BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 537021.9.peg.1087_1 (48 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|315122533|ref|YP_004063022.1| hypothetical protein CKC_03925 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495935|gb|ADR52534.1| hypothetical protein CKC_03925 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 331 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 24/25 (96%), Positives = 24/25 (96%) Query: 4 KVMVHPNRVMASNAETARNAFLIHP 28 KVMVHPNRVMASNAETARNAFLI P Sbjct: 252 KVMVHPNRVMASNAETARNAFLIDP 276 >gi|227822441|ref|YP_002826413.1| putative phage major head protein [Sinorhizobium fredii NGR234] gi|227341442|gb|ACP25660.1| putative phage major head protein [Sinorhizobium fredii NGR234] Length = 331 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 15/22 (68%), Positives = 16/22 (72%) Query: 5 VMVHPNRVMASNAETARNAFLI 26 VM+HPNRV A N ARNAF I Sbjct: 253 VMIHPNRVQAVNGGVARNAFFI 274 >gi|227821704|ref|YP_002825674.1| putative phage related protein [Sinorhizobium fredii NGR234] gi|227340703|gb|ACP24921.1| putative phage related protein [Sinorhizobium fredii NGR234] Length = 123 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 17/23 (73%) Query: 5 VMVHPNRVMASNAETARNAFLIH 27 VM+HPNRV A+ A ARNAF I Sbjct: 65 VMIHPNRVQATGATQARNAFFID 87 Searching..................................................done Results from round 2 CONVERGED! >gi|315122533|ref|YP_004063022.1| hypothetical protein CKC_03925 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495935|gb|ADR52534.1| hypothetical protein CKC_03925 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 331 Score = 55.8 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 24/25 (96%), Positives = 24/25 (96%) Query: 4 KVMVHPNRVMASNAETARNAFLIHP 28 KVMVHPNRVMASNAETARNAFLI P Sbjct: 252 KVMVHPNRVMASNAETARNAFLIDP 276 >gi|227821704|ref|YP_002825674.1| putative phage related protein [Sinorhizobium fredii NGR234] gi|227340703|gb|ACP24921.1| putative phage related protein [Sinorhizobium fredii NGR234] Length = 123 Score = 38.5 bits (88), Expect = 0.30, Method: Composition-based stats. Identities = 15/23 (65%), Positives = 17/23 (73%) Query: 5 VMVHPNRVMASNAETARNAFLIH 27 VM+HPNRV A+ A ARNAF I Sbjct: 65 VMIHPNRVQATGATQARNAFFID 87 >gi|227822441|ref|YP_002826413.1| putative phage major head protein [Sinorhizobium fredii NGR234] gi|227341442|gb|ACP25660.1| putative phage major head protein [Sinorhizobium fredii NGR234] Length = 331 Score = 38.1 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 15/23 (65%), Positives = 16/23 (69%) Query: 5 VMVHPNRVMASNAETARNAFLIH 27 VM+HPNRV A N ARNAF I Sbjct: 253 VMIHPNRVQAVNGGVARNAFFID 275 >gi|327489361|gb|EGF21154.1| cell wall surface anchor family protein [Streptococcus sanguinis SK1058] Length = 2843 Score = 33.9 bits (76), Expect = 7.0, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 10 NRVMASNAETARNAFLIHPKWILLSPNNVMAPLN 43 NRV+ N E A N+ + P WI S +N+ P N Sbjct: 287 NRVIVRNIEGADNSTYLDPNWIRYSTDNLSVPGN 320 >gi|327461506|gb|EGF07837.1| cell wall surface anchor family protein [Streptococcus sanguinis SK1] Length = 2807 Score = 33.9 bits (76), Expect = 7.0, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 10 NRVMASNAETARNAFLIHPKWILLSPNNVMAPLN 43 NRV+ N E A N+ + P WI S +N+ P N Sbjct: 287 NRVIVRNIEGADNSTYLDPNWIRYSTDNLSVPGN 320 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.322 0.137 0.431 Lambda K H 0.267 0.0442 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 907,998,397 Number of Sequences: 13984884 Number of extensions: 22881800 Number of successful extensions: 56670 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 56660 Number of HSP's gapped (non-prelim): 10 length of query: 48 length of database: 4,792,584,752 effective HSP length: 21 effective length of query: 27 effective length of database: 4,498,902,188 effective search space: 121470359076 effective search space used: 121470359076 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 76 (33.8 bits)