RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.109_1 (66 letters) >gnl|CDD|150299 pfam09586, YfhO, Bacterial membrane protein YfhO. This protein is a conserved membrane protein. The yfhO gene is transcribed in Difco sporulation medium and the transcription is affected by the YvrGHb two-component system. Some members of this family have been annotated as glycosyl transferases of the PMT family. Length = 835 Score = 30.7 bits (70), Expect = 0.091 Identities = 15/40 (37%), Positives = 20/40 (50%) Query: 5 FCQRIFSITLSHFAQWFLQFSVSLLLSADISASVLFPVYW 44 F R+ + + FL+F +S LLS ISA VL P Sbjct: 197 FLYRLIFKDIKSRWKQFLRFIISSLLSGGISAVVLLPTVL 236 >gnl|CDD|185101 PRK15179, PRK15179, Vi polysaccharide biosynthesis protein TviE; Provisional. Length = 694 Score = 24.2 bits (52), Expect = 8.7 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Query: 7 QRIFSITLS-HFAQWFLQFSVSLLLS 31 +RI LS W QF+ LLLS Sbjct: 574 ERILFTGLSRRVGYWLTQFNAFLLLS 599 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.339 0.147 0.479 Gapped Lambda K H 0.267 0.0639 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,053,540 Number of extensions: 48529 Number of successful extensions: 182 Number of sequences better than 10.0: 1 Number of HSP's gapped: 182 Number of HSP's successfully gapped: 10 Length of query: 66 Length of database: 5,994,473 Length adjustment: 37 Effective length of query: 29 Effective length of database: 5,194,977 Effective search space: 150654333 Effective search space used: 150654333 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 50 (23.2 bits)