BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.1083_1 (40 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.1083_1 Length = 40 Score = 81.3 bits (199), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 40/40 (100%), Positives = 40/40 (100%) Query: 1 MKLYNFFVSLIVRQRVSQKNQIDVFKNPCDVSKKLTEVFL 40 MKLYNFFVSLIVRQRVSQKNQIDVFKNPCDVSKKLTEVFL Sbjct: 1 MKLYNFFVSLIVRQRVSQKNQIDVFKNPCDVSKKLTEVFL 40 >gi|254781087|ref|YP_003065500.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 91 Score = 24.6 bits (52), Expect = 0.35, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 10/18 (55%) Query: 23 DVFKNPCDVSKKLTEVFL 40 F+NPC S TEV + Sbjct: 51 GAFRNPCAASAHKTEVLI 68 >gi|254780760|ref|YP_003065173.1| hypothetical protein CLIBASIA_03235 [Candidatus Liberibacter asiaticus str. psy62] Length = 330 Score = 21.6 bits (44), Expect = 2.7, Method: Composition-based stats. Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 25 FKNPCDVSKKLTEVF 39 F+ PC +KKL E + Sbjct: 117 FRVPCGFTKKLIETY 131 >gi|255764507|ref|YP_003065323.2| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 222 Score = 19.6 bits (39), Expect = 9.3, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 5 NFFVSLIVRQRVSQKNQID 23 NF +S+ V RV + N++D Sbjct: 41 NFEMSISVTTRVRRPNEVD 59 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.140 0.395 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,905 Number of Sequences: 1233 Number of extensions: 490 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 40 length of database: 328,796 effective HSP length: 14 effective length of query: 26 effective length of database: 311,534 effective search space: 8099884 effective search space used: 8099884 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.3 bits) S2: 31 (16.5 bits)