE     D  N
Sbjct: 296 LIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKN 343


>gi|218964078|ref|YP_002455438.1| putative phage terminase, pbsx family protein [Borrelia afzelii
           ACA-1]
 gi|216752969|gb|ACJ73583.1| putative phage terminase, pbsx family protein [Borrelia afzelii
           ACA-1]
          Length = 450

 Score = 69.0 bits (167), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 43/159 (27%), Gaps = 8/159 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E     ++   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHKETLLEVMKRLRKGKSIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQERK--RIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +    +    +  +    +     GE +L    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIETQEKLYKHFPAYKARVLYGEWVLNESSL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
             +     + I           A   L    D    Y+ 
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAVCVLERTFDKFYAYIY 312


>gi|297193139|ref|ZP_06910537.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197721315|gb|EDY65223.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 251

 Score = 68.7 bits (166), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 61/189 (32%), Gaps = 17/189 (8%)

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSL 127
           D +  R+ +++ P  +      +   Y    R     G  ++  G ++ + +E   +   
Sbjct: 13  DLRSWRIRLDDNPSLSAAYIDALRAEYVGLWRRRMIGGTWVIAEGAVYDMFDEQRHVVD- 71

Query: 128 DIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR------CREQTPIFHVAAL 181
           ++P        +D+G  + F+A        +D +Y V  +R       R+ T      A+
Sbjct: 72  ELPPMRRYWVAIDYGTANQFSAILYGLGA-NDRLYAVNEWRPNSWATHRQMTDAQLSRAV 130

Query: 182 KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
            +W                  S    S Q                  +N V  GI  +  
Sbjct: 131 SAWLDEQQVVPE---WTFIDPSATSFSTQL------WTDRHPVVALANNEVLDGIHSVST 181

Query: 242 RMRSGRWKV 250
            + SG  +V
Sbjct: 182 ALGSGLLRV 190


>gi|145629503|ref|ZP_01785301.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|145641440|ref|ZP_01797019.1| predicted phage terminase large subunit [Haemophilus influenzae
           R3021]
 gi|144978346|gb|EDJ88110.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|145273983|gb|EDK13850.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.4-21]
 gi|309750959|gb|ADO80943.1| Probable bacteriophage terminase, large subunit [Haemophilus
           influenzae R2866]
          Length = 447

 Score = 68.7 bits (166), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/228 (11%), Positives = 59/228 (25%), Gaps = 13/228 (5%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++       + + 
Sbjct: 116 IDVVWVEEGENVSKESWDILIPTIREDGSQIIVSFNPKNILDDTYQRFVIHPPERCKSVL 175

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVINSLDIPE 131
           +   + P++ ++  + +               +GEP+  S                 +  
Sbjct: 176 VNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKL 235

Query: 132 HWVQIGGMDFGWH--------HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
            +   G    G+         +  A  H       +V           +T    V     
Sbjct: 236 GFTTKGMKKVGFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKAD 295

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQL-SAQYRRQGMKMLPECATFDDGSN 230
              +           H KR  + L    +   G    PE     D  N
Sbjct: 296 LIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKN 343


>gi|293399999|ref|ZP_06644145.1| putative phage terminase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306399|gb|EFE47642.1| putative phage terminase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 408

 Score = 68.7 bits (166), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 51/149 (34%), Gaps = 6/149 (4%)

Query: 6   QGRDKWQSNTVHYVWFDEEPPE--DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
               + + +T+ Y + DE      +V+    +R+     L   T  P   +  +      
Sbjct: 104 SSVARLRGSTLKYCYGDETVDWNKEVFQLLKSRLRTGYSLFDGTGNPQHPKHWLK--LFI 161

Query: 64  ASSSDRQVIRMTINETPHYNEQERKRIIDSYPL-HEREARTKGEPILGSGRIFPIVEEDI 122
            S +D    +  +++ P      R+ +   Y    E      GE     G IF    ++ 
Sbjct: 162 DSDADVYCQQYKLDDNPFLPGDVREELKKEYFGTVEYNRYILGEWCNAEGLIFKPYADNP 221

Query: 123 VINSLDIPEHW-VQIGGMDFGWHHPFAAG 150
            +  ++I   + +   G+D G     +  
Sbjct: 222 KLWEVEILPFFQMVNIGLDIGGTKSHSTL 250


>gi|227551837|ref|ZP_03981886.1| phage terminase, large subunit, PBSX family protein [Enterococcus
           faecium TX1330]
 gi|227179009|gb|EEI59981.1| phage terminase, large subunit, PBSX family protein [Enterococcus
           faecium TX1330]
          Length = 432

 Score = 68.7 bits (166), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 41/246 (16%), Positives = 72/246 (29%), Gaps = 20/246 (8%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTL-TPLKGRSPIIEHYLSASSSDRQVI-RMTINETPH 81
              +D   E   R  A +    L    P     P +E       S R +    T N+ P 
Sbjct: 137 LLHKDFINECFRRTFAAEWRYHLGEQNPPAPNHPNLELLERFEKSGRFLFRHWTPNDNPI 196

Query: 82  YNEQERKRIIDSYPLHER--EARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGM 139
            +E+ +K + D     E   E    G  +L  G IF + ++      +            
Sbjct: 197 LSEERKKELFDELSSSEYLLERDWYGHRVLPQGVIFAMFDKKNKATEIKGNIVETFFTA- 255

Query: 140 DFGWHHPFAAGHLVWNRDSDVIYVVKN--YRCREQTP------IFHVAALKSWGKWLPWA 191
           D G          V        Y+ +   Y               +   +K + +W    
Sbjct: 256 DGGQADATTCAFWVVTHHEGKFYLYRLANYYHSGTETGETKAMSTYAKEIKKFVEWCYTK 315

Query: 192 WPH-DGLQHDKRSG--EQLSAQYRRQGMKMLPECATFDDGSNG----VEAGISDMLDRMR 244
           W H             + L  +    G++         D  +     +E GI  + + M 
Sbjct: 316 WKHLPRWNWFFVDPACKTLRTELDLIGIETDKADNNSSDKVSSNGLKIEVGIERLQNTMT 375

Query: 245 SGRWKV 250
           SG++ +
Sbjct: 376 SGQFII 381


>gi|313498221|gb|ADR59587.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 511

 Score = 68.7 bits (166), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 53/177 (29%), Gaps = 28/177 (15%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPE---DVYF--EGLTRIN---------ATQGLVTLTLTP 50
           EQ   K+      ++ +DE       ++Y       R +              V  T  P
Sbjct: 134 EQYEAKFHGQEYSFIGWDELTTWATDEIYESMMSTLRTSYQPTKAQPLMPPLQVRSTTNP 193

Query: 51  L-KGRSPIIEHY----------LSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHER 99
              G+  +   +                D+  I  T+ E PH N++ +  +       +R
Sbjct: 194 WGVGKRWVKARFIDGKISGQIEYKNGQRDKCAIFGTVFENPHLNDEYKHWLRTISDPAKR 253

Query: 100 EARTKGEPILGSGRIFP---IVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV 153
            +   G+               ++ +++    IP HW      D+G   PF      
Sbjct: 254 ASWLLGDWEAVDDTAMFAALWKKDVLLMQPFTIPAHWKVERSFDYGQSTPFCCLWTA 310


>gi|184157353|ref|YP_001845692.1| putative phage terminase [Acinetobacter baumannii ACICU]
 gi|294839380|ref|ZP_06784063.1| putative phage terminase [Acinetobacter sp. 6013113]
 gi|294842832|ref|ZP_06787515.1| putative phage terminase [Acinetobacter sp. 6014059]
 gi|294857682|ref|ZP_06795451.1| putative phage terminase [Acinetobacter sp. 6013150]
 gi|301345227|ref|ZP_07225968.1| putative phage terminase [Acinetobacter baumannii AB056]
 gi|301595737|ref|ZP_07240745.1| putative phage terminase [Acinetobacter baumannii AB059]
 gi|183208947|gb|ACC56345.1| putative phage terminase [Acinetobacter baumannii ACICU]
          Length = 413

 Score = 68.7 bits (166), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 81/256 (31%), Gaps = 32/256 (12%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINATQGLVTL---TLTPLK 52
           ++ E+         + +   DE         +  + + + R+   Q  +       T  +
Sbjct: 89  RSMEK-PATIVGFKIGHALIDELDVMAKVKAQQAWRKIIARMRYKQAGLLNGIDVATTPE 147

Query: 53  GRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKG 105
           G     E ++  ++          +I+ +  +   +  +     + +SYP     A  +G
Sbjct: 148 GFKFTYEQFVKEANKSEAKRKLYGMIQASTYDNEANLPDDYISSLYESYPPQLISAYLRG 207

Query: 106 EPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
           + + L SG ++P  +  +     +I +    + GMDF      A  +++          +
Sbjct: 208 QFVNLTSGAVYPDFDRVLNHTDEEIKKGEPLLIGMDFNVLKMAAVVYVI---REGKPRAL 264

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPEC 222
                   TP       + +        P    Q        E   A  ++ G K+    
Sbjct: 265 DELVGVRDTPTMCQLINERFPDHDITVIPDASGQATSSKNFSESDHAILKKNGFKVE--- 321

Query: 223 ATFDDGSNGVEAGISD 238
                  NGV  GI D
Sbjct: 322 ------VNGVNPGIKD 331


>gi|222151209|ref|YP_002560363.1| terminase, large subunit [Macrococcus caseolyticus JCSC5402]
 gi|222120332|dbj|BAH17667.1| terminase, large subunit [Macrococcus caseolyticus JCSC5402]
          Length = 430

 Score = 68.7 bits (166), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 31/237 (13%), Positives = 68/237 (28%), Gaps = 39/237 (16%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTL--TLTPLKGRSPIIEHYLSASSS---- 67
           +  +W +E  E     + E + R+   +    +  +  P+   +    H+     +    
Sbjct: 122 ISLIWLEECSEIKYAGFKELIGRLRHPRLRNYMILSTNPVSKSNWTYLHFFINKDAKVIK 181

Query: 68  ---------------DRQVIRMTINETPHYNEQERKRIIDSYPLHEREART--KGEPILG 110
                          D      T ++     +    ++ D         R    G+    
Sbjct: 182 LDDYRLYKEKTIVLGDTYYHHSTADDNYFLPDDYIAQLDDMKNYDIDLHRVARLGQFGAN 241

Query: 111 SGRIFPIVE---EDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKN 166
             ++ P  E    D V+  ++     +   G+DFG+     A   +  +  +  +Y+   
Sbjct: 242 GKKVLPQFEVMAHDEVMKVVNRTSARLLKNGLDFGFVTSFNALSRMAIDEKNMWLYIYDE 301

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
              +EQ        L   G+ L  A   D                 ++GM +     
Sbjct: 302 VYTKEQDDEELYQELAYLGRTLIKADHED----------STIKYLNKKGMNLRKAKK 348


>gi|322507236|gb|ADX02690.1| Putative phage terminase [Acinetobacter baumannii 1656-2]
          Length = 378

 Score = 68.3 bits (165), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 81/256 (31%), Gaps = 32/256 (12%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINATQGLVTL---TLTPLK 52
           ++ E+         + +   DE         +  + + + R+   Q  +       T  +
Sbjct: 54  RSMEK-PATIVGFKIGHALIDELDVMAKVKAQQAWRKIIARMRYKQAGLLNGIDVATTPE 112

Query: 53  GRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKG 105
           G     E ++  ++          +I+ +  +   +  +     + +SYP     A  +G
Sbjct: 113 GFKFTYEQFVKEANKSEAKRKLYGMIQASTYDNEANLPDDYISSLYESYPPQLISAYLRG 172

Query: 106 EPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
           + + L SG ++P  +  +     +I +    + GMDF      A  +++          +
Sbjct: 173 QFVNLTSGAVYPDFDRVLNHTDEEIKKGEPLLIGMDFNVLKMAAVVYVI---REGKPRAL 229

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPEC 222
                   TP       + +        P    Q        E   A  ++ G K+    
Sbjct: 230 DELVGVRDTPTMCQLINERFPDHDITVIPDASGQATSSKNFSESDHAILKKNGFKVE--- 286

Query: 223 ATFDDGSNGVEAGISD 238
                  NGV  GI D
Sbjct: 287 ------VNGVNPGIKD 296


>gi|145638997|ref|ZP_01794605.1| terminase large subunit-like protein [Haemophilus influenzae
           PittII]
 gi|145271969|gb|EDK11878.1| terminase large subunit-like protein [Haemophilus influenzae
           PittII]
          Length = 379

 Score = 68.3 bits (165), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 26/228 (11%), Positives = 59/228 (25%), Gaps = 13/228 (5%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++       + + 
Sbjct: 48  IDVVWVEEGENVSKESWDILIPTIREDGSQIIVSFNPKNILDDTYQRFVIHPPERCKSVL 107

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVINSLDIPE 131
           +   + P++ ++  + +               +GEP+  S                 +  
Sbjct: 108 VNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKPVWIESAVDAHLKL 167

Query: 132 HWVQIGGMDFGWH--------HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
            +   G    G+         +  A  H       +V           +T    V     
Sbjct: 168 GFTTKGMKKVGFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDSANRTNQSAVKFKAD 227

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQL-SAQYRRQGMKMLPECATFDDGSN 230
              +           H KR  + L    +   G    PE     D  N
Sbjct: 228 LIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKDKKN 275


>gi|291335182|gb|ADD94806.1| hypothetical protein [uncultured phage MedDCM-OCT-S12-C102]
 gi|291336563|gb|ADD96112.1| hypothetical protein [uncultured organism MedDCM-OCT-S04-C6]
          Length = 555

 Score = 68.3 bits (165), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 58/202 (28%), Gaps = 36/202 (17%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEH 60
            K Y Q     +   +  +WFDE  P+        R+ + +G + +T TP++G S  ++ 
Sbjct: 168 FKNYTQDLSTLEGTELDLIWFDELVPQSWVETLKYRLVSRKGKMLITFTPIEGYSSAVKS 227

Query: 61  YL------------------SASSSDRQVIRMTI----------------NETPHYNEQE 86
            +                    +        M                     P+     
Sbjct: 228 AMEGAIIEETREAKLIDPNSPGNIPGVPKGHMPYRARTKNGSGKIFWFYSEWNPYTPFDR 287

Query: 87  RKRIIDSYPLHEREARTKGEP-ILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHH 145
            ++ +      E E R  G      +G+     + +IV  S    +    +         
Sbjct: 288 LQKTLKGRTREELEIRAYGYVSNPVTGKFPRFTDRNIVKASDIPRQGTNYMVCDPTPGDR 347

Query: 146 PFAAGHLVWNRDSDVIYVVKNY 167
            +       + D   +++ + +
Sbjct: 348 NWFFLWARVD-DLGRVFIYREF 368


>gi|227499654|ref|ZP_03929757.1| PbsX family phage terminase, large subunit [Anaerococcus tetradius
           ATCC 35098]
 gi|227218251|gb|EEI83510.1| PbsX family phage terminase, large subunit [Anaerococcus tetradius
           ATCC 35098]
          Length = 439

 Score = 68.3 bits (165), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 37/261 (14%), Positives = 81/261 (31%), Gaps = 19/261 (7%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINA-TQGLVTLTLTPLKGRSPIIEHYLS 63
              K + N+       E     +D   E   R  A  +      L P      I   ++ 
Sbjct: 126 SYKKIRGNSFGMWIATEINLHHKDSIKEAFNRTAAAKRRKFFWDLNPSSPNHFIYADHID 185

Query: 64  ASSS---------DRQVIRMTINETPHYNEQERKRIIDSYPLH--EREARTKGEPILGSG 112
              +                TI++  + ++Q +K I   Y  +    +    G  ++  G
Sbjct: 186 KYQNMIDEGIDFGGYNYKHFTIDDNINISDQRKKEIKLQYDPNSVWYKRDILGLRVVAEG 245

Query: 113 RIFPIVEEDIVINSLDIPEH--WVQIGGMDFGWHHP-FAAGHLVWNRDSDVIYVVKNYRC 169
            I+    ++     +    H   +   G+DFG ++   A      +R    +Y +++ R 
Sbjct: 246 LIYKQFADNPDDYLIKEKPHELQMIQIGVDFGGNNSKHAFICCGISRGFKKVYALRSERL 305

Query: 170 REQTPIFHVAALKSWGKWLPWAWPH-DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
               P      L  + + +   + + D +  D      L    ++  +         +  
Sbjct: 306 EPDKPTDLYNQLIDFVRVIQSTYGNVDLIYADSAEQV-LIKGMQKALLDANLNIKIKNSI 364

Query: 229 SNGVEAGISDMLDRMRSGRWK 249
            N +   I  +   + S R+ 
Sbjct: 365 KNPINDRIRLVNTLIASDRFF 385


>gi|239504148|ref|ZP_04663458.1| putative phage terminase [Acinetobacter baumannii AB900]
          Length = 413

 Score = 67.9 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 38/256 (14%), Positives = 81/256 (31%), Gaps = 32/256 (12%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINATQGLVTL---TLTPLK 52
           ++ E+         + +   DE         +  + + + R+   Q  +       T  +
Sbjct: 89  RSMEK-PATIVGFKIGHALIDELDVMAMTKAQQAWRKIIARMRFKQAGLLNGIDVATTPE 147

Query: 53  GRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTKG 105
           G     E ++  ++          +I+ +  +   +  +     + +SYP     A  +G
Sbjct: 148 GFKFTYEQFVKEANKSEAKRKLYGMIQASTYDNEANLPDDYISSLYESYPPQLISAYLRG 207

Query: 106 EPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
           + + L SG ++P  +  +     +I +    + GMDF      A  +++          +
Sbjct: 208 QFVNLTSGAVYPDFDRVLNHTDEEIKKGEPLLIGMDFNVLKMAAVVYVI---REGKPRAL 264

Query: 165 KNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPEC 222
                   TP       + +        P    Q        E   A  ++ G K+    
Sbjct: 265 DELVGVRDTPTMCQLINERFPDHDITVIPDASGQATSSKNFSESDHAILKKNGFKVE--- 321

