BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.1140_1 (90 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.1140_1 Length = 90 Score = 185 bits (470), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 90/90 (100%), Positives = 90/90 (100%) Query: 1 MTKRQEDHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWL 60 MTKRQEDHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWL Sbjct: 1 MTKRQEDHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWL 60 Query: 61 FSALKNIAIAVTSLTAIIYGLLNIKGWFKQ 90 FSALKNIAIAVTSLTAIIYGLLNIKGWFKQ Sbjct: 61 FSALKNIAIAVTSLTAIIYGLLNIKGWFKQ 90 >gi|254781134|ref|YP_003065547.1| hypothetical protein CLIBASIA_05180 [Candidatus Liberibacter asiaticus str. psy62] Length = 320 Score = 22.3 bits (46), Expect = 1.6, Method: Composition-based stats. Identities = 7/27 (25%), Positives = 17/27 (62%) Query: 3 KRQEDHYITREEFIEFCTNSNSKQDCL 29 K ++ ++T+++ +FC N + +CL Sbjct: 268 KWTDNLFVTKKKLFQFCQNVVAYGNCL 294 >gi|254780812|ref|YP_003065225.1| uroporphyrinogen decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 346 Score = 21.9 bits (45), Expect = 1.9, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 13/17 (76%) Query: 46 GVNEILDILKSVKWLFS 62 GVN ILD+L S ++F+ Sbjct: 304 GVNAILDVLGSGPFIFN 320 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 21.6 bits (44), Expect