RPSBLAST alignment of GI: peg_1079 and protein with PDBid: 2wbn

>2wbn_A G2P, terminase large subunit; large terminase, nuclease, viral protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB: 2wc9_A Length = 212
 Score = 58.6 bits (141), Expect = 1e-09
 Identities = 20/139 (14%), Positives = 43/139 (30%), Gaps = 12/139 (8%)

Query: 109 LGSGRIF--PIVEEDIVINSLDIPEHWVQIGGMDFGW-HHPFAAGHLVWNRDSDVIYVVK 165
           LGSG +    +  E+ +I   ++        G+DFG+   P A     +++  + IY + 
Sbjct: 23  LGSGVVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAID 82

Query: 166 NYRCREQTPIFHVAALKSWGKWLPWAWPHDGLQHDKRSGEQLSAQYRRQGMKMLPECATF 225
                + +       ++                        + A     G+  +      
Sbjct: 83  ELVDHKVSLKRTADFVRKNKYESARIIADSS------EPRSIDALKLEHGINRIEGA--- 133

Query: 226 DDGSNGVEAGISDMLDRMR 244
             G + VE G   + +   
Sbjct: 134 KKGPDSVEHGERWLDELDA 152