Query: 223 ATFDDGSNGVEAGISD 238
                  NGV  GI D
Sbjct: 322 ------VNGVNPGIKD 331


>gi|224984406|ref|YP_002641809.1| phage terminase, large subunit, pbsx family [Borrelia valaisiana
           VS116]
 gi|224497005|gb|ACN52640.1| phage terminase, large subunit, pbsx family [Borrelia valaisiana
           VS116]
          Length = 450

 Score = 67.9 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/245 (9%), Positives = 66/245 (26%), Gaps = 13/245 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E     ++   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHKETLLEVIKRLRKGKSIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQERK--RIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +    +    +  +    +     GE IL    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIETQEKLYKHFPAYKARVLYGEWILNESAL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT--PIFHVAALKS 183
             +     + I           A   L    +    Y+ ++ +    +         +++
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERTFEKFYAYIYQDQKPVSDSLMLGSIQVLIEN 333

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
           +     +    D  + D    + +    R + +             +     I  ++   
Sbjct: 334 FNVNTVYIEERDSTKGDGILTKTIL-FLRNKSIN--YFKVAPIKPLSSKFKRICALIPLF 390

Query: 244 RSGRW 248
            S + 
Sbjct: 391 ESRKI 395


>gi|257887288|ref|ZP_05666941.1| phage terminase [Enterococcus faecium 1,141,733]
 gi|257823342|gb|EEV50274.1| phage terminase [Enterococcus faecium 1,141,733]
          Length = 438

 Score = 67.9 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 41/246 (16%), Positives = 72/246 (29%), Gaps = 20/246 (8%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTL-TPLKGRSPIIEHYLSASSSDRQVI-RMTINETPH 81
              +D   E   R  A +    L    P     P IE       S R +    T N+ P 
Sbjct: 143 LLHKDFINECFRRTFAAEWRYHLGEQNPPAPNHPNIELLERFEKSGRFLFRHWTPNDNPI 202

Query: 82  YNEQERKRIIDSYPLHER--EARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGM 139
            +E+ +K + D     E   E    G  +L  G I+ +  ++     +            
Sbjct: 203 LSEERKKELFDELSSSEYLLERDWYGHRVLPQGVIYAMFGKNNKATEIKGNIIETFFTA- 261

Query: 140 DFGWHHPFAAGHLVWNRDSDVIYVVKN--YRCREQTP------IFHVAALKSWGKWLPWA 191
           D G          V        Y+ +   Y               +   +K + +W    
Sbjct: 262 DGGQADATTCAFWVVTHHEGKFYLYRLANYYHSGTETGETKAMSIYAKEIKKFVEWCYTK 321

Query: 192 WPH-DGLQHDKRSG--EQLSAQYRRQGMKMLPECATFDDGSNG----VEAGISDMLDRMR 244
           W H             + L  +    G++         D  +     +E GI  + + M 
Sbjct: 322 WKHLPRWNWFFVDPACKTLRTELDLIGIETDKADNNSSDKVSSNGLKIEVGIERLQNTMT 381

Query: 245 SGRWKV 250
           SG++ +
Sbjct: 382 SGQFII 387


>gi|283765957|gb|ADB28373.1| phage terminase large subunit [Bacillus phage 250]
          Length = 425

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 76/235 (32%), Gaps = 17/235 (7%)

Query: 31  FEGLTRINATQGLVTL-TLTPLKGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKR 89
            E   R  A Q    L  L P     P+I       ++       T N+ P  +EQ ++ 
Sbjct: 143 QECFRRTFAAQDRYHLADLNPPAPNHPVISEVFDVQNTRWT--HWTPNDNPILSEQRKQE 200

Query: 90  IIDSYPLHER--EARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPF 147
           I D    +    E    G+ ++  G I+ + + +  +    + + +      D G     
Sbjct: 201 IYDVLSKNPYLLERDWYGKRVMPQGVIYSMFDMNKNVEHAVLGDRYEMFFTADGGQSDAT 260

Query: 148 AAGHLVWNRDSDVIYVVK--NYRCRE-QTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSG 204
           +    +  R  D   +++  +Y     +T      ++ +    L   W     Q      
Sbjct: 261 SCACNIVTRFKDKFRLMRVAHYYHSGAETGQVKAMSVYAKEIKLFIEWCVRRFQMRYTEV 320

Query: 205 ------EQLSAQYRRQGMKMLPECATFDDGSNGV---EAGISDMLDRMRSGRWKV 250
                 + L  +    G+          D S+     E GI  + + M + ++ +
Sbjct: 321 FVDPACKSLREELHLLGINTTGADNNAHDVSSSAKGMEVGIERLQNLMTNEQFYI 375


>gi|300922509|ref|ZP_07138621.1| phage terminase large subunit [Escherichia coli MS 182-1]
 gi|300421167|gb|EFK04478.1| phage terminase large subunit [Escherichia coli MS 182-1]
          Length = 240

 Score = 67.5 bits (163), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 13/111 (11%), Positives = 35/111 (31%), Gaps = 6/111 (5%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPP 164

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIF 115
            D  ++ +   + PH+ E  R  + +    +         GEP+  S    
Sbjct: 165 DDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAI 215


>gi|290466769|gb|ADD25699.1| putative terminase large subunit [Lactococcus phage 1358]
          Length = 454

 Score = 67.5 bits (163), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/250 (13%), Positives = 71/250 (28%), Gaps = 22/250 (8%)

Query: 12  QSNTVHYVWFDEEPPED------VYFEGLTRINATQGL-VTLTLTPLK-GRSPIIEHYLS 63
           Q   V ++ ++E    +           L R +      V  +  P K     + EH   
Sbjct: 152 QGF-VRFIHYEEADEFESPQDFRTINASLLRGSDDITPAVFYSYNPPKIRGHWLNEHVRD 210

Query: 64  -ASSSDRQVIRMTINETP-----HYNEQERKRIIDSYPLH--EREARTKGEPILGSGRIF 115
              +    V                 +        +   +  + +    G  +     +F
Sbjct: 211 LTGTPMNYVSHTNFLTCYKLHPEWLGKTFLAEAFHTMKYNRRQFDWEYLGLDVATGNEVF 270

Query: 116 PIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTP 174
             +E  ++           +  G+DFG+   PF      ++R  D +Y+           
Sbjct: 271 NNIESRVITQEERDNFEDYRKSGVDFGFSKDPFVYVDAYFDRKRDTVYLWNEVFQTRLKN 330

Query: 175 IFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              V  +KS             L     +  +  +++   G+ +         G   V+ 
Sbjct: 331 KAAVEKVKSRNPSTYKGGARGRLIKADAAEPRTISEFYDLGLDITRS----KKGKGSVDH 386

Query: 235 GISDMLDRMR 244
           G+  + DR +
Sbjct: 387 GVKWLSDRTK 396


>gi|293568929|ref|ZP_06680242.1| phage terminase, large subunit, pbsx family [Enterococcus faecium
           E1071]
 gi|291588362|gb|EFF20197.1| phage terminase, large subunit, pbsx family [Enterococcus faecium
           E1071]
          Length = 429

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 41/246 (16%), Positives = 72/246 (29%), Gaps = 20/246 (8%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTL-TPLKGRSPIIEHYLSASSSDRQVI-RMTINETPH 81
              +D   E   R  A +    L    P     P IE       S R +    T N+ P 
Sbjct: 134 LLHKDFINECFRRTFAAEWRYHLGEQNPPAPNHPNIELLERFEKSGRFLFRHWTPNDNPI 193

Query: 82  YNEQERKRIIDSYPLHER--EARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGM 139
            +E+ +K + D     E   E    G  +L  G I+ +  ++     +            
Sbjct: 194 LSEERKKELFDELSSSEYLLERDWYGHRVLPQGVIYAMFGKNNKATEIKGNIIETFFTA- 252

Query: 140 DFGWHHPFAAGHLVWNRDSDVIYVVKN--YRCREQTP------IFHVAALKSWGKWLPWA 191
           D G          V        Y+ +   Y               +   +K + +W    
Sbjct: 253 DGGQADATTCAFWVVTHHEGKFYLYRLANYYHSGTETGETKAMSIYAKEIKKFVEWCYTK 312

Query: 192 WPH-DGLQHDKRSG--EQLSAQYRRQGMKMLPECATFDDGSNG----VEAGISDMLDRMR 244
           W H             + L  +    G++         D  +     +E GI  + + M 
Sbjct: 313 WKHLPRWNWFFVDPACKTLRTELDLIGIETDKADNNSSDKVSSNGLKIEVGIERLQNTMT 372

Query: 245 SGRWKV 250
           SG++ +
Sbjct: 373 SGQFII 378


>gi|330996205|ref|ZP_08320095.1| phage terminase, large subunit, PBSX family [Paraprevotella
           xylaniphila YIT 11841]
 gi|329573709|gb|EGG55300.1| phage terminase, large subunit, PBSX family [Paraprevotella
           xylaniphila YIT 11841]
          Length = 430

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 37/264 (14%), Positives = 78/264 (29%), Gaps = 51/264 (19%)

Query: 15  TVHYV---WFDEE---PPEDVYFEGLTRINATQ--GLVTLTLTPLKGRSPIIEHYLSASS 66
           ++H +     DE      E  + + +  I        + + + P      I + Y+  + 
Sbjct: 126 SIHGITTFVCDEAEEWTNEQDFDKIMLSIRQKGIQNRIIIIMNPTDSNHFIYKKYIENTH 185

Query: 67  ---------------SDRQVIRMTINET-PHYNEQERKRIIDSYPLHE--REARTKGEP- 107
                           +   I  T  +   + + Q  K +      +         G   
Sbjct: 186 KLVEIDGVPVQISTHPNVLHIHTTYFDNIDNLSPQFIKEVEQMKAENPEKYAHTVIGRWA 245

Query: 108 ILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNY 167
            +  G I+        I             G+DFG+ H   A  +    D+D +Y+ +  
Sbjct: 246 DVAEGAIYKKWGVVKSI----PQWCKKIALGLDFGFTHDETAIVMCGVMDND-LYIDEIC 300

Query: 168 RCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD 227
              +      +  L+ +      A   D          +L  +    G+++ P     + 
Sbjct: 301 YKTQMLTKDIIQTLRPYQGMKVIADSAD---------PRLIQEIHNAGIRIYP----VEK 347

Query: 228 GSNGVEAGISDMLDRMRSGRWKVF 251
           G   V AGI       ++  + +F
Sbjct: 348 GKGSVIAGIE------KAKEFNIF 365


>gi|170764163|ref|ZP_02633320.2| phage terminase, large subunit, pbsx family [Clostridium
           perfringens E str. JGS1987]
 gi|170661287|gb|EDT13970.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens E str. JGS1987]
          Length = 441

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/264 (13%), Positives = 78/264 (29%), Gaps = 20/264 (7%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRI-NATQGLVTLTLTPLKGRSPIIEHYLS 63
              K + N+       E      D   E   R   A +  V   L P    + I + Y+ 
Sbjct: 123 SYKKIRGNSYGMWIATEINLHHPDSIKEAFNRTIAAHKRKVFWDLNPDNPNAFIYKDYID 182

Query: 64  ASSSDRQ---------VIRMTINETPHYNEQERKRIIDSYPLH--EREARTKGEPILGSG 112
              S  +             TI++  + +++ ++ I   Y  +    +    G+  +  G
Sbjct: 183 NYKSKYENGELKGGYNYYHFTIDDNINISDERKEEIKSQYDKNSIWYQRDILGKRCVAEG 242

Query: 113 RIFPIVEED---IVINSLDIPEHWVQIGGMDFGWHH-PFAAGHLVWNRDSDVIYVV--KN 166
            I+     +         D+      + G+DFG      A            + ++  + 
Sbjct: 243 LIYRRFANNPNSYRAEESDVSNLMKIVIGVDFGGTGSGHAFIASAITFGYKKVIILSSER 302

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           +   +           ++ K + + +    + +   + + L    R   +K        D
Sbjct: 303 HFGDDIDSEKLGKIFINFVKKINYKYGFAEVAYCDNAEQVLIRTLRNAAIKAGLSIRVTD 362

Query: 227 DGSNGVEAGISDMLDRMRSGRWKV 250
                V   I+     M   R ++
Sbjct: 363 AWKTTVNDRINATTKLMAQDRLQI 386


>gi|219872451|ref|YP_002476937.1| phage terminase, large subunit, pbsx family [Borrelia garinii PBr]
 gi|219694305|gb|ACL34832.1| phage terminase, large subunit, pbsx family [Borrelia garinii PBr]
          Length = 450

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/214 (9%), Positives = 61/214 (28%), Gaps = 11/214 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E     ++   E + R+   + ++     P          ++     
Sbjct: 158 KIRGGNSAIIYVNEATVIHKETLLEVIKRLRKGKAIIIFDTNPEGPTHFFKTDFIENK-D 216

Query: 68  DRQVIRMTINETPHYNEQERK--RIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +    +  + +  +    +     GE IL    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIETQKKLYKHLPAYKARVLYGEWILNESTL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT--PIFHVAALKS 183
             +     + I           A   L    +    Y+ ++ +    +         +++
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERAFEKFYAYIYQDQKPVSDSLMLGSIQVLIEN 333

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMK 217
           +     +    D ++ D    + +    R + + 
Sbjct: 334 FNVNTVYIEERDSIKGDGILTKTIL-FLRDKSIN 366


>gi|85059798|ref|YP_455500.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84780318|dbj|BAE75095.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 483

 Score = 66.7 bits (161), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/183 (9%), Positives = 46/183 (25%), Gaps = 14/183 (7%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDIAWVEEAEAVTKESWDILIPTIRKPGSEIWVSFNPKNILDDTYQRFVVNPL 164

Query: 67  SDRQVIRMTINETPHYNEQERKRII--DSYPLHEREARTKGEPILGSGRIFPIV------ 118
            D  ++ +   + PH+ E  R  +               +GEP+  S             
Sbjct: 165 DDICLLTVHYTDNPHFPEVLRLEMEECKCKDYDLYLHIWEGEPVADSDLAIIKPLWIAAA 224

Query: 119 EEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLV--WNRDSDVIYVVKNYRCREQTPIF 176
            +  +    D          +        A   +      D D  +         +   +
Sbjct: 225 VDAHMTLGFDAVGEKRLGFDVADEGEDCNALCFVQGSVVLDLDEWHRGDVIASSNRVNRY 284

Query: 177 HVA 179
            + 
Sbjct: 285 AIE 287


>gi|157325367|ref|YP_001468786.1| TerL [Listeria phage P35]
 gi|66733372|gb|AAY53187.1| TerL [Listeria phage P35]
          Length = 440

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/227 (10%), Positives = 57/227 (25%), Gaps = 19/227 (8%)

Query: 27  EDVYFEGLTRINATQ-GLVTLTLTPLKGRSPIIEHYLS--ASSSDRQVIRMTIN-ETPHY 82
             +      R   T          P K +   + +++        + V   T      H+
Sbjct: 167 FSIVNSSYMRGEGTGDSRAFYLYNPPKYKGHWLNNWVDVIRDEPSQYVHHSTFIPIALHH 226

Query: 83  NE----QERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGG 138
            E       +        +      +      +              + D+ +      G
Sbjct: 227 PEWLGSTWLESARLVRDKNPNRYEWEFLGRNVNTGNEVFPNAVQEHITFDMIDGLRPYEG 286

Query: 139 MDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGL 197
            D G+   P     + ++   D +Y+      +          + +  +        D  
Sbjct: 287 FDEGYTADPSVWLRVFYDEQRDTVYITDELVMKRYKTKALAKDILNVQEGSYNIVRGDSA 346

Query: 198 QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
                   ++  + R  G+  L          N V  G + + +R++
Sbjct: 347 N------PRVLDEMRDLGVNAL----AVSKSPNSVPHGTNWLANRIK 383


>gi|37527280|ref|NP_930624.1| hypothetical protein plu3406 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36786714|emb|CAE15780.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 418

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 30/245 (12%), Positives = 66/245 (26%), Gaps = 26/245 (10%)

Query: 6   QGRDKWQSNTVHYVWFDEEPP--EDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLS 63
           Q         +   W +E     +D +      + A +  V ++  P +   P  +    
Sbjct: 109 QSIKSMHGIKI--CWVEEAQTVSQDSWDILGPTVRANKSEVWVSFNPREEEDPTYKLMTR 166

Query: 64  ASSS----DRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPI 117
                      + ++   +   + +  R+ +     +     E    G P   S  +   
Sbjct: 167 HQEDPSDGGVIIRKVNYCDNAFFPDVLRQEMEYCKRIDYEAYEHIWLGLPKALSEAVIFS 226

Query: 118 VEEDIVINSLDIPEHWVQ-IGGMDFGW-HHPFAAGHLVWNRDSDVIYVVKNYRCREQTPI 175
            +  +   S ++     +   G DFG+ + P              +Y+            
Sbjct: 227 GKYRVEAFSDELWLEADRLFYGADFGFANDPSTLVRCFI--IGTKLYIEYEAYGVGV--- 281

Query: 176 FHVAALKSWGKWLPWAWPHDGL-QHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
                L    ++            H   S  +  +   RQG  +             VE 
Sbjct: 282 ----ELDEMPQFYDSVPLSRKWPIHGDSSRPETISYLSRQGFVIDGA----TKWPGSVED 333

Query: 235 GISDM 239
           GI+ +
Sbjct: 334 GITYL 338


>gi|225621691|ref|YP_002724049.1| phage terminase, large subunit, pbsx family [Borrelia sp. SV1]
 gi|225547649|gb|ACN93626.1| phage terminase, large subunit, pbsx family [Borrelia sp. SV1]
          Length = 450

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 42/159 (26%), Gaps = 8/159 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E     ++   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHKETLLEVIKRLRKGKEIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQER--KRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +      +  +       R     GE IL    +     E I   
Sbjct: 217 VFKTYTFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWILNESTL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
             +     + I           A   L    +    Y+ 
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERTFEKFYAYIY 312


>gi|262039284|ref|ZP_06012601.1| phage terminase, large subunit, pbsx family [Leptotrichia
           goodfellowii F0264]
 gi|261746674|gb|EEY34196.1| phage terminase, large subunit, pbsx family [Leptotrichia
           goodfellowii F0264]
          Length = 438

