BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.1080_1 (110 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.1080_1 Length = 110 Score = 228 bits (581), Expect = 2e-62, Method: Compositional matrix adjust. Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGE 60 MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGE Sbjct: 1 MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGE 60 Query: 61 PMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI 110 PMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI Sbjct: 61 PMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI 110 >gi|254780949|ref|YP_003065362.1| tyrosyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 418 Score = 24.3 bits (51), Expect = 0.58, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Query: 2 AGNQLGKTLAGAAEAAMHLSGCYPSW--WR 29 +G ++GKTL+GA ++ Y W WR Sbjct: 233 SGTKMGKTLSGAIWLNKEMTSPYNFWQYWR 262 >gi|254781044|ref|YP_003065457.1| succinate dehydrogenase iron-sulfur subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 259 Score = 22.7 bits (47), Expect = 1.7, Method: Compositional matrix adjust. Identities = 11/45 (24%), Positives = 17/45 (37%) Query: 10 LAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQ 54 L A + C WW R+L P +++ +RD Q Sbjct: 167 LYECVMCACCSTSCPSYWWNSDRYLGPAILLQAYRWLIDSRDEFQ 211 >gi|254781118|ref|YP_003065531.1| lysyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 502 Score = 22.3 bits (46), Expect = 2.3, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 52 GIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRS 84 GI RL++ +P + + PA +V N +R++ Sbjct: 469 GIDRLIMLLTNAPSIRDVILFPAQRVKNGSRKT 501 >gi|254780673|ref|YP_003065086.1| pyruvate dehydrogenase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 467 Score = 22.3 bits (46), Expect = 2.5, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 6/60 (10%) Query: 1 MAGNQLGKTL------AGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQ 54 M+G Q+ ++ AA A S CY +W+ L+ ++ S L + I+ Sbjct: 240 MSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIR 299 >gi|255764470|ref|YP_003064828.2| integral membrane protein TerC [Candidatus Liberibacter asiaticus str. psy62] Length = 523 Score = 21.9 bits (45), Expect = 3.2, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 49 TRDGIQRLLLGEPMSP 64 T D + RLL G+P+ P Sbjct: 252 TADAVLRLLGGKPIQP 267 >537021.9.peg.410_1 Length = 952 Score = 21.2 bits (43), Expect = 5.1, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 18/41 (43%) Query: 61 PMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGR 101 P+S + +KV ++ + ST T+RH S R Sbjct: 261 PLSFRSTADILTVVDKVFSIPENAQGLSEDSTTTIRHRSSR 301 >gi|254780414|ref|YP_003064827.1| GMP synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 520 Score = 20.8 bits (42), Expect = 6.3, Method: Composition-based stats. Identities = 7/24 (29%), Positives = 12/24 (50%) Query: 18 MHLSGCYPSWWRGYRFLQPIVMVA 41 +H +G Y W+ + L P+ V Sbjct: 430 IHKAGIYRKIWQAFTVLLPVQTVG 453 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.135 0.407 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,155 Number of Sequences: 1233 Number of extensions: 2092 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 110 length of database: 328,796 effective HSP length: 63 effective length of query: 47 effective length of database: 251,117 effective search space: 11802499 effective search space used: 11802499 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 32 (16.9 bits)