BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.1107_1 (40 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.1107_1 Length = 40 Score = 81.3 bits (199), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 40/40 (100%), Positives = 40/40 (100%) Query: 1 MAYDEIEDLFFFREKRQYFFVFNDTNQMNIESFLWILFMR 40 MAYDEIEDLFFFREKRQYFFVFNDTNQMNIESFLWILFMR Sbjct: 1 MAYDEIEDLFFFREKRQYFFVFNDTNQMNIESFLWILFMR 40 >gi|254780166|ref|YP_003064579.1| hydrolase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Score = 21.9 bits (45), Expect = 2.0, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 6 IEDLFFFREKRQYFFVFNDTNQMNIESFLWI 36 + ++ FFR R+Y F F D + + L I Sbjct: 2 MNEVKFFRSWRKYQFAFYDVGDKDAPTILLI 32 >gi|254780134|ref|YP_003064547.1| phage-related integrase/recombinase [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 21.9 bits (45), Expect = 2.2, Method: Composition-based stats. Identities = 8/21 (38%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Query: 16 RQYFFVFNDTNQMNIESF-LW 35 ++ FF+ ND +MN F +W Sbjct: 252 KETFFINNDKQKMNATQFSIW 272 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.339 0.148 0.472 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,957 Number of Sequences: 1233 Number of extensions: 579 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 40 length of database: 328,796 effective HSP length: 14 effective length of query: 26 effective length of database: 311,534 effective search space: 8099884 effective search space used: 8099884 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 31 (16.5 bits)