 Score = 66.3 bits (160), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/240 (11%), Positives = 67/240 (27%), Gaps = 40/240 (16%)

Query: 19  VWFDEEPPED--VYFEGLTRINATQGLV--TLTLTPLKGRS------PIIEHYLSASSS- 67
           +W +E    D   + +   R+      +   ++  P +  S        +  Y++ +   
Sbjct: 121 IWIEEANQCDRNDFKQLRYRLRTPNIKMHMYISTNPAEPDSASNWTYWFLTDYMNVTEET 180

Query: 68  --------------------DRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEP 107
                                  V   T  E     E     +      +      +G+ 
Sbjct: 181 LYDVKEFIKSIEDKETGYIQRIYVNHSTYKENKFLPESAVAELNMETDPYLISIAKEGKF 240

Query: 108 ILGSGRIFPIVEEDIVINSLDIPEHW---VQIGGMDFGWH-HPFAAGHLVWNRDSDVIYV 163
                 ++  +E +      +  +       I GMDFG+     A      + +++++YV
Sbjct: 241 GYHGEFVYYNIESENNQYVDEQIKRIGIEWHIAGMDFGFSISYTAVVRAAIDYENNILYV 300

Query: 164 VKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECA 223
              +  +  T       +         A     +  D    + +  +++  G+ M     
Sbjct: 301 YDEFYNKGLTNAQ----ILQEDFLYDVAEEGIVIYADYAEPKTI-QEFKANGVLMAKADK 355


>gi|247553003|gb|ACS94840.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           JD1]
          Length = 450

 Score = 66.0 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 42/159 (26%), Gaps = 8/159 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E     ++   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHKETLLEVIKRLRKGKEIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQER--KRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +      +  +       R     GE IL    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWILNESTL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
             +     + I           A   L    +    Y+ 
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERTFEKFYAYIY 312


>gi|224796679|ref|YP_002641707.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           WI91-23]
 gi|224553883|gb|ACN55283.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           WI91-23]
          Length = 450

 Score = 66.0 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 41/159 (25%), Gaps = 8/159 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E      +   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHRETLLEVIKRLRKGKEIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQER--KRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +      +  +       R     GE IL    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWILNESML---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
             +     + I           A   L    +    Y+ 
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERTFEKFYAYIY 312


>gi|219807285|ref|YP_002477581.1| phage terminase, pbsx family protein [Borrelia burgdorferi 156a]
 gi|224797061|ref|YP_002642778.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           64b]
 gi|225571759|ref|YP_002724342.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           118a]
 gi|219692550|gb|ACL33771.1| phage terminase, pbsx family protein [Borrelia burgdorferi 156a]
 gi|223929616|gb|ACN24327.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           64b]
 gi|225547179|gb|ACN93166.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           118a]
          Length = 450

 Score = 66.0 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 42/159 (26%), Gaps = 8/159 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E     ++   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHKETLLEVIKRLRKGKEIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQER--KRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +      +  +       R     GE IL    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWILNESTL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
             +     + I           A   L    +    Y+ 
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERTFEKFYAYIY 312


>gi|219499179|ref|YP_002455350.1| putative phage terminase, pbsx family protein [Borrelia burgdorferi
           ZS7]
 gi|218164189|gb|ACK74256.1| putative phage terminase, pbsx family protein [Borrelia burgdorferi
           ZS7]
          Length = 450

 Score = 66.0 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 41/159 (25%), Gaps = 8/159 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E      +   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHRETLLEVIKRLRKGKEIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQER--KRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +      +  +       R     GE IL    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIQAQEKLYRRFPAYRARVLYGEWILNESTL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
             +     + I           A   L    +    Y+ 
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERTFEKFYAYIY 312


>gi|11496928|ref|NP_045704.1| hypothetical protein BBA31 [Borrelia burgdorferi B31]
 gi|195942693|ref|ZP_03088075.1| hypothetical protein Bbur8_07694 [Borrelia burgdorferi 80a]
 gi|224796822|ref|YP_002642504.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           72a]
 gi|224796893|ref|YP_002642572.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           CA-11.2a]
 gi|225573840|ref|YP_002724449.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           94a]
 gi|226234883|ref|YP_002775758.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           Bol26]
 gi|2690260|gb|AAC66261.1| conserved hypothetical protein [Borrelia burgdorferi B31]
 gi|221237191|gb|ACM10059.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           72a]
 gi|224554443|gb|ACN55827.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           CA-11.2a]
 gi|225546432|gb|ACN92439.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           94a]
 gi|226202357|gb|ACO38016.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           Bol26]
 gi|247552767|gb|ACS94776.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           N40]
          Length = 450

 Score = 66.0 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 41/159 (25%), Gaps = 8/159 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E      +   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHRETLLEVIKRLRKGKEIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQER--KRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +      +  +       R     GE IL    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWILNESTL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
             +     + I           A   L    +    Y+ 
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERTFEKFYAYIY 312


>gi|247553170|gb|ACS94899.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           297]
          Length = 450

 Score = 66.0 bits (159), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 41/159 (25%), Gaps = 8/159 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E      +   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHRETLLEVIKRLRKGKEIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQER--KRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +      +  +       R     GE IL    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSADFIQTQEKLYRRFPAYRARVLYGEWILNESTL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
             +     + I           A   L    +    Y+ 
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERTFEKFYAYIY 312


>gi|319649444|ref|ZP_08003600.1| TerL protein [Bacillus sp. 2_A_57_CT2]
 gi|317398606|gb|EFV79288.1| TerL protein [Bacillus sp. 2_A_57_CT2]
          Length = 433

 Score = 66.0 bits (159), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 35/256 (13%), Positives = 74/256 (28%), Gaps = 32/256 (12%)

Query: 19  VWFDEEPPE------DVYFEGLTR--INATQGLVTLTLTPLK----GRSPIIEHYLSASS 66
           +WF+E          D+  +   R  I   +  V  +  P +      +  ++    A  
Sbjct: 130 LWFEEAAEFAGVEDIDIVEDTFIRQEIEGKEVKVYFSYNPPRNPYSWINEWLD--TKAED 187

Query: 67  SDRQVIRMTINETP--HYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
            D  +   T  +      +EQ  ++I       E   R      +          +    
Sbjct: 188 DDYFIHHSTYLDDEKGFLSEQMIRKIEKYKENDEDYWRWMYAGEVIGLGDMVYNMDHFHE 247

Query: 125 NS--LDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRC-----REQTPIF 176
                +  +  +    +D G            + +  +VI +   Y        ++ P  
Sbjct: 248 IDALPEDDDLILIDIAIDTGHQVSATTFLAFGFTKKRNVILLDTFYYSPENKVVKKAPSE 307

Query: 177 HVAALKSWGKWLPWAWPH--DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
               LK W   +   +    D    D   G   +  ++  G+++ P              
Sbjct: 308 LSKDLKEWIDKIQQTYKRHFDKQTIDSAEGALRNQFFKDYGIRLHPVTKKKK------ID 361

Query: 235 GISDMLDRMRSGRWKV 250
            I ++ D +  GR+ V
Sbjct: 362 MIDNVQDLLAQGRFFV 377


>gi|145629819|ref|ZP_01785613.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|148827544|ref|YP_001292297.1| hypothetical protein CGSHiGG_04845 [Haemophilus influenzae PittGG]
 gi|144977965|gb|EDJ87753.1| predicted phage terminase large subunit [Haemophilus influenzae
           22.1-21]
 gi|148718786|gb|ABQ99913.1| hypothetical protein CGSHiGG_04845 [Haemophilus influenzae PittGG]
          Length = 449

 Score = 66.0 bits (159), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 53/177 (29%), Gaps = 14/177 (7%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +  VW +E      + +   +  I   +  + +T  P     P  + ++ A  
Sbjct: 108 KSLEG--IDLVWIEEAENVSNESWDILIPTIRKERSEIWVTFNPKNILDPTYQRFVIAPP 165

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            +  V ++  +E P++ E  R  + +              GEP+  S ++          
Sbjct: 166 KNSFVRKINYDENPYFPETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECA 225

Query: 125 NSLDIPEHWVQIGGMDFGWH--------HPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
                   ++  G    G+         +  A  H       D  +        ++T
Sbjct: 226 VDAHKKLGFLPAGRKIVGFDVADDGVDSNANAFVHGSVVLRVDEWHGEDVIGSADRT 282


>gi|260583110|ref|ZP_05850891.1| phage terminase large subunit [Haemophilus influenzae NT127]
 gi|260093822|gb|EEW77729.1| phage terminase large subunit [Haemophilus influenzae NT127]
          Length = 445

 Score = 66.0 bits (159), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 23/177 (12%), Positives = 53/177 (29%), Gaps = 14/177 (7%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +  VW +E      + +   +  I   +  + +T  P     P  + ++ A  
Sbjct: 104 KSLEG--IDLVWIEEAENVSNESWDILIPTIRKERSEIWVTFNPKNILDPTYQRFVIAPP 161

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVEEDIVI 124
            +  V ++  +E P++ E  R  + +              GEP+  S ++          
Sbjct: 162 KNSFVRKINYDENPYFPETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWIECA 221

Query: 125 NSLDIPEHWVQIGGMDFGWH--------HPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
                   ++  G    G+         +  A  H       D  +        ++T
Sbjct: 222 VDAHKKLGFLPAGRKIVGFDVADDGVDSNANAFVHGSVVLRVDEWHGEDVIGSADRT 278


>gi|166031069|ref|ZP_02233898.1| hypothetical protein DORFOR_00750 [Dorea formicigenerans ATCC
           27755]
 gi|166029336|gb|EDR48093.1| hypothetical protein DORFOR_00750 [Dorea formicigenerans ATCC
           27755]
          Length = 454

 Score = 65.6 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 33/252 (13%), Positives = 64/252 (25%), Gaps = 24/252 (9%)

Query: 16  VHYVWFDEEPPE----------DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL--S 63
           +  V  DE                      R N++   +     P K  +  I  +    
Sbjct: 118 IKLVVLDELTEFFDDGEGEDELSNIEATFVRGNSSGFQMIYLYNPPKNPNAPINQWCKKM 177

Query: 64  ASSSDRQVIRMTINETP--HYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVE 119
               D   I     + P     +             E        G+ +     I+ +  
Sbjct: 178 EKREDCIHIHTDYRDVPVSWLGQALVDSAEAMKRADEKMYRWVWLGQAVGVDELIYYMFG 237

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE------QT 173
           +           +     G D+G  +         +     I  +  Y          ++
Sbjct: 238 DRHRQKPDPNRRYDRIYIGGDYGQQNATTFEAFGLDTYRKKIPGLGEYYHSGRETGKQKS 297

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHD-KRSGEQLSAQYRRQGMKMLPECATF-DDGSNG 231
           P  +   L  +   L   + +         S + L+ + RR    +  +   F  D  N 
Sbjct: 298 PSEYAQDLVEFMNELHEQYDNRVFYIFLDPSAKGLAEEIRRATRAVSLDYQVFLRDAEND 357

Query: 232 VEAGISDMLDRM 243
           V  GIS +   +
Sbjct: 358 VALGISRVQKVL 369


>gi|194100616|ref|YP_002003365.1| gp7 [Mycobacterium phage Predator]
 gi|192758332|gb|ACF05104.1| gp7 [Mycobacterium phage Predator]
          Length = 569

 Score = 65.6 bits (158), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 35/293 (11%), Positives = 70/293 (23%), Gaps = 57/293 (19%)

Query: 5   EQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
            Q  D      +  V  DE     E V+ + L    A         T  +G++ I + Y 
Sbjct: 143 AQDPDSLVGEGLSGVHVDEAAKMKEIVWKQMLFPSLADFKGWARFTTTPEGKNWIYDLYT 202

Query: 63  SASSSDRQVI---------------------------------------RMTINETPHYN 83
            A    ++                                          M +++ P   
Sbjct: 203 DAIKPHKRGWNGFRIPSWYNTGYGALHGDPNGPQPPYPEPTIDQHVKMLTMAMDDNPGLT 262

Query: 84  ------------EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINS--LDI 129
                       + E  +  DS  +         E     G++F   + +          
Sbjct: 263 AFEIAKSLNLTIDSEILQQADSNTIATFNQEFAAEFTDFVGKVFKGFDVETHCRRLKFHT 322

Query: 130 PEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLP 189
              W  +G +D+G+ +P     +        I ++         P      +        
Sbjct: 323 ESSWRTVGCVDYGFSNPNVWLLVQIGP-WGEINILDELYQENLAPDEFAREILRRNLVPD 381

Query: 190 WAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDR 242
                          + L   +R+ G +      T  +  N     I  ++  
Sbjct: 382 NCDSFFPDPALPGYTKTLETIFRQAGKRCRARPHTGGE-INDRLNLIRAVIKA 433


>gi|203288609|ref|YP_002223516.1| bsr protein [Borrelia duttonii Ly]
 gi|201084316|gb|ACH93904.1| bsr protein [Borrelia duttonii Ly]
          Length = 450

 Score = 65.6 bits (158), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/196 (13%), Positives = 53/196 (27%), Gaps = 8/196 (4%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K + +    V+ +E     ++   E + R+    G++     P          Y+     
Sbjct: 158 KIRGSNSALVYVNEATLMHKETLLEIMKRLRQKPGIIIFDTNPDHPAHYFKVDYIDN-RD 216

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPL-HEREAR-TKGEPILGSGRIFPIVEEDIVIN 125
             +     I + P  ++   K     Y      +AR   GE             E I+  
Sbjct: 217 VYRTYNFNIYDNPLNSKDFIKTQEAIYKNLSAYKARVLLGEWTASIDSC---FNEVILNC 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG 185
                   + I           A        D    Y+ ++ +      I H  ++ +  
Sbjct: 274 EYTFKSPIMYIDPAFSVGMDNTAICVFEKMGDKYYAYIYQDKKPISDESILHAISVFAED 333

Query: 186 KWLPWAWPHDGLQHDK 201
             +   +  D    D 
Sbjct: 334 FNINTLYIEDRDNTDG 349


>gi|33594269|ref|NP_881913.1| putative phage terminase [Bordetella pertussis Tohama I]
 gi|33564344|emb|CAE43647.1| putative phage terminase [Bordetella pertussis Tohama I]
          Length = 425

 Score = 65.6 bits (158), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 42/269 (15%), Positives = 79/269 (29%), Gaps = 34/269 (12%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEPPEDV------YFEGLTRINATQ----GLVTLTLTPL 51
           ++ E+  D      +     DE            + + + R+  T       V +T TP 
Sbjct: 102 RSMEKPGD-IVGFKIGKGLIDELDVMKADKAALAWRKIIARLRHTAPGLLNGVDVTTTPE 160

Query: 52  KGRSPIIEHYLSASSSD-------RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK 104
            G   + + ++               V   T     +  E     +  SYP     A  +
Sbjct: 161 -GFKFVYQQFVKQVRERPELAALYGLVQASTYENGKNLPEDYIPSLRASYPPQLIAAYLR 219

Query: 105 GEP-ILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYV 163
           G+   L SG ++   +  +         H     GMDF   +  A  +++    + +   
Sbjct: 220 GQFTNLTSGSVYANFDRRLHHTDAAEEPHEELHIGMDFNVLNMTATVNVI---RAGLPLT 276

Query: 164 VKNYRCREQTPIFHVAALKSWGKWLPW---AWPHD--GLQHDKRSGEQLSAQYRRQGMKM 218
           V        TP      LK   K        +P    G    K + E   +  R+ G  +
Sbjct: 277 VGELTKVRDTPE-MARMLKERFKDKGHGVTIYPDASGGNTSSKNASESDLSILRKAGFTV 335

Query: 219 LPECATFDDGSNGVEAGISDMLDRMRSGR 247
                        V+  I+ +   + +  
Sbjct: 336 RVNSRNP-----SVKDRINAVNGMLLNDE 359


>gi|261381054|ref|ZP_05985627.1| phage terminase, large subunit, PBSX family [Neisseria subflava
           NJ9703]
 gi|284796087|gb|EFC51434.1| phage terminase, large subunit, PBSX family [Neisseria subflava
           NJ9703]
          Length = 450

 Score = 65.2 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 25/211 (11%), Positives = 54/211 (25%), Gaps = 19/211 (9%)

Query: 14  NTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQV 71
             +   W +E     ++ +   +  I      + LT  P     P  + ++     D   
Sbjct: 111 EAIDICWIEEAENVSDESWNILIPTIRKAGSEIWLTWNPKNILDPTYQRFVVNPPDDMVD 170

Query: 72  IRMTINETPHYNEQERKRII--DSYPLHEREARTKGEPILGSGRIFPIVE------EDIV 123
           I +   +  +  E  R       +           GEP+  S       +      +  +
Sbjct: 171 IVVNYTDNIYLPEVLRLEAESCKARDYDLYRHIWLGEPVADSELSVIKPKWIDAAIDSHI 230

Query: 124 INSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
               +     +    +        A       R   V+  +  +R ++         L  
Sbjct: 231 KLGFEATGQRILGFDVADEGDDASATIL----RHGSVVIDMDEWRGQDVIYSADKVYLYG 286

Query: 184 WGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQ 214
                               G  + AQ+RR+
Sbjct: 287 QEAKADKIVYDSI-----GVGAGVKAQFRRK 312


>gi|227530602|ref|ZP_03960651.1| PBSX family phage terminase, large subunit [Lactobacillus vaginalis
           ATCC 49540]
 gi|227349490|gb|EEJ39781.1| PBSX family phage terminase, large subunit [Lactobacillus vaginalis
           ATCC 49540]
          Length = 227

 Score = 65.2 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 60/170 (35%), Gaps = 14/170 (8%)

Query: 82  YNEQERKRIIDSYPLHER-EARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMD 140
              +    +    P     +    G  + G G I+   +E   +   D+P+    I G+D
Sbjct: 1   MPAEYVSALKAQTPSGMFTDRAIYGLWVTGEGAIYRDFDE-RKMVVNDVPKMVRYIAGID 59

Query: 141 FGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHD 200
           +G++HP +      + +S+  Y+V     R +   +     +   K   +         D
Sbjct: 60  WGYNHPCSITVFGIDANSN-YYLVDEKTERFKEIDYWTKVARKLQKKYGY---KMPFYCD 115

Query: 201 KRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
               E     ++  G+  L        G   V  GI  +   M+SGR+ V
Sbjct: 116 TARTE-FIDHFKHNGINALY-------GWKLVVPGIEIVAGLMKSGRFFV 157


>gi|319775727|ref|YP_004138215.1| phage terminase large subunit [Haemophilus influenzae F3047]
 gi|319896735|ref|YP_004134928.1| phage terminase large subunit [Haemophilus influenzae F3031]
 gi|317432237|emb|CBY80589.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3031]
 gi|317450318|emb|CBY86534.1| predicted phage terminase large subunit [Haemophilus influenzae
           F3047]
          Length = 449

 Score = 65.2 bits (157), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 40/111 (36%), Gaps = 6/111 (5%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +  VW +E      + +   +  I   +  + +T  P     P  + ++ A  
Sbjct: 108 KSLEG--IDLVWIEEAENVSNESWDILIPTIRKERSEIWVTFNPKNILDPTYQRFVIAPP 165

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIF 115
            +  V ++  +E P++ E  R  + +              GEP+  S ++ 
Sbjct: 166 KNSFVRKINYDENPYFPETLRLEMEECKERDYELYRHIWLGEPVADSDKVI 216


>gi|226246423|ref|YP_002775825.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           29805]
 gi|226201818|gb|ACO38403.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           29805]
          Length = 450

 Score = 65.2 bits (157), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 19/159 (11%), Positives = 41/159 (25%), Gaps = 8/159 (5%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K +      ++ +E      +   E + R+   + ++     P          Y+  +  
Sbjct: 158 KIRGGNSAIIYVNEATVIHRETLLEVIKRLRKGKEIIIFDTNPESPAHYFKTDYIENT-D 216

Query: 68  DRQVIRMTINETPHYNEQER--KRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    T  + P  +      +  +       R     GE IL    +     E I   
Sbjct: 217 VFKTYNFTTYDNPLNSTDFIQTQEKLYRRFPAYRARVLYGEWILNESTL---FNEMIFNQ 273

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVV 164
             +     + I           A   L    +    Y+ 
Sbjct: 274 DYEFKSPIMYIDPAFSVGGDNTAICVLERTFEKFYAYIY 312


>gi|78212008|ref|YP_380787.1| hypothetical protein Syncc9605_0456 [Synechococcus sp. CC9605]
 gi|78196467|gb|ABB34232.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 414

 Score = 64.8 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 34/253 (13%), Positives = 69/253 (27%), Gaps = 15/253 (5%)

Query: 8   RDKWQSNTVHYVWFDEEPP----EDVYFEGLTRI--NATQGLVTLTLTPLKGRSPIIEHY 61
            D  +         DE       ++++   L  +   +  G V  + TP  G +   E +
Sbjct: 106 ADSLRGQRADRFAIDEYCYIRDLQEMWQAALLPMLGTSDDGSVIFSSTPAGGGTFSAELW 165

Query: 62  LSASS-SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEE 120
             A +                   +  ++   +           G      G ++P   +
Sbjct: 166 ERAETAEGWARWNFPSVAGGWVKPEYVEQARQTMDPSLWRQEFFGSIESLLGAVYPAFNQ 225

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
             + +++D       + G DF           V     DV+ V++     E        A
Sbjct: 226 QNISDTVD--NGGPLLVGCDFNRSP---FCGCVLQVQGDVVVVLEEIVLIEADTREFALA 280

Query: 181 LKSWGKWLPWAWPHDGLQHDKRS---GEQLSAQYRRQGMKMLPECATFDDGSNGVEAGIS 237
           ++            D     K++   G       +  G   +          + V A   
Sbjct: 281 VRERYPQRMIHCAPDPTGSRKQTSSLGLSDHKILQESGGFKICTPRAPWAIKDKVNATRL 340

Query: 238 DMLDRMRSGRWKV 250
            +LD     R +V
Sbjct: 341 MVLDAAGRRRLQV 353


>gi|160932962|ref|ZP_02080351.1| hypothetical protein CLOLEP_01804 [Clostridium leptum DSM 753]
 gi|156868036|gb|EDO61408.1| hypothetical protein CLOLEP_01804 [Clostridium leptum DSM 753]
          Length = 428

 Score = 64.8 bits (156), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 43/262 (16%), Positives = 82/262 (31%), Gaps = 23/262 (8%)

Query: 9   DKWQSNTVHYVWFDE--EPPEDVYFEGLTRINATQGLVTL-TLTPLKGRSPIIEHYLSAS 65
             +   ++  V+F E      D   E   R  A++    +  L P     P+I    +  
Sbjct: 118 KSFTGMSLGSVYFCEINLLHIDAIQEAFRRTCASRIRWHIADLNPPAPSHPVISEVFNIQ 177

Query: 66  SSDRQVIRMTINETPHYNEQERKRIIDSYPLHER--EARTKGEPILGSGRIFPIVE--ED 121
            +       TI++ P    + ++ I  +   +    +    GE  +  G I+ + +    
Sbjct: 178 DTQWT--HWTIDDNPIITPERKEEIRKTCLKNPYLYKRDWLGERCIPQGVIYSMFDPQRH 235

Query: 122 IVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSD---VIYVVKNYRCREQ----TP 174
           I+    D           D G     + G  V  R       +Y V  +         T 
Sbjct: 236 ILSYIPDSESKIEMYFAGDGGLSDATSIGCYVVTRTMQNQFKLYRVAGWYYSGADIGITK 295

Query: 175 IFHVAALKSWGKWLPWAW----PHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDD--- 227
              V A +  G ++P+        +       + + L A++   G           D   
Sbjct: 296 AMSVQAREICGSFIPYCRQLTSMRESSIKIDPACKALCAEFDLLGYYTDRADNNARDIKG 355

Query: 228 GSNGVEAGISDMLDRMRSGRWK 249
              G+E GI  +   +  GR+ 
Sbjct: 356 ARKGIEVGIEYLQSSISDGRFY 377


>gi|315149883|gb|EFT93899.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX0012]
          Length = 429

 Score = 64.8 bits (156), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 38/246 (15%), Positives = 74/246 (30%), Gaps = 20/246 (8%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTL-TPLKGRSPIIEHYLSASSSDRQVI-RMTINETPH 81
              +D   E   R  A +    L    P     P +E       S R +    T ++ P 
Sbjct: 134 LLHKDFINECFRRTFAAEWRYHLGEQNPPAPNHPNLELLERFEKSGRFLFRHWTPDDNPI 193

Query: 82  YNEQERKRIIDSYPLHER--EARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGM 139
            +E  ++++ D     E   E    G  ++  G I+ +  ++     +            
Sbjct: 194 LSESRKQQLYDELSSSEYLLERDWYGHRVIPQGVIYSMFGKNNKATEIKGNIIETFFTA- 252

Query: 140 DFGWHHPFAAGHLVWNRDSDVIYVVKN--YRCREQTP------IFHVAALKSWGKWLPWA 191
           D G          V        Y+ +   Y               +   +K + +W    
Sbjct: 253 DGGQADATTCAFWVVTFYDGKFYLYRLANYYHSGTDTGETKAMSIYAKEIKRFVEWCYTK 312

Query: 192 WPHDGLQHD---KRSGEQLSAQYRRQGMKMLPECATFDDGSNG----VEAGISDMLDRMR 244
           W H    +      + + L ++    G+          D  +     +E GI  + + M 
Sbjct: 313 WNHLPHWNYFFVDPACKTLRSELELLGIGTDKADNNSSDKVSSNGLKIEVGIERLQNTMT 372

Query: 245 SGRWKV 250
           SG++ V
Sbjct: 373 SGQFIV 378


>gi|68249883|ref|YP_248995.1| phage terminase large subunit [Haemophilus influenzae 86-028NP]
 gi|68058082|gb|AAX88335.1| predicted phage terminase large subunit [Haemophilus influenzae
           86-028NP]
          Length = 438

 Score = 64.8 bits (156), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 40/111 (36%), Gaps = 6/111 (5%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +  VW +E      + +   +  I   +  + +T  P     P  + ++ A  
Sbjct: 97  KSLEG--IDLVWIEEAENVSNESWDILIPTIRKERSEIWVTFNPKNILDPTYQRFVIAPP 154

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIF 115
            +  V ++  +E P++ E  R  + +              GEP+  S ++ 
Sbjct: 155 KNSFVRKINYDENPYFPETLRLEMEECKERDYELYRHIWLGEPVADSDKVI 205


>gi|290513013|ref|ZP_06552377.1| hypothetical protein HMPREF0485_04781 [Klebsiella sp. 1_1_55]
 gi|289774626|gb|EFD82630.1| hypothetical protein HMPREF0485_04781 [Klebsiella sp. 1_1_55]
          Length = 435

 Score = 64.4 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 40/282 (14%), Positives = 87/282 (30%), Gaps = 43/282 (15%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINAT----QGLVTLTLTPL 51
           ++ E+  D      +     DE            + + + R+       +  + +T TP 
Sbjct: 105 RSMEK-PDTIVGFKIGNALVDELDVLKADKARQAWRKIIARMRYKVDGLRNGIDVTTTPE 163

Query: 52  KGRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTK 104
            G   +   ++ A            +++ +  +   +  +     ++ SYP    +A   
Sbjct: 164 -GFKFVYNQFVKAVREKPELRSMYGLVQASTFDNEKNLPDDYIPSLLASYPPELIKAYLN 222

Query: 105 GEP-ILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYV 163
           G+   L SG I+   +  +  +S +         GMDF         H++      + + 
Sbjct: 223 GQFTNLTSGTIYHQFDRVLNNSSEEEQPGEALYIGMDFNVGKMAGIVHVL---RLGLPHA 279

Query: 164 VKNYRCREQTPIF----------HVAALKSWGKWLPWAWPHDGLQHDKRSG-EQLSAQYR 212
           V        TP            +        + +       G      +  +    Q R
Sbjct: 280 VTEIINAYDTPDMIRIIKERFWLYADGDYRKVREIYIYPDASGDSRKSNNASKTDIEQLR 339

Query: 213 RQGMKMLPECATFDDGSNGVEAGISDMLDRMRSG----RWKV 250
           + G  ++ + A        V+  I+ M     +G    R+KV
Sbjct: 340 QAGFNVIVDDANPP-----VKDRINSMNAMFCNGNGDRRYKV 376


>gi|301382086|ref|ZP_07230504.1| hypothetical protein PsyrptM_05618 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302061639|ref|ZP_07253180.1| hypothetical protein PsyrptK_16760 [Pseudomonas syringae pv. tomato
           K40]
 gi|302131811|ref|ZP_07257801.1| hypothetical protein PsyrptN_10492 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
          Length = 433

 Score = 64.4 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 38/271 (14%), Positives = 80/271 (29%), Gaps = 38/271 (14%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRIN----ATQGLVTLTLTPL 51
           ++ E+         V +   DE         +  + + + R+       +  V +T TP 
Sbjct: 102 RSMEK-PQTIVGFKVGHALVDELDVLTSIKAQQAWRKIIARMRYNLPGLKNGVDVTTTPE 160

Query: 52  KGRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTK 104
            G   +   ++              +I+ +  +   +  +     +++SYP     A   
Sbjct: 161 -GFKFVFLQFVKQLRDKPALKEMYGLIQASTFDNELNLPDDYIPSLMESYPEQLIRAYLN 219

Query: 105 GEPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYV 163
           G+ + L SG I+   +  +      +        GMDF      A       RD  +   
Sbjct: 220 GQFVNLTSGSIYHAYDRKLNQCFDTVQAGEPLFIGMDFNVGKMAAIT--HVKRDKGLPRA 277

Query: 164 VKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHD--KRSGEQL---------SAQYR 212
           V  +     TP       + + +     +            SG+            A  +
Sbjct: 278 VDEFMDGYDTPDMIRRIKERYWRHDGDKYIKSCEIRIYPDASGDSRKSVNASVTDIAMLK 337

Query: 213 RQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
           + G  ++   A        V+  I+ M    
Sbjct: 338 QAGFTVIAPAANPP-----VKDRINAMNAMF 363


>gi|307251380|ref|ZP_07533296.1| hypothetical protein appser4_21360 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306856621|gb|EFM88761.1| hypothetical protein appser4_21360 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 384

 Score = 64.4 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/213 (11%), Positives = 56/213 (26%), Gaps = 21/213 (9%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++         + 
Sbjct: 48  IDVVWVEEGENVSKESWDVLIPTIREDGSQIIVSFNPKNLLDDTYQRFVINPPERCCSVL 107

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRI------FPIVEEDIVIN 125
           +   + P++ ++  + +               +G+P+  S              +     
Sbjct: 108 VNWQDNPYFPKELMEDMKQMKERDFELYRHVYEGQPVADSDLAIIKPLWIEKAVDAHKKL 167

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG 185
                   V    +        A           V+  V  +R  +     H        
Sbjct: 168 GFTASGRKVVGFDVADEGIDANANCFAH----GSVVLQVDEWRGDDVIQSAH------RT 217

Query: 186 KWLPWAWPHDGLQHDK-RSGEQLSAQYRRQGMK 217
                 W  D +  D    G  + A+YRR   K
Sbjct: 218 HTNAVMWGVDEIVFDSIGVGAGVKAEYRRMDTK 250


>gi|203288341|ref|YP_002223391.1| bsr protein [Borrelia recurrentis A1]
 gi|201085561|gb|ACH95134.1| bsr protein [Borrelia recurrentis A1]
          Length = 412

 Score = 64.4 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/196 (12%), Positives = 53/196 (27%), Gaps = 8/196 (4%)

Query: 10  KWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSS 67
           K + +    V+ +E     ++   E + R+    G++     P          Y+     
Sbjct: 120 KIRGSNSALVYVNEATLMHKETLLEIMKRLRQKPGIIIFDTNPDHPAHYFKVDYIDN-RD 178

Query: 68  DRQVIRMTINETPHYNEQERKRIIDSYPL--HEREARTKGEPILGSGRIFPIVEEDIVIN 125
             +    +I + P  ++   K     Y      +     GE             E I+  
Sbjct: 179 VYRTYNFSIYDNPLNSKDFIKTQEAIYKNLSAYKARVLLGEWTASIDSC---FNEVILNC 235

Query: 126 SLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWG 185
                   + I           A        D    Y+ ++ +      I H  ++ +  
Sbjct: 236 EYTFKSPIMYIDPAFSVGMDNTAICVFEKMGDKYYAYIYQDKKPISDESILHAISVFAED 295

Query: 186 KWLPWAWPHDGLQHDK 201
             +   +  D    D+
Sbjct: 296 FNINTLYIEDRDNTDR 311


>gi|317058064|ref|ZP_07922549.1| LOW QUALITY PROTEIN: terminase [Fusobacterium sp. 3_1_5R]
 gi|313683740|gb|EFS20575.1| LOW QUALITY PROTEIN: terminase [Fusobacterium sp. 3_1_5R]
          Length = 251

 Score = 64.0 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/187 (12%), Positives = 66/187 (35%), Gaps = 10/187 (5%)

Query: 71  VIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIP 130
            +  T+ + P  +E ++++    Y     E    G  ++  G ++ I+ ++  I+  +IP
Sbjct: 5   YLHFTMEDNPTLSENKKQQYKLMYKGAFYERFILGLWVMAEGLVYQIIGDN-FIDEDEIP 63

Query: 131 EHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE------QTPIFHVAALKSW 184
                    D+G ++P A    +     + +Y+++ Y          +T   +      W
Sbjct: 64  VCDYYYISCDYGIYNPMA--WNLIGVLGNEVYIMEEYHHSGRETNETKTDEQYTQDFLEW 121

Query: 185 GKWLPWAWPHDGLQHD-KRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
            + +   +  +        S         ++G  ++       +  +   +GI  +   +
Sbjct: 122 KESICNKYGIEVEYTIVDPSASSFIVALEQEGQYVVKANNKVFEEDSERVSGIPLVQIYL 181

Query: 244 RSGRWKV 250
              R  +
Sbjct: 182 NKLRLFI 188


>gi|33601198|ref|NP_888758.1| putative phage terminase [Bordetella bronchiseptica RB50]
 gi|33602480|ref|NP_890040.1| putative phage terminase [Bordetella bronchiseptica RB50]
 gi|33575633|emb|CAE32711.1| putative phage terminase [Bordetella bronchiseptica RB50]
 gi|33576919|emb|CAE33999.1| putative phage terminase [Bordetella bronchiseptica RB50]
          Length = 425

 Score = 64.0 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/269 (16%), Positives = 81/269 (30%), Gaps = 34/269 (12%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEE--PPED----VYFEGLTRINATQ----GLVTLTLTPL 51
           ++ E+  D      +     DE      D     + + + R+  T       V +T TP 
Sbjct: 102 RSMEKPGD-IVGFKIGKGLIDELDVMKTDKAALAWRKIIARLRHTAPGLINGVDVTTTPE 160

Query: 52  KGRSPIIEHYLSASSSD-------RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTK 104
            G   + + ++               V   T     +  E     +  SYP     A  +
Sbjct: 161 -GFKFVYQQFVKQVRERPDLVALYGLVQASTYENGKNLPEDYIPSLRASYPPQLIAAYLR 219

Query: 105 GEP-ILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYV 163
           G+   L SG ++P  +  +         H     GMDF   +  A  +++    + +   
Sbjct: 220 GQFTNLTSGSVYPNFDRRLHHTDAAEEPHEELHIGMDFNVLNMTATVNVI---RAGLPLT 276

Query: 164 VKNYRCREQTPIFHVAALKSWGKWLPW---AWPHD--GLQHDKRSGEQLSAQYRRQGMKM 218
           V        TP      LK   K        +P    G    K + E   +  R+ G  +
Sbjct: 277 VGELTKVRDTPE-MARMLKERFKDKGHGVTIYPDASGGNTSSKNASESDLSILRKAGFTV 335

Query: 219 LPECATFDDGSNGVEAGISDMLDRMRSGR 247
                        V+  I+ +   + +  
Sbjct: 336 RVNSRNP-----AVKDRINAVNGMLLNDE 359


>gi|296112059|ref|YP_003622441.1| putative terminase large subunit phage [Leuconostoc kimchii IMSNU
           11154]
 gi|295833591|gb|ADG41472.1| putative terminase large subunit phage [Leuconostoc kimchii IMSNU
           11154]
          Length = 432

 Score = 64.0 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/256 (11%), Positives = 71/256 (27%), Gaps = 30/256 (11%)

Query: 18  YVWFDEEPPEDVYFE------GLTRINATQGL---VTLTLTPLKGRSPIIEHYLSASSSD 68
           ++WF+E      + E        TR    +G+      +  P +     I  ++ + S D
Sbjct: 125 WLWFEEATEFSNFTEIHTVQLSYTRQKLPKGMQVVTIFSYNPPRNPYDWINEWVESVSDD 184

Query: 69  RQV--IRMTINE--TPHYNEQERKRII--DSYPLHEREARTKGEPILGSGRIFPIVEEDI 122
                +  T  +      +EQ    I             +  GEP+     ++ +     
Sbjct: 185 ADFLVVHTTYLDDELHFLSEQYLHDIEKYKHNDYDYYRWQFLGEPVGLGTNVYKMDLFQR 244

Query: 123 VINSLDIPEH-WVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR------EQTPI 175
           + +  D+ +         D G      A           + ++  +         +  P 
Sbjct: 245 LEHLEDLNDSVVDLYFSADVGHSVSATAVGCYGVTYHRKVVLIDMWYYSPEGKVDKMAPD 304

Query: 176 FHVAALKSWGKWLPWAWPH--DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
                +  + + +   +      +  D       +  ++  G+   P             
Sbjct: 305 DLSKNIHDFIEKMYAKYGKPISNMTMDSAEASLRNQYHKDYGVDWHPVAKLKKP------ 358

Query: 234 AGISDMLDRMRSGRWK 249
             I  + + +  GR+ 
Sbjct: 359 DMIDRVQNLLAQGRFY 374


>gi|325849110|ref|ZP_08170602.1| phage terminase, large subunit, PBSX family [Anaerococcus
           hydrogenalis ACS-025-V-Sch4]
 gi|325480355|gb|EGC83418.1| phage terminase, large subunit, PBSX family [Anaerococcus
           hydrogenalis ACS-025-V-Sch4]
          Length = 439

 Score = 64.0 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 37/261 (14%), Positives = 80/261 (30%), Gaps = 19/261 (7%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRINA-TQGLVTLTLTPLKGRSPIIEHYLS 63
              K + N+       E     +D   E   R  A  +      L P      I   ++ 
Sbjct: 126 SYKKIRGNSFGMWIATEINLHHKDSIKEAFNRTAAAKRRKFFWDLNPSSPNHFIYSDHID 185

Query: 64  ASSS---------DRQVIRMTINETPHYNEQERKRIIDSYPLH--EREARTKGEPILGSG 112
              +                TI++  + ++Q +K I   Y  +    +    G  ++  G
Sbjct: 186 KYQNMIDEGIDFGGYNYKHFTIDDNINISDQRKKEIKLQYDPNSVWYKRDILGLRVVAEG 245

Query: 113 RIFPIVEEDIVINSLDIPEH--WVQIGGMDFGWHHP-FAAGHLVWNRDSDVIYVVKNYRC 169
            I+    +      +    H   +   G+DFG ++   A      +R    +Y +++ R 
Sbjct: 246 LIYKQFADIPDNYLIKEKPHELQLIQIGVDFGGNNSKHAFICTGISRGFKKVYALRSERL 305

Query: 170 REQTPIFHVAALKSWGKWLPWAWPH-DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDG 228
               P      L  + + +   + + D +  D      L    ++  +         +  
Sbjct: 306 EPDKPTDLYNQLIDFVRIIQSTYGNVDLIYADSAEQV-LIKGMQKALIDANLNIKIKNSI 364

Query: 229 SNGVEAGISDMLDRMRSGRWK 249
            N +   I  +   + S R+ 
Sbjct: 365 KNPINDRIRLVNTLVASDRFF 385


>gi|284162607|ref|YP_003401230.1| hypothetical protein Arcpr_1511 [Archaeoglobus profundus DSM 5631]
 gi|284012604|gb|ADB58557.1| protein of unknown function DUF264 [Archaeoglobus profundus DSM
           5631]
          Length = 435

 Score = 64.0 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/256 (9%), Positives = 64/256 (25%), Gaps = 25/256 (9%)

Query: 8   RDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHY---L 62
            +  + +  H +  DE    P+DV    +  + A      + +    G++   + Y    
Sbjct: 129 PEFLRGHKAHRIILDEAAFIPDDVISNIIEPMLADYNGSWIKIGTPFGKNHFYDTYLKGQ 188

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLH--EREARTKGEPILGSGRIFPIVEE 120
           S    D    R      PH + +  ++    Y  +          E +     +F   + 
Sbjct: 189 SPDFPDYSSYRFPSTVNPHISHEFIEKKKREYGENSIIFRTEYLAEFVEDQNAVFRWADI 248

Query: 121 DIVINSLDIPEHWVQIGGMDF-------GWHHPFAAGHLVWNRDSDVIYVVKNYRCREQT 173
              +++        +     +        +        L        +   + +  R   
Sbjct: 249 QKNVDNSIELIDSAENVSKQYVIGCDLAKYQDYTVIVVLDVTEKPYKLVHFERFNRR--- 305

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVE 233
              +   +    +          L      G+ +    +  G +                
Sbjct: 306 --PYAEVIMRLKELYRRFNYAKVLIDSTGVGDPVLEDLQDVGAEGYVFT------PKSKV 357

Query: 234 AGISDMLDRMRSGRWK 249
             I  +   + +G  +
Sbjct: 358 QLIQRLQAALENGEIR 373


>gi|329122215|ref|ZP_08250807.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
 gi|327474100|gb|EGF19511.1| phage terminase large subunit [Haemophilus aegyptius ATCC 11116]
          Length = 452

 Score = 63.6 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 10/104 (9%), Positives = 36/104 (34%), Gaps = 4/104 (3%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++       + + 
Sbjct: 116 IDVVWVEEGENVSKESWDVLIPTIREDGSQIIVSFNPKNILDDTYQRFVIHPPERCKSVL 175

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIF 115
           +   + P++ ++  + +               +GEP+  S ++ 
Sbjct: 176 VNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDKVI 219


>gi|66046030|ref|YP_235871.1| hypothetical protein Psyr_2794 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63256737|gb|AAY37833.1| Protein of unknown function DUF264 [Pseudomonas syringae pv.
           syringae B728a]
          Length = 433

 Score = 63.6 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 38/271 (14%), Positives = 80/271 (29%), Gaps = 38/271 (14%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRIN----ATQGLVTLTLTPL 51
           ++ E+         V +   DE         +  + + + R+       +  V +T TP 
Sbjct: 102 RSMEK-PQTIVGFKVGHALVDELDVLTSIKAQQAWRKIIARMRYNLPGLKNGVDVTTTPE 160

Query: 52  KGRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTK 104
            G   +   ++              +I+ +  +   +  +     +++SYP     A   
Sbjct: 161 -GFKFVFLQFVKQLRDKPALKEMYGLIQASTFDNELNLPDDYIPSLMESYPEQLIRAYLN 219

Query: 105 GEPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYV 163
           G+ + L SG I+   +  +      +        GMDF      A       RD  +   
Sbjct: 220 GQFVNLTSGSIYHAYDRKLNQCFDTVQAGEPLFIGMDFNVGKMAAIT--HVKRDKGLPRA 277

Query: 164 VKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQH--DKRSGEQL---------SAQYR 212
           V  +     TP       + + +     +            SG+            A  +
Sbjct: 278 VDEFMDGYDTPDMIRRIKERYWRHDGDKYIKSCEIRVYPDASGDSRKSVNASVTDIAMLK 337

Query: 213 RQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
           + G  ++   A        V+  I+ M    
Sbjct: 338 QAGFTVIAPAANPP-----VKDRINAMNAMF 363


>gi|170676278|ref|YP_001742039.1| large terminase subunit [Salmonella phage E1]
 gi|170321588|emb|CAM33107.1| phage large terminase subunit [Salmonella phage Vi II-E1]
          Length = 474

 Score = 63.6 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 74/258 (28%), Gaps = 27/258 (10%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEPPED--VYFEGLTRINATQGLVTLTLTPLKGRSPI 57
            +   +     +    +  V+ +E        +   +  + A    + +   P K   P 
Sbjct: 158 FRGLWRNITAIKGMAGLTDVFCEESENISQVSWDTLIPTVRAAGSEIIIVFNPNKETDPT 217

Query: 58  IEHYLS----------ASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEP 107
             +++               D  V+ +     P + E+ ++ +     +         E 
Sbjct: 218 WTNFVEPYINKMVDGIYQDDDIVVVNVNYVHNPWFTEELKQHMNQMKTVDYDRYLWVYEG 277

Query: 108 ILGSGRIFPIVEEDIVINSLDIPEHWV-QIGGMDFGWH-HPFAAGHLVWNR---DSDVIY 162
                    +      I++ ++   W     GMDFG+   P A   +           IY
Sbjct: 278 KFNKRSDEQVFGGKWRIDNFEVKPEWHGPYFGMDFGFSTDPTAMVEVYIEELPGGRRNIY 337

Query: 163 VVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPEC 222
           + + Y           AA++   +             D    E +S   +R G  + P  
Sbjct: 338 INREYGKVGLEITDTPAAMEQSFQ----MAKRARWYADCARPETIS-HIKRSGFDIHPC- 391

Query: 223 ATFDDGSNGVEAGISDML 240
                    VE G++ + 
Sbjct: 392 ---TKWPGSVEDGVTWLR 406


>gi|188025504|ref|ZP_02997527.1| hypothetical protein PROSTU_00661 [Providencia stuartii ATCC 25827]
 gi|188023287|gb|EDU61327.1| hypothetical protein PROSTU_00661 [Providencia stuartii ATCC 25827]
          Length = 285

 Score = 63.6 bits (153), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 52/155 (33%), Gaps = 7/155 (4%)

Query: 18  YVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIRMT 75
             W DE     E  + +    +      + +T  P K  S   + +      +  V+ M 
Sbjct: 126 IAWVDEAESVSETAWTKLTPTVREAGSEIWVTWNPEKDGSATDKRFRKKQPDNAIVVEMN 185

Query: 76  INETPHYN---EQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEH 132
            ++ P +    E+ER                +G  +  S +     +  +     D+ + 
Sbjct: 186 YDDNPWFPSVLEEERLNDQARLDAATYAWIWEGAYLENSDKQVLANKYVVQSFPDDLWKK 245

Query: 133 WVQ-IGGMDFGWHHPFAAGHLVWNRDSDVIYVVKN 166
             + + G DFG+         ++  D D +Y+ + 
Sbjct: 246 ADRLLFGADFGFAKDLNTLIRMFILD-DCLYIERE 279


>gi|260463792|ref|ZP_05811989.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259030389|gb|EEW31668.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 131

 Score = 63.6 bits (153), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 64/95 (67%)

Query: 69  RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLD 128
           R V  MTI++  HY+  ER  I+ +YP HEREAR +G P+LGSGRIFP+ E  I      
Sbjct: 3   RHVTFMTIDDAAHYSPDERAAIVAAYPAHEREARARGIPVLGSGRIFPVAEALIACEPFR 62

Query: 129 IPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYV 163
           +P +W ++G +DFGW HP AA  L W+ ++DV+YV
Sbjct: 63  LPRYWPRLGALDFGWDHPSAAVELAWDTEADVVYV 97


>gi|253999341|ref|YP_003051404.1| hypothetical protein Msip34_1632 [Methylovorus sp. SIP3-4]
 gi|253986020|gb|ACT50877.1| protein of unknown function DUF264 [Methylovorus sp. SIP3-4]
          Length = 428

 Score = 63.6 bits (153), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 34/271 (12%), Positives = 81/271 (29%), Gaps = 37/271 (13%)

Query: 7   GRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRINAT----QGLVTLTLTPLKGRSP 56
              +     +     DE         +  + + + R+       Q  V +T TP  G   
Sbjct: 107 DPSQIVGFKIGKALIDELDILAKEKAQLAWRKIIARMRYKVDNLQNGVGVTTTPE-GFKF 165

Query: 57  IIEHYLSASSSD-------RQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPI- 108
           + + ++               +   T +   +  E     +  SYP    EA  +G+ + 
Sbjct: 166 VYDQFVKQVREKPELASLYGLIHASTYDNAKNLPEDYIPSLRASYPPQLIEAYLRGKFVN 225

Query: 109 LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYR 168
           L SG ++   +         +        GMDF   +  A  +++ +    +   V    
Sbjct: 226 LNSGSVYANFDRKKNHTDAVMKPGEALHIGMDFNVMNMTATINVMRD---GLPLQVAELT 282

Query: 169 CREQTPIFHVAALKSW---GKWLPWAWPHDGLQHDKR--SGEQLSAQYRRQGMKMLPECA 223
               TP      +         +   +P    ++     + E      RR+   ++   +
Sbjct: 283 GVRDTPT-MAQIIHDRYRGNHNVIQIYPDASGKNTSSKNASESDLTILRRKEFSIMVNDS 341

Query: 224 TFDDGSNGVEAGISDMLDRMRSG----RWKV 250
                   V+  ++     + +     R+++
Sbjct: 342 NP-----AVKDRVNAYHAMILNDKGERRFRI 367


>gi|330977766|gb|EGH77669.1| hypothetical protein PSYAP_13460 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 384

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 37/271 (13%), Positives = 80/271 (29%), Gaps = 38/271 (14%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRIN----ATQGLVTLTLTPL 51
           ++ E+         V +   DE         +  + + + R+       +  V +T TP 
Sbjct: 102 RSMEK-PQTIVGFKVGHALVDELDVLTSIKAQQAWRKIIARMRYNLPGLKNGVDVTTTPE 160

Query: 52  KGRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTK 104
            G   +   ++              +I+ +  +   +  +     +++SYP     A   
Sbjct: 161 -GFKFVFLQFVKQLRDKPALKEMYGLIQASTFDNELNLPDDYIPSLMESYPEQLIRAYLN 219

Query: 105 GEPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYV 163
           G+ + L SG I+   +  +      +        GMDF      A       R+  +   
Sbjct: 220 GQFVNLTSGSIYHAYDRKLNQCFDTVQAGEPLFIGMDFNVGKMAAIT--HVKREKGLPRA 277

Query: 164 VKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHD--KRSGEQL---------SAQYR 212
           V  +     TP       + + +     +            SG+            A  +
Sbjct: 278 VDEFMDGYDTPDMIRRIKERYWRHDGDKYIKSCEIRIYPDASGDSRKSVNASVTDIAMLK 337

Query: 213 RQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
           + G  ++   A        V+  I+ M    
Sbjct: 338 QAGFTVIAPAANPP-----VKDRINAMNAMF 363


>gi|153853398|ref|ZP_01994807.1| hypothetical protein DORLON_00796 [Dorea longicatena DSM 13814]
 gi|149754184|gb|EDM64115.1| hypothetical protein DORLON_00796 [Dorea longicatena DSM 13814]
          Length = 390

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 31/253 (12%), Positives = 60/253 (23%), Gaps = 26/253 (10%)

Query: 16  VHYVWFDEEPPE----------DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL--S 63
           +  V  DE                      R N +   +     P K  +  I  +    
Sbjct: 54  IKLVVLDELTEFFDDGEGEDELSNIEATFVRGNDSDFQMIYLYNPPKNPNAPINQWCKKM 113

Query: 64  ASSSDRQVIRMTINETP--HYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIFPIVE 119
               D   I     + P                   E        G+ +     I+ +  
Sbjct: 114 EKRDDCIHIHTDYRDVPVSWLGHALIASAEAMKRADEKMYRWVWLGQAVGVDELIYYMFG 173

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCRE------QT 173
           +           +     G D+G  +        ++        +  Y          ++
Sbjct: 174 DRHRKKPDPDRRYDRIYIGGDYGQQNATTFEAFGFDAYRKKFPGLGEYYHSGRETGKQKS 233

Query: 174 PIFHVAALKSWGKWLPWAWPHDGLQHD-KRSGEQLSAQYRRQGMKMLPECATF--DDGSN 230
           P  +   L  +   L   + +         S + L+ + RR   +           D  N
Sbjct: 234 PSEYAKDLVEFMNDLHEQYDNRVFYIFLDPSAKGLAEEVRRA-TRAENLDYQVFLRDAEN 292

Query: 231 GVEAGISDMLDRM 243
            V  GIS +   +
Sbjct: 293 DVALGISRVQKVL 305


>gi|85058727|ref|YP_454429.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84779247|dbj|BAE74024.1| phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 456

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/111 (11%), Positives = 34/111 (30%), Gaps = 6/111 (5%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++  P        + ++    
Sbjct: 107 KSLEG--IDIAWVEEAEAVTKESWDILIPTIRKPGSEIWVSFNPKNILDDTYQRFVVNPL 164

Query: 67  SDRQVIRMTINETPHYNEQERKRII--DSYPLHEREARTKGEPILGSGRIF 115
            D  ++ +   + PH+ E  R  +               +GEP+  S    
Sbjct: 165 DDICLLTVHYTDNPHFPEVLRLEMEECKCKDYDLYLHIWEGEPVADSDLAI 215


>gi|168214628|ref|ZP_02640253.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens CPE str. F4969]
 gi|170713912|gb|EDT26094.1| phage terminase, large subunit, pbsx family [Clostridium
           perfringens CPE str. F4969]
          Length = 443

 Score = 63.3 bits (152), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 36/263 (13%), Positives = 80/263 (30%), Gaps = 20/263 (7%)

Query: 7   GRDKWQSNTVHYVWFDE--EPPEDVYFEGLTRI-NATQGLVTLTLTPLKGRSPIIEHYLS 63
              K + N+       E      D   E   R   A +  V   L P    + I + Y+ 
Sbjct: 125 SYKKIRGNSYGMWIATEINLHHPDSIKEAFNRTIAAQKRKVFWDLNPDNPNAFIYKDYID 184

Query: 64  ASSS---------DRQVIRMTINETPHYNEQERKRIIDSYPLH--EREARTKGEPILGSG 112
              +                TI++  + +++ ++ I   Y       +    G+  +  G
Sbjct: 185 NYKNKYDVGTLIGGYNYYHFTIDDNINISDERKEEIKSQYDKTSIWYQRDILGKRCVAEG 244

Query: 113 RIFPIV---EEDIVINSLDIPEHWVQIGGMDFGWHH-PFAAGHLVWNRDSDVIYVV--KN 166
            I+       +  +I + DI        G+DFG +    A          + + ++  + 
Sbjct: 245 LIYRRFANNPKKFIIENKDISNLMKISIGVDFGGNGSGHAFIATGITFGFEKVIILSSER 304

Query: 167 YRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFD 226
           +   +  P         + K +   +    + +   + + L    +   +K   +    D
Sbjct: 305 HFGDDIDPERLGEIFVDFVKKINHKYGFAEVAYCDSAEQVLIRGLKNAAIKEGLDIRVTD 364

Query: 227 DGSNGVEAGISDMLDRMRSGRWK 249
              + V   I+     M   R +
Sbjct: 365 AWKSTVNDRINATTKLMAQDRLQ 387


>gi|238765410|ref|ZP_04626332.1| hypothetical protein ykris0001_46080 [Yersinia kristensenii ATCC
           33638]
 gi|238696351|gb|EEP89146.1| hypothetical protein ykris0001_46080 [Yersinia kristensenii ATCC
           33638]
          Length = 381

 Score = 62.9 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/172 (9%), Positives = 41/172 (23%), Gaps = 16/172 (9%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPP-------EDVYFEGLTRIN-ATQGLVTLTLTPL- 51
               +  +   +    H V  DE          E+++   +       +G   +  TP  
Sbjct: 51  FWVTDNNKLAGRGRKYHAVLIDEAAFTKSPEMLEEIWPRAIRPTLVDYRGRAWVFSTPNG 110

Query: 52  KGRSPIIEHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEP-ILG 110
              S          S          +  P   + E +           +     E     
Sbjct: 111 IDESNFFYAICHDESLGFVKHHAPTSSNPFIPKDELEETERKSDPRVWQQEYLAEFVDWS 170

Query: 111 SGRIFPIVEEDIVINSLDIPEHWVQIGGM------DFGWHHPFAAGHLVWNR 156
              +  I +  +    + +P+H   +  +          +      +  + R
Sbjct: 171 KDALLDIDKLLVDGQPVGVPKHCDVVFAVMDTALKGGTENDGTGVVYFAYER 222


>gi|266623782|ref|ZP_06116717.1| terminase, large subunit [Clostridium hathewayi DSM 13479]
 gi|288864419|gb|EFC96717.1| terminase, large subunit [Clostridium hathewayi DSM 13479]
          Length = 440

 Score = 62.9 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 55/180 (30%), Gaps = 13/180 (7%)

Query: 15  TVHYVWFDEEPPE------DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSD 68
            +  +W +E              + + R       +  +  P K  S     Y+    + 
Sbjct: 263 YIGILWLEELDQFVGPESVRKIEQSVIR-GGEVAYIFKSFNPPKTASNWANKYIKVPKAS 321

Query: 69  RQVIRMTINETPHY----NEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
           R V   T  + P         +    +        +    G    GSG           I
Sbjct: 322 RLVTESTYLDVPPKWLGKPFLDEAEFLKEVNPDAYDNEYMGV-ANGSGGSVFDNVTIRKI 380

Query: 125 NSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKS 183
              +I +    + G+D+GW+   +A   + ++     +Y+ + Y C +Q+       L  
Sbjct: 381 TDEEIAQFDHVLNGVDWGWYPDLYAFVRVHYDPARLRLYIWQEYTCNKQSNRKTADKLIE 440


>gi|85059367|ref|YP_455069.1| putative phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
 gi|84779887|dbj|BAE74664.1| putative phage terminase large subunit [Sodalis glossinidius str.
           'morsitans']
          Length = 264

 Score = 62.5 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 11/111 (9%), Positives = 33/111 (29%), Gaps = 6/111 (5%)

Query: 9   DKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASS 66
              +   +   W +E     ++ +   +  I      + ++           + ++    
Sbjct: 108 KSLEG--IDIAWVEEAEAVTKESWDILIPTIRKPGSEIWVSFNSKNILDDTYQRFVVNPP 165

Query: 67  SDRQVIRMTINETPHYNEQERKRII--DSYPLHEREARTKGEPILGSGRIF 115
            D  ++ +   + PH+ E  R  +               +G+P+  S    
Sbjct: 166 DDICLLTVHYTDNPHFPEVLRLEMEECKCKDYDLYLHIWEGQPVADSDLAI 216


>gi|258508120|ref|YP_003170871.1| phage-related terminase large subunit [Lactobacillus rhamnosus GG]
 gi|257148047|emb|CAR87020.1| Phage-related terminase, large subunit [Lactobacillus rhamnosus GG]
          Length = 453

 Score = 62.5 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 34/254 (13%), Positives = 72/254 (28%), Gaps = 29/254 (11%)

Query: 19  VWFDEEPPE---DVYFEG---LTRINAT---QGLVTLTLTPLKGRSPIIEHYLS--ASSS 67
           VW++E       +V+ +      R  +    Q  V  T  P K     I  ++       
Sbjct: 135 VWYEEAANFKSAEVFDQTNPTFIRQKSPWVDQVQVFYTYNPPKNPYDWINEWIDSVRGDP 194

Query: 68  DRQVIRMTI--NETPHYNEQERK--RIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIV 123
           D  +   T   ++    +EQ+ K      +           G+ I     ++ +     +
Sbjct: 195 DFFIDTSTYLDDDLGFTDEQQLKLIDKYKANDYDYYRWLYLGDVIGLGTNVYNMDLFHRL 254

Query: 124 INSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR------EQTPIFH 177
                       +  +D G  +             + + V+  Y         ++ P   
Sbjct: 255 DEVPSNDPIRRLVFSIDAGHINSATTCVAAAVTAKNNLIVLDTYYYSPANQSVKKAPSDL 314

Query: 178 VAALKSWGKWLPWAWPHDG--LQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           V  +KS+   +   + H       D   G   +   +  G++          G       
Sbjct: 315 VPEIKSFIDKVRSKYNHPVLKYTIDSAEGALRNEFVKEFGIRW----HGIVKGKEA--DM 368

Query: 236 ISDMLDRMRSGRWK 249
           I  + + +  GR  
Sbjct: 369 IDFVSNLLAQGRVF 382


>gi|296160121|ref|ZP_06842940.1| phage terminase, large subunit, PBSX family [Burkholderia sp.
           Ch1-1]
 gi|295889595|gb|EFG69394.1| phage terminase, large subunit, PBSX family [Burkholderia sp.
           Ch1-1]
          Length = 494

 Score = 62.5 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 34/278 (12%), Positives = 67/278 (24%), Gaps = 45/278 (16%)

Query: 1   LKAYEQGRDKWQSNT-VHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPI 57
            +   + +   +  T     W DE      D +   +  I      V +T  P K   P 
Sbjct: 150 FRGLYRNQRGIKGFTKASKAWVDEADGVSRDSWEILMPTIREKGSEVWVTFNPNKAHDPT 209

Query: 58  I-----------EHYLSASSSDRQVIRMTINETPHYNE--QERKRIIDSYPLHEREARTK 104
                       +        D  +IR    + P + E  +  +  ++            
Sbjct: 210 WTDLIGPYEHLLDDGGCYEDDDVLIIRANYTDNPWFTEELELERAKMERVDKDRYNWIWL 269

Query: 105 GEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWN-------- 155
           G+    S  +  I        + + P +     G D+G+   P                 
Sbjct: 270 GQFNKRSNEL--IFAGKWRTEAFETPANVRFFFGADWGFAQDPTTLNRSFVKGNTLFVDY 327

Query: 156 ------RDSDVIYVVKNYRC-----REQTPIFHVAALKSWGKWLPWAWPHDGL--QHDKR 202
                 +++     +              P              P          + D  
Sbjct: 328 EANSLRQNAGKGVDLDELWKLFAGSEGMRPAQRQQWKAEDALKYPGVPGARKWKIKADCA 387

Query: 203 SGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
             E +S   ++ G  +             VE GI+ + 
Sbjct: 388 RPETISLVAKQ-GFNIDAA----KKWGGSVEDGITFLR 420


>gi|229844502|ref|ZP_04464642.1| predicted phage terminase large subunit [Haemophilus influenzae
           6P18H1]
 gi|229812751|gb|EEP48440.1| predicted phage terminase large subunit [Haemophilus influenzae
           6P18H1]
          Length = 452

 Score = 62.5 bits (150), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 10/104 (9%), Positives = 37/104 (35%), Gaps = 4/104 (3%)

Query: 16  VHYVWFDE--EPPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYLSASSSDRQVIR 73
           +  VW +E     ++ +   +  I      + ++  P        + ++       + + 
Sbjct: 116 IDVVWVEEGENVSKESWDVLIPTIREDGSQIIVSFNPKNILDDTYQRFVIHPPERCKSVL 175

Query: 74  MTINETPHYNEQERKRIIDSYPLHE--REARTKGEPILGSGRIF 115
           +   + P++ ++  + ++              +GEP+  S ++ 
Sbjct: 176 VNWQDNPYFPKELMEDMVQMRERDYELYRHVYEGEPVADSDKVI 219


>gi|221196218|ref|ZP_03569265.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221202891|ref|ZP_03575910.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221176825|gb|EEE09253.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221182772|gb|EEE15172.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 424

 Score = 62.5 bits (150), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 62/237 (26%), Gaps = 22/237 (9%)

Query: 6   QGRDKWQSNTVHYVWFDE--EPP---EDVYFEGLTRI-NATQGLVTLTLTP-LKGRSPII 58
           Q  D  +S     V  DE    P     ++ + +       +G   +  TP         
Sbjct: 104 QDEDAGRSRFYDRVIIDEGSLVPKGLRSIWEQAIAPTLLDRKGHAIMAGTPKGIDPENFF 163

Query: 59  EHYLSASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEP-ILGSGRIFPI 117
               +  +   +         P  + +   R+ D YP    +     +         F  
Sbjct: 164 YEACTDKTLGWREFHAPTASNPMLDPEAVARLKDEYPALVYQQEYLADFVDWNGAAFFSE 223

Query: 118 VEEDIVINSLDIPEHWVQIGGM------DFGWHHPFAAGHLVWNRDSDVIYVV---KNYR 168
               +    +D P    Q+  +      D   H   A  +   N  +     +      +
Sbjct: 224 ESLLVDGEPVDYPTRCDQVFAVVDTALKDGLEHDGTAVTYFARNVITGTPLTILDWDVLQ 283

Query: 169 CREQTPIFHVAALKSWGKWLPWAWPH-----DGLQHDKRSGEQLSAQYRRQGMKMLP 220
                    +  +    + L            G   DK SG  L  Q +R+ +   P
Sbjct: 284 IEGALLESWLPTVAQRCEELAAQVGARQGSLGGWIEDKASGIVLLQQAKRRSLPFHP 340


>gi|195942579|ref|ZP_03087961.1| hypothetical protein Bbur8_07059 [Borrelia burgdorferi 80a]
          Length = 450

 Score = 62.1 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E          E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHRQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +  + T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYKFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTIIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|259649436|dbj|BAI41598.1| phage terminase large subunit [Lactobacillus rhamnosus GG]
          Length = 446

 Score = 62.1 bits (149), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 34/254 (13%), Positives = 72/254 (28%), Gaps = 29/254 (11%)

Query: 19  VWFDEEPPE---DVYFEG---LTRINAT---QGLVTLTLTPLKGRSPIIEHYLS--ASSS 67
           VW++E       +V+ +      R  +    Q  V  T  P K     I  ++       
Sbjct: 128 VWYEEAANFKSAEVFDQTNPTFIRQKSPWVDQVQVFYTYNPPKNPYDWINEWIDSVRGDP 187

Query: 68  DRQVIRMTI--NETPHYNEQERK--RIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIV 123
           D  +   T   ++    +EQ+ K      +           G+ I     ++ +     +
Sbjct: 188 DFFIDTSTYLDDDLGFTDEQQLKLIDKYKANDYDYYRWLYLGDVIGLGTNVYNMDLFHRL 247

Query: 124 INSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR------EQTPIFH 177
                       +  +D G  +             + + V+  Y         ++ P   
Sbjct: 248 DEVPSNDPIRRLVFSIDAGHINSATTCVAAAVTAKNNLIVLDTYYYSPANQSVKKAPSDL 307

Query: 178 VAALKSWGKWLPWAWPHDG--LQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAG 235
           V  +KS+   +   + H       D   G   +   +  G++          G       
Sbjct: 308 VPEIKSFIDKVRSKYNHPVLKYTIDSAEGALRNEFVKEFGIRW----HGIVKGKEA--DM 361

Query: 236 ISDMLDRMRSGRWK 249
           I  + + +  GR  
Sbjct: 362 IDFVSNLLAQGRVF 375


>gi|11497347|ref|NP_051454.1| hypothetical protein BBN43 [Borrelia burgdorferi B31]
 gi|6382368|gb|AAF07680.1|AE001581_22 conserved hypothetical protein [Borrelia burgdorferi B31]
          Length = 450

 Score = 62.1 bits (149), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  ++   T  +    ++   +     Y      +AR   GE I  +  I     +
Sbjct: 213 DN-IATFKIYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI---FTQ 268

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
             + +          +           A   +   R  D  Y       R     + +  
Sbjct: 269 INITDDYIFTSPIAYLDPAFSVGGDNTALCVM--ERVDDKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITM 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|297620908|ref|YP_003709045.1| hypothetical protein wcw_0671 [Waddlia chondrophila WSU 86-1044]
 gi|297376209|gb|ADI38039.1| conserved hypothetical protein [Waddlia chondrophila WSU 86-1044]
          Length = 499

 Score = 62.1 bits (149), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 50/163 (30%), Gaps = 9/163 (5%)

Query: 83  NEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFG 142
           +E + + +   +P    EA       L  GR      +   I ++    +       D G
Sbjct: 268 SETQGEDMKREFPSTPEEAFEVSNEGLYYGRQIVEARQHGRIRNVYYDANVPVHTAWDLG 327

Query: 143 WHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWL-PWAWPHDGLQHDK 201
           ++   A     +      I++++ Y    +    ++  +KS          PHD   H+ 
Sbjct: 328 YNDSTAIWW--YQVCGQEIHLLEYYENSGEPLTHYLQIVKSKPYVYGKHIVPHDAAVHEY 385

Query: 202 RSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMR 244
            +G       R  G+               +  GI  + +   
Sbjct: 386 STGLSRVEVARNHGVSFTIAP------KIDLIEGIDAVRNIFN 422


>gi|315168841|gb|EFU12858.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX1341]
          Length = 429

 Score = 61.7 bits (148), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 39/246 (15%), Positives = 74/246 (30%), Gaps = 20/246 (8%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTL-TPLKGRSPIIEHYLSASSSDRQVI-RMTINETPH 81
              +D   E   R  A +    L    P     P +E       S R +    T ++ P 
Sbjct: 134 LLHKDFINECFRRTFAAEWRYHLGEQNPPAPNHPNLELLERFEKSGRFLFRHWTPDDNPI 193

Query: 82  YNEQERKRIIDSYPLHER--EARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGM 139
            +E  ++++ D     E   E    G  +L  G I+ +  ++     +            
Sbjct: 194 LSESRKQQLYDELSSSEYLLERDWYGHRVLPQGVIYSMFGKNNKATEIKGNIIETFFTA- 252

Query: 140 DFGWHHPFAAGHLVWNRDSDVIYVVKN--YRCREQTP------IFHVAALKSWGKWLPWA 191
           D G          V        Y+ +   Y               +   +K + +W    
Sbjct: 253 DGGQADATTCAFWVVTFYDGKFYLYRLANYYHSGTDTGETKAMSIYAKEIKRFVEWCYTK 312

Query: 192 WPHDGLQHD---KRSGEQLSAQYRRQGMKMLPECATFDDGSNG----VEAGISDMLDRMR 244
           W H    +      + + L ++    G+          D  +     +E GI  + + M 
Sbjct: 313 WNHLPHWNYFFVDPACKTLRSELDLIGIITDKADNNSSDKVSSNGLKIEVGIERLQNTMI 372

Query: 245 SGRWKV 250
           SG++ V
Sbjct: 373 SGQFIV 378


>gi|224020497|ref|YP_002601287.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           64b]
 gi|223929730|gb|ACN24438.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           64b]
          Length = 450

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
           +   +  +    T  +    ++   +     Y      +AR   GE I  +  I     +
Sbjct: 213 NN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI---FTQ 268

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
             + +          +           A   +   R  D  Y       R     + +  
Sbjct: 269 INITDDYIFTSPIAYLDPAFSVGGDNTALCVM--ERVDDKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITM 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|225575989|ref|YP_002724899.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           118a]
 gi|225546587|gb|ACN92590.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           118a]
          Length = 450

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/252 (11%), Positives = 68/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
              S   +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DNIS-TFKTYNFTTYDNVLLSKGFVETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  YV      R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYVFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|197261559|ref|YP_002154374.1| terminase large subunit [Bacillus phage IEBH]
 gi|197092431|gb|ACH42306.1| terminase large subunit [Bacillus phage IEBH]
          Length = 432

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 33/256 (12%), Positives = 71/256 (27%), Gaps = 32/256 (12%)

Query: 19  VWFDEEPPE------DVYFEGLTR--INATQGLVTLTLTPLK----GRSPIIEHYLSASS 66
           +WF+E          D+  +   R  I   +  V  +  P +      +  ++    A  
Sbjct: 129 LWFEEAAEFAGVEDIDIVEDTFIRQEIEGKEVKVYFSYNPPRNPYSWINEWLD--SKAGD 186

Query: 67  SDRQVIRMTINETP--HYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVI 124
            D  +   T  +      ++Q  ++I           R      +            I  
Sbjct: 187 EDYFIHHSTYMDDKKGFLSQQMIRKIEKYKIHDLDYWRWMYGGEVIGLGDMVYNMNHIQE 246

Query: 125 NSLDIPEHWVQIGGMDFGWHH---PFAAGHLVWNRDSDVIYVVKNYRC-----REQTPIF 176
                 +  + +        H         L + +  +VI +   Y        ++ P  
Sbjct: 247 IDELPHDDDIILIDTASDTGHQVSATTHLSLAFTKKRNVILLDTYYYSPANKVVKKAPSE 306

Query: 177 HVAALKSWGKWLPWAWPH--DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
                K W   +   +    D    D   G   +  ++  G+++ P              
Sbjct: 307 LSKDFKEWQDSIIKMYNRYFDKQTIDSAEGALRNQVFKDYGIRLHP------IAKKKKID 360

Query: 235 GISDMLDRMRSGRWKV 250
            I ++ D +  GR+ V
Sbjct: 361 MIDNVQDLLAQGRFFV 376


>gi|312148837|gb|ADQ31485.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           JD1]
          Length = 450

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 68/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++  +   +  +
Sbjct: 386 LITPLTYKKLYI 397


>gi|302186554|ref|ZP_07263227.1| hypothetical protein Psyrps6_09413 [Pseudomonas syringae pv.
           syringae 642]
          Length = 433

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 37/271 (13%), Positives = 80/271 (29%), Gaps = 38/271 (14%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEEP------PEDVYFEGLTRIN----ATQGLVTLTLTPL 51
           ++ E+         V +   DE         +  + + + R+       +  V +T TP 
Sbjct: 102 RSMEK-PQTIVGFKVGHALVDELDVLTSIKAQQAWRKIIARMRYNLPGLKNGVDVTTTPE 160

Query: 52  KGRSPIIEHYLSASSSD------RQVIRMTINETP-HYNEQERKRIIDSYPLHEREARTK 104
            G   +   ++              +I+ +  +   +  +     +++SYP     A   
Sbjct: 161 -GFKFVFLQFVKQMRDKPALKEMYGLIQASTFDNELNLPDDYIPSLMESYPEQLIRAYLN 219

Query: 105 GEPI-LGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYV 163
           G+ + L SG I+   +  +      +        GMDF      A       R+  +   
Sbjct: 220 GQFVNLTSGSIYHAYDRKLNQCFDTVQAGEPLFIGMDFNVGKMAAIT--HVKREKGLPRA 277

Query: 164 VKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQH--DKRSGEQL---------SAQYR 212
           V  +     TP       + + +     +            SG+            A  +
Sbjct: 278 VDEFMDGYDTPDMIRRIKERYWRHDGDKYIKTCEVRVYPDASGDSRKSVNASVTDIAMLK 337

Query: 213 RQGMKMLPECATFDDGSNGVEAGISDMLDRM 243
           + G  ++   A        V+  I+ M    
Sbjct: 338 QAGFTVIAPAANPP-----VKDRINAMNAMF 363


>gi|87307615|ref|ZP_01089759.1| hypothetical protein DSM3645_28877 [Blastopirellula marina DSM
           3645]
 gi|87289785|gb|EAQ81675.1| hypothetical protein DSM3645_28877 [Blastopirellula marina DSM
           3645]
          Length = 429

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/168 (10%), Positives = 44/168 (26%), Gaps = 12/168 (7%)

Query: 10  KWQSNTVHYVWFDEEPPE--DVYFEGLTR-INATQGLVTLTLTPLKGRSPIIEHYLSASS 66
             +   +  +  DE      +V+ + L   ++  +G      TP        +H L    
Sbjct: 134 SLRGEGLDGMIGDEFAFVRKEVWSDALRPALSDRRGWSMFLTTPNGPNWMKDQHDLDGVD 193

Query: 67  SDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIF---PIVEEDIV 123
              +  +   ++    ++ E    +        +   + + +  SG  F           
Sbjct: 194 PTYKSWQCPTSDNCLIDQAELDSALLDLGQASFDQEYRAQFVDVSGAEFSGLYFQTPKFW 253

Query: 124 INSLDIPEHWV-QIGGMDFG-----WHHPFAAGHLVWNRDSDVIYVVK 165
            +          ++ G+D            A   L    D  +     
Sbjct: 254 FDDWPPESEIRFRVIGLDPSKGKNDKSDYSAFVMLALAGDGQIYVDAD 301


>gi|315426011|dbj|BAJ47659.1| prophage MuMc02, terminase, ATPase subunit [Candidatus
           Caldiarchaeum subterraneum]
          Length = 439

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/214 (14%), Positives = 61/214 (28%), Gaps = 14/214 (6%)

Query: 7   GRDKWQSNTVHYVWFDEEPPE----DVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
             +  +      V+ DE        ++    +    A  G VTL  TP   R    E + 
Sbjct: 127 NPESLRGYRADAVYVDEAAFFRGDTNLKTAIMFTTVARNGRVTLVSTPKGKRGWFHEAWT 186

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE--E 120
           + ++       + + ++PH    + + +  +    E       E +       P  +  E
Sbjct: 187 TDNT--WSKHLVKLGDSPHITMHDLEELRKTMSPLEWRQEMMCEFLDEVNAFIPYEKILE 244

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
            +               G+DFG              D +   V      R++     + A
Sbjct: 245 CVEDYVPARVVGGRVYVGVDFGRFRDSTVII-AVVEDGERFRVCYVEELRQKPFAAQLEA 303

Query: 181 L-KSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRR 213
           + ++     P     D        G  L+    +
Sbjct: 304 INRANMVLHPAIVAVDS----TGMGAPLAETLAK 333


>gi|219723105|ref|YP_002474527.1| phage terminase, large subunit, pbsx family [Borrelia garinii PBr]
 gi|219694031|gb|ACL34563.1| phage terminase, large subunit, pbsx family [Borrelia garinii PBr]
          Length = 450

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/238 (11%), Positives = 63/238 (26%), Gaps = 16/238 (6%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCAQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
              ++     + T  +    +++  K     Y      +AR   GE I  +  I    + 
Sbjct: 213 DNVATFNTY-KFTTYDNVLLSKEFIKTQEKLYKDIPAYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +  A   +  +R  D  Y       R     + +  
Sbjct: 270 NITQDYVFTSPIAYLDPAFSIGGDN-TALCVM--DRVDDKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGKWLPWA--WPHDGLQHDKRSGEQLSAQY---RRQGMKMLPECATFDDGSNGVE 233
           +K+  +       +  D     K +G             G                  
Sbjct: 327 VKTVLENFNVNTLYLEDRDN-TKGAGALTREYMTLRNNMGHYFRIVPIKPKSNKFSRI 383


>gi|11497152|ref|NP_051291.1| hypothetical protein BB_R45 [Borrelia burgdorferi B31]
 gi|6382173|gb|AAF07489.1|AE001577_3 conserved hypothetical protein [Borrelia burgdorferi B31]
          Length = 450

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITNDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 VITPFTYKKLYI 397


>gi|224020463|ref|YP_002601168.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           64b]
 gi|223929158|gb|ACN23879.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           64b]
          Length = 450

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITNDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|150007526|ref|YP_001302269.1| putative phage large subunit terminase [Parabacteroides distasonis
           ATCC 8503]
 gi|149935950|gb|ABR42647.1| putative phage large subunit terminase [Parabacteroides distasonis
           ATCC 8503]
          Length = 422

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/230 (11%), Positives = 66/230 (28%), Gaps = 36/230 (15%)

Query: 30  YFEGLTRINATQ--GLVTLTLTPLKGRSPIIEHYLSASS---------------SDRQVI 72
           + + +  I        + + + P      I + Y+  +                 +   I
Sbjct: 141 FDKIMLSIRKKGIQNRIIIIMNPCDSNHFIYKKYIENTHKLVEIDGVQVQISTHPNVLHI 200

Query: 73  RMTINET-PHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLDIPE 131
             T  +   + + +  K + D    +  +                + ++  +++      
Sbjct: 201 HTTYLDNLENLSPEFLKEVEDMKVNNPEKYAHVVIGRWADVAEGAVFKKWGIVDEFPAWA 260

Query: 132 HWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPW 190
                 G DFG+   P A+         + +Y+ +            + +L+ WG     
Sbjct: 261 -KKVAIGQDFGYTHDPSASIRCGI--VDNALYLDEIDYRTGLLSSDIIKSLRPWGLK--- 314

Query: 191 AWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISDML 240
                       +  +L  +    G+K+       + G+  V AG+  M 
Sbjct: 315 -------VIADSADPRLIQEIHNGGVKI----YAVEKGAGSVNAGLDKMQ 353


>gi|255972605|ref|ZP_05423191.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|256762688|ref|ZP_05503268.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|257422423|ref|ZP_05599413.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|255963623|gb|EET96099.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|256683939|gb|EEU23634.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|257164247|gb|EEU94207.1| conserved hypothetical protein [Enterococcus faecalis X98]
          Length = 429

 Score = 61.3 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 39/246 (15%), Positives = 75/246 (30%), Gaps = 20/246 (8%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTL-TPLKGRSPIIEHYLSASSSDRQVI-RMTINETPH 81
              +D   E   R  A +    L    P     P +E       S R +    T ++ P 
Sbjct: 134 LLHKDFINECFRRTFAAEWRYHLGEQNPPAPNHPNLELLERFEKSGRFLFRHWTPDDNPI 193

Query: 82  YNEQERKRIIDSYPLHER--EARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGM 139
            +E  ++++ D     E   E    G  +L  G I+ +  ++     +            
Sbjct: 194 LSESRKQQLYDELSSSEYLLERDWYGHRVLPQGVIYSMFGKNNKATEIKGNIIETFFTA- 252

Query: 140 DFGWHHPFAAGHLVWNRDSDVIYVVKN--YRCREQTP------IFHVAALKSWGKWLPWA 191
           D G          V    +   Y+ +   Y               +   +K + +W    
Sbjct: 253 DGGQADATTCAFWVVTFYAGKFYLYRLANYYHSGTDTGETKAMSIYAKEIKQFVEWCYTK 312

Query: 192 WPHDGLQHD---KRSGEQLSAQYRRQGMKMLPECATFDDGSNG----VEAGISDMLDRMR 244
           W H    +      + + L ++    G+          D  +     +E GI  + + M 
Sbjct: 313 WNHLPHWNYFFVDPACKTLRSELDLIGIITDKADNNSSDKVSSNGLKIEVGIERLQNTMI 372

Query: 245 SGRWKV 250
           SG++ V
Sbjct: 373 SGQFIV 378


>gi|219723069|ref|YP_002474484.1| phage terminase, large subunit, pbsx family protein [Borrelia
           burgdorferi 156a]
 gi|219693000|gb|ACL34209.1| phage terminase, large subunit, pbsx family protein [Borrelia
           burgdorferi 156a]
 gi|312147710|gb|ADQ30370.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           JD1]
          Length = 450

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E          E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHRQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
           +   +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 NN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNI 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITA 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|315144258|gb|EFT88274.1| phage terminase, large subunit, PBSX family [Enterococcus faecalis
           TX2141]
          Length = 429

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 39/246 (15%), Positives = 75/246 (30%), Gaps = 20/246 (8%)

Query: 24  EPPEDVYFEGLTRINATQGLVTLTL-TPLKGRSPIIEHYLSASSSDRQVI-RMTINETPH 81
              +D   E   R  A +    L    P     P +E       S R +    T ++ P 
Sbjct: 134 LLHKDFINECFRRTFAAEWRYHLGEQNPPAPNHPNLELLERFEKSGRFLFRHWTPDDNPI 193

Query: 82  YNEQERKRIIDSYPLHER--EARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGM 139
            +E  ++++ D     E   E    G  +L  G I+ +  ++     +            
Sbjct: 194 LSESRKQQLYDELSSSEYLLERDWYGHRVLPQGVIYSMFGKNNKATEIKGNIIETFFTA- 252

Query: 140 DFGWHHPFAAGHLVWNRDSDVIYVVKN--YRCREQTP------IFHVAALKSWGKWLPWA 191
           D G          V    +   Y+ +   Y               +   +K + +W    
Sbjct: 253 DGGQADATTCAFWVVTFYAGKFYLYRLANYYHSGTDTGETKAMSIYAKEIKQFVEWCYTK 312

Query: 192 WPHDGLQHD---KRSGEQLSAQYRRQGMKMLPECATFDDGSNG----VEAGISDMLDRMR 244
           W H    +      + + L ++    G+          D  +     +E GI  + + M 
Sbjct: 313 WNHLPHWNYFFVDPACKTLRSELDLIGIITDKADNNSSDKVSSNGLKIEVGIERLQNTMI 372

Query: 245 SGRWKV 250
           SG++ V
Sbjct: 373 SGQFIV 378


>gi|226246889|ref|YP_002776229.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           Bol26]
 gi|226202275|gb|ACO37943.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           Bol26]
          Length = 450

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 66/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I     +
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI---FTQ 268

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
             + +          +           A   +   R  D  Y       R     + +  
Sbjct: 269 INITDDYIFTSPIAYLDPAFSVGGDNTALCVM--ERVDDKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|225576422|ref|YP_002725451.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           118a]
 gi|225547005|gb|ACN92996.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           118a]
          Length = 450

 Score = 60.9 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKHYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|224535095|ref|ZP_03675642.1| phage terminase, large subunit, pbsx family [Borrelia spielmanii
           A14S]
 gi|224513629|gb|EEF83976.1| phage terminase, large subunit, pbsx family [Borrelia spielmanii
           A14S]
          Length = 450

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/234 (10%), Positives = 65/234 (27%), Gaps = 18/234 (7%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLKEALKRLRRGQETIIFDTNPDHPEHFFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    +++  K     Y      +AR   GE +  +  I    + 
Sbjct: 213 DN-VATFKTYNFTTYDNVFLSKEFIKTQEKLYKDIPTYKARVLLGEWVSSTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + + +            G  +         +   D  Y       R     + +  
Sbjct: 270 NITQDYVFVSPIAYLDPAFSIGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQY-----RRQGMKMLPECATFDD 227
           +K+  +   +   +  D     K +G                 +++P     + 
Sbjct: 327 VKTVLENFNVHTFYLEDRDN-TKGAGALTREYMTLRNNMSHNFRIIPVKPKSNK 379


>gi|190151448|ref|YP_001974359.1| putative large subunit of phage terminase [Streptococcus phage
           PH15]
 gi|190014442|emb|CAQ57828.1| hypothetical protein [Streptococcus phage PH15]
          Length = 435

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 33/255 (12%), Positives = 63/255 (24%), Gaps = 30/255 (11%)

Query: 19  VWFDEEPPE---DVYFEG---LTRINATQGLV---TLTLTPLKGRSPIIEHYLS--ASSS 67
           VW++E       + + +      R             +  P +     I  +        
Sbjct: 129 VWYEEAAEFSNQEDFDQTNVTFMRQKHPDVPFVKFFWSYNPPRNPYSWINEWWDSLKERE 188

Query: 68  DRQVIRMTINE--TPHYNEQERKRIID--SYPLHEREARTKGEPILGSGRIFPIVEEDIV 123
           D  + + +  +       EQ    I                GEP+     ++ +     V
Sbjct: 189 DYLLHKSSYLDDELGFVTEQMLADIERIKENDYDYYRYIYLGEPVGLGTNVYNMDLFHRV 248

Query: 124 INSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCR------EQTPIFH 177
               D      Q+   D G              +   +Y+V NY         ++ P   
Sbjct: 249 DKIPDNERVIGQLFAADTGHQQSATTCLHAVVTNKRKLYLVDNYYYSPAGKTHKKAPSVL 308

Query: 178 VAALKSWG---KWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEA 234
              L  +      L    P   +  D   G   +      G++  P           V  
Sbjct: 309 SKELHEFVTSQTKLFVNVPVVEMTIDSAEGALRNQYLEDFGIRWHP----VAKKKKIVMT 364

Query: 235 GISDMLDRMRSGRWK 249
               +   +  GR+ 
Sbjct: 365 --EYVQSLLADGRFY 377


>gi|225575978|ref|YP_002724813.1| phage terminase, large subunit, pbsx family [Borrelia sp. SV1]
 gi|225576296|ref|YP_002725339.1| phage terminase, large subunit, pbsx family [Borrelia sp. SV1]
 gi|225547342|gb|ACN93326.1| phage terminase, large subunit, pbsx family [Borrelia sp. SV1]
 gi|225547454|gb|ACN93434.1| phage terminase, large subunit, pbsx family [Borrelia sp. SV1]
          Length = 450

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/232 (12%), Positives = 64/232 (27%), Gaps = 12/232 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
             ++   +  + T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DNTA-TFKTYKFTTYDNVLLSKGFIETQEKLYKDIPTYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I+ + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NIIQDYVFTSPIAYLDPAFSIGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
           +K+  +   +   +  D        G        R  M      A     SN
Sbjct: 327 VKTVLENFNVHTLYLEDRDNTKGAGGLTREYIMLRSNMSQYFRIAPVKPKSN 378


>gi|288924494|ref|ZP_06418458.1| hypothetical protein FrEUN1fDRAFT_8156 [Frankia sp. EUN1f]
 gi|288344160|gb|EFC78725.1| hypothetical protein FrEUN1fDRAFT_8156 [Frankia sp. EUN1f]
          Length = 229

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/165 (18%), Positives = 56/165 (33%), Gaps = 20/165 (12%)

Query: 98  EREARTKGEPILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRD 157
             +    G+ ++  G I+ + +ED  +             G+D+G  +PF+   L    D
Sbjct: 7   WYKRFILGQWVMAEGAIYDMWDEDTHLVDRLPSIERWLALGVDYGTVNPFSGLLLGLGND 66

Query: 158 SDVIYVVKNYR------CREQTPIFHVAALKSW------GKWLPWAWPHDGLQHDKRSGE 205
              +Y+   +R       R  T   +   ++ W      G   P     +    D  S  
Sbjct: 67  -RRLYLTHEWRWDSKLERRSLTDSQYSTRVREWLTALDLGMNAPARVDPEWFIVD-PSAA 124

Query: 206 QLSAQYRRQGMKMLPECATFDDGSNGVEAGISDMLDRMRSGRWKV 250
               Q    G+      A    G N V +GI  +   + + R +V
Sbjct: 125 SFKTQLFSDGV------ANVMGGDNDVVSGIRTVASLLGNDRLRV 163


>gi|219723016|ref|YP_002474442.1| phage terminase, large subunit, pbsx family protein [Borrelia
           burgdorferi 156a]
 gi|219692691|gb|ACL33908.1| phage terminase, large subunit, pbsx family protein [Borrelia
           burgdorferi 156a]
          Length = 450

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
              +   +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DNMA-TFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|224022662|ref|YP_002606275.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           64b]
 gi|224593632|ref|YP_002640950.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           CA-11.2a]
 gi|223929246|gb|ACN23964.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           64b]
 gi|224554688|gb|ACN56067.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           CA-11.2a]
          Length = 450

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|219723193|ref|YP_002474612.1| phage terminase, large subunit, pbsx family protein [Borrelia
           burgdorferi 156a]
 gi|224591572|ref|YP_002640899.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           CA-11.2a]
 gi|219693035|gb|ACL34243.1| phage terminase, large subunit, pbsx family protein [Borrelia
           burgdorferi 156a]
 gi|224554907|gb|ACN56281.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           CA-11.2a]
          Length = 450

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|224983785|ref|YP_002641105.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           WI91-23]
 gi|224553986|gb|ACN55383.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           WI91-23]
          Length = 450

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/232 (11%), Positives = 60/232 (25%), Gaps = 12/232 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSN 230
           +K+  +   +   +  D        G        R  +            SN
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSN 378


>gi|28378986|ref|NP_785878.1| prophage Lp2 protein 36 [Lactobacillus plantarum WCFS1]
 gi|28271824|emb|CAD64729.1| prophage Lp2 protein 36 [Lactobacillus plantarum WCFS1]
          Length = 233

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 49/153 (32%), Gaps = 14/153 (9%)

Query: 91  IDSYPLHEREARTKGEPILGSGRIFPIVEEDIVINSLD-IPEHWVQIGGMDFG-WHHPFA 148
           +        +    G+  +  G +F    E I  N++D I E      G+D+G  + P A
Sbjct: 15  LYQTNPRRAKTVVDGDWGVAEGLVFEDNIEQIEFNTMDKIQECGQTGFGLDYGFGNDPNA 74

Query: 149 AGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLS 208
              +  +  +  ++V        QT       LK+ G      +             + +
Sbjct: 75  FVAVAVDVRNKQLWVYDEMYTYHQTTPHVAEWLKANGYERARIYADSA-------NPERT 127

Query: 209 AQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
           AQ    G+               +EAGI  +  
Sbjct: 128 AQLNDLGI-----VNADSVVKTPIEAGIDQLWQ 155


>gi|312147637|gb|ADQ30298.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           JD1]
          Length = 450

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|224590670|ref|YP_002640676.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           WI91-23]
 gi|224553765|gb|ACN55167.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           WI91-23]
          Length = 450

 Score = 60.9 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|313611711|gb|EFR86253.1| phage terminase, large subunit, pbsx family [Listeria monocytogenes
           FSL F2-208]
          Length = 466

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 35/258 (13%), Positives = 70/258 (27%), Gaps = 29/258 (11%)

Query: 15  TVHYVWFDEEPPE------DVYFEGLTRINATQGL---VTLTLTPLKGRSPIIEHY--LS 63
            V  +WF+E          DV  +   R +   G    + ++  P +     +  Y    
Sbjct: 158 YVSGLWFEELAEFSGVTDIDVVEDTFIREDLPDGQEVTIYMSFNPPRNPYEWVNEYVDSK 217

Query: 64  ASSSDRQVIRMTINETP----HYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVE 119
            S  D  +   T  +           ++        L        GE I     ++ +  
Sbjct: 218 RSDDDYLIHHTTYLDDEKGFLSKQIIKKIEKYKKNDLDYYRWMYLGEVIGLGDNVYNMNL 277

Query: 120 EDIVINSLDIPEHWVQIGGMDFGWH-HPFAAGHLVWNRDSDVIYVVKNYRC-----REQT 173
              +          +    +D G                 +VI +   Y        ++ 
Sbjct: 278 FHPLKAIPADDRLILIDFAIDTGHQVSATTYLSFGLTAKRNVILLNTYYYSPANQVVKKA 337

Query: 174 PIFHVAALKSWGKWLPWAWPH--DGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNG 231
           P  +   L+ +   +   +    D    D   G   +  Y+  G+ + P       G   
Sbjct: 338 PSEYSKELRDFMTKVVENYNTNVDMQTVDSAEGGLRNQYYKDYGVSLHP----VAKGKK- 392

Query: 232 VEAGISDMLDRMRSGRWK 249
               I  + D +  GR+ 
Sbjct: 393 -VDMIDFVCDLLAQGRFY 409


>gi|226246703|ref|YP_002776000.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           Bol26]
 gi|226202392|gb|ACO38050.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           Bol26]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|225576048|ref|YP_002724855.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           118a]
 gi|225546646|gb|ACN92649.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           118a]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFVETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITNDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|11497124|ref|NP_051248.1| hypothetical protein BB_S45 [Borrelia burgdorferi B31]
 gi|223987739|ref|YP_002601211.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           64b]
 gi|6382145|gb|AAF07462.1|AE001576_21 conserved hypothetical protein [Borrelia burgdorferi B31]
 gi|223929452|gb|ACN24166.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           64b]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|226315871|ref|YP_002776346.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           Bol26]
 gi|226202080|gb|ACO37753.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           Bol26]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 66/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E          E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHRQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|300772208|ref|ZP_07082078.1| PBSX family phage terminase [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300760511|gb|EFK57337.1| PBSX family phage terminase [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 445

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 36/273 (13%), Positives = 76/273 (27%), Gaps = 68/273 (24%)

Query: 21  FDEEPPEDVYFEGLTRINATQ--GLVTLTLTPLKGRSPIIEHYLSASS------------ 66
            +E   ED Y + +  I        V L + P      + + Y+  +             
Sbjct: 126 MEEWQSEDDYDKLILSIRKKGIQNRVILIMNPSDDEHFVYKKYIQDTHRVEVIDGVEVQI 185

Query: 67  ---SDRQVIRMTINETPHY--------------------------------NEQERKRII 91
               +   I  +  +                                    +E+ ++   
Sbjct: 186 STHPNVLHIHTSYLDNIENVSETFLAEIAEIKRKSEKQAHQAAIAEFPEVHSEEYKRAYH 245

Query: 92  DSYPLHEREARTKGEP-ILGSGRIFPIVEEDIVINSLDIPEHWVQIGGMDFGWH-HPFAA 149
            ++   +      G    +  G IF   EE       D  E    + G D+G+   P   
Sbjct: 246 RAFQRTKYAYVVIGRWADIAEGVIFTDWEE------GDFDESLPYLYGQDYGFSIDPTTL 299

Query: 150 GHLVWNRDSDVIYVVKNYR-CREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLS 208
             +  +     +YV + +    +           ++       +P+D +  D      ++
Sbjct: 300 VKVAVDERRKRVYVQEKFYSKSQLKLQNVYNMNLAYLD-----YPNDLIIGDSAEDRLIA 354

Query: 209 AQYRRQGMKMLPECATFDDGSNGVEAGISDMLD 241
                 G+ +         G   V+AGI+D+ D
Sbjct: 355 D-LAGLGLNIEECD----KGPGSVKAGIADLQD 382


>gi|11497292|ref|NP_051420.1| hypothetical protein BB_L43 [Borrelia burgdorferi B31]
 gi|6382313|gb|AAF07626.1|AE001580_11 conserved hypothetical protein [Borrelia burgdorferi B31]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 68/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +  + T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYKFTTYDNVLLSKGFVETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|312147604|gb|ADQ30266.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           JD1]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|224983831|ref|YP_002641150.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           WI91-23]
 gi|224554243|gb|ACN55633.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           WI91-23]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 68/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +  + T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYKFTTYDNVLLSKGFVETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|11497063|ref|NP_051203.1| hypothetical protein BB_P42 [Borrelia burgdorferi B31]
 gi|6382084|gb|AAF07402.1|AE001575_3 conserved hypothetical protein [Borrelia burgdorferi B31]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 68/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +  + T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYKFTTYDNVLLSKGFVETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|219723219|ref|YP_002474654.1| phage terminase, large subunit, pbsx family protein [Borrelia
           burgdorferi 156a]
 gi|219692798|gb|ACL34012.1| phage terminase, large subunit, pbsx family protein [Borrelia
           burgdorferi 156a]
 gi|312148753|gb|ADQ31404.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           JD1]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITADYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVLENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|312126991|ref|YP_003991865.1| hypothetical protein Calhy_0759 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777010|gb|ADQ06496.1| conserved hypothetical protein [Caldicellulosiruptor hydrothermalis
           108]
          Length = 444

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/221 (12%), Positives = 66/221 (29%), Gaps = 14/221 (6%)

Query: 2   KAYEQGRDKWQSNTVHYVWFDEE--PPEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIE 59
           ++  +     +      V   E     + VY + +  +   +  V    T   G + + +
Sbjct: 133 RSTSRNGVYLRGKGADGVAITEAAFIKDKVYHDVIRAMVLDRNGVLRLETTPNGMNYVYK 192

Query: 60  HYLSASSSDR---QVIRMTINETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFP 116
            +    +      +    T+ +    + +E +RI    P          E +     IFP
Sbjct: 193 LFQEGLNDSTGYYKSFHATVYDNERLDREELERIRREIPELAWRIEYLAEFVEDDSFIFP 252

Query: 117 IVEEDIVINSL----DIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQ 172
                 V +      +         G+D   +  +    ++ +   +   +V+ +R + +
Sbjct: 253 WNLLCEVFDDYELKKEPQNGHRYSIGVDLAKYQDYTVIIVL-DITREPYQIVEYHRYQGR 311

Query: 173 TPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRR 213
                VA +             D        G+ ++ Q R 
Sbjct: 312 LYTDVVAHVNELQAKYNARVYLDA----TGVGDPIAEQVRN 348


>gi|224591489|ref|YP_002640832.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           CA-11.2a]
 gi|224554623|gb|ACN56003.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           CA-11.2a]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKIDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYTFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFAYKKLYI 397


>gi|219869985|ref|YP_002474251.1| phage terminase, large subunit, pbsx family protein [Borrelia
           burgdorferi 156a]
 gi|219692877|gb|ACL34089.1| phage terminase, large subunit, pbsx family protein [Borrelia
           burgdorferi 156a]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/252 (11%), Positives = 68/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITNDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFAFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  M      A     SN   + I+ 
Sbjct: 327 VKTVLENFNVHTLYLEDRDNTKGAGGLTREYMLLRNNMSQYFRIAPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|221641598|ref|YP_002527783.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           72a]
 gi|225622087|ref|YP_002725040.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           118a]
 gi|221237550|gb|ACM10383.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           72a]
 gi|225546885|gb|ACN92880.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           118a]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKIDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYTFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFAYKKLYI 397


>gi|317492999|ref|ZP_07951423.1| hypothetical protein HMPREF0864_02187 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919121|gb|EFV40456.1| hypothetical protein HMPREF0864_02187 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 535

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 35/279 (12%), Positives = 74/279 (26%), Gaps = 50/279 (17%)

Query: 5   EQGRDKWQSNTVHYVWFDEEPPED--VYFEGLTRINATQGL------------------V 44
           E+    +      ++ F+E   +    ++E +     +                      
Sbjct: 127 EKDYWDYHGQEFPFIGFNELTKQPNPDFYESMFSCRRSSFRPQDYPLPDGSLLPNIPLET 186

Query: 45  TLTLTPLKGRSPIIEHYLSASSSD------------------------RQVIRMTINETP 80
             T  P       ++      +                          R  I  +  E P
Sbjct: 187 FNTTNPFGIGHTWVKKRFIDPAPRGTIIRDKQMVPNPQTQQDEEITLTRVAIHGSFKENP 246

Query: 81  HYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED--IVINSLDIPEHWVQIGG 138
           + +      +++    ++R+A  +G   + SG  F  +  +   VI    IP+ W     
Sbjct: 247 YLDPVYIATLMNIKDPNKRKAWVEGSWDVTSGGRFDHLWNESLHVIKPFKIPDSWTVDRS 306

Query: 139 MDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQ 198
            D+G   PF+        D     +      +   P   +  +  W    P         
Sbjct: 307 HDWGESKPFSNLWWA-QSDGTEATLPD--GSKFCPPTGSLILIGEWYGCPPDELNKGLNM 363

Query: 199 HDKRSGEQLS-AQYRRQGMKMLPECATFDDGSNGVEAGI 236
                 + ++    R  G ++     T   G   +  GI
Sbjct: 364 SSTNVAKGVAWVDKRLMGEEVEEPEETQGKGQMHIVPGI 402


>gi|225622132|ref|YP_002725127.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           94a]
 gi|225546387|gb|ACN92395.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           94a]
          Length = 450

 Score = 60.6 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/252 (9%), Positives = 64/252 (25%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHEREAR--TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y            GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFVETQEKLYKDIPSYQARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITNDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|224591529|ref|YP_002640858.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           WI91-23]
 gi|224554111|gb|ACN55505.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           WI91-23]
          Length = 450

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/252 (11%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    V+ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALVFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITNDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVLENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|226246851|ref|YP_002776184.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           29805]
 gi|226202003|gb|ACO38584.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           29805]
          Length = 450

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
              +   +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DNMA-TFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPGNDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|312147626|gb|ADQ30287.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           JD1]
          Length = 450

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATALHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFVETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|195942876|ref|ZP_03088258.1| hypothetical protein Bbur8_08745 [Borrelia burgdorferi 80a]
 gi|312149906|gb|ADQ29970.1| phage terminase, large subunit, pbsx family [Borrelia burgdorferi
           N40]
          Length = 450

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFVETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|225576365|ref|YP_002725382.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           118a]
 gi|225546718|gb|ACN92719.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           118a]
          Length = 450

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/252 (10%), Positives = 66/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFVETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +      Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---GKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|226322171|ref|ZP_03797692.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           Bol26]
 gi|226232426|gb|EEH31184.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           Bol26]
          Length = 450

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|312201416|gb|ADQ44721.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           297]
          Length = 450

 Score = 60.2 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFVETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRNNISQYFRIVPVKPKSNKF-SRITT 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|312201145|gb|ADQ44458.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           297]
          Length = 450

 Score = 60.2 bits (144), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120
               +  +    T  +    ++   +     Y      +AR   GE I  +  I    + 
Sbjct: 213 DN-IATFKTYNFTTYDNVLLSKGFVETQEKLYKDIPSYKARVLLGEWIASTDSI--FTQI 269

Query: 121 DIVINSLDIPEHWVQIGGMDFGWHHPFAAGHLVWNRDSDVIYVVKNYRCREQTPIFHVAA 180
           +I  + +              G  +         +   D  Y       R     + +  
Sbjct: 270 NITDDYVFTSPIAYLDPAFSVGGDNTALCVMERVD---DKYYAFVFQDQRPANDPYIMNM 326

Query: 181 LKSWGK--WLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATFDDGSNGVEAGISD 238
           +K+  +   +   +  D        G        R  +            SN   + I+ 
Sbjct: 327 VKTVIENFNVHTLYLEDRDNTKGAGGLTREYILLRSNISQYFRIVPVKPKSNKF-SRITA 385

Query: 239 MLDRMRSGRWKV 250
           ++      +  +
Sbjct: 386 LITPFTYKKLYI 397


>gi|157146113|ref|YP_001453432.1| hypothetical protein CKO_01869 [Citrobacter koseri ATCC BAA-895]
 gi|157083318|gb|ABV12996.1| hypothetical protein CKO_01869 [Citrobacter koseri ATCC BAA-895]
          Length = 523

 Score = 60.2 bits (144), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 53/201 (26%), Gaps = 46/201 (22%)

Query: 1   LKAYEQGRDKWQSNTVHYVWFDEEPPE--DVYFEGLTRINATQGL--------------- 43
             +       +      ++ F+E   +    ++E +     +                  
Sbjct: 108 FGSEADDYWNFHGQEFPFIGFNELTKQPNSDFYEAMFSCRRSSFRPEDYPRKDGSLLKPI 167

Query: 44  ---VTLTLTPLKGRSPIIEHYLSASSSD------------------------RQVIRMTI 76
              V  T  P       ++      +                          R  I  + 
Sbjct: 168 PLEVFSTTNPFGIGHTWVKKRFIEPAPRGTVQRHKQLVFNPQTEREEEITLTRVAIHGSF 227

Query: 77  NETPHYNEQERKRIIDSYPLHEREARTKGEPILGSGRIFPIVEED--IVINSLDIPEHWV 134
            E P+ + Q    ++     + R+A  +G   + SG  F  +  +   VI    IP+ W 
Sbjct: 228 KENPYLDPQYIATLMSIKDPNRRKAWVEGSWDVTSGGRFDHLWSEALHVIKPFRIPDSWT 287

Query: 135 QIGGMDFGWHHPFAAGHLVWN 155
                D+G   PF+       
Sbjct: 288 VDRSHDWGESKPFSNLWWART 308


>gi|195942842|ref|ZP_03088224.1| hypothetical protein Bbur8_08565 [Borrelia burgdorferi 80a]
 gi|312150044|gb|ADQ30103.1| phage terminase, large subunit, PBSX family [Borrelia burgdorferi
           N40]
          Length = 450

 Score = 60.2 bits (144), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/252 (10%), Positives = 67/252 (26%), Gaps = 13/252 (5%)

Query: 5   EQGRDKWQSNTVHYVWFDEEP--PEDVYFEGLTRINATQGLVTLTLTPLKGRSPIIEHYL 62
               ++++ +    ++ +E     +    E L R+   Q  +     P          Y+
Sbjct: 153 ASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYI 212

Query: 63  SASSSDRQVIRMTINETPHYNEQERKRIIDSYPLHE-REAR-TKGEPILGSGRIFPIVEE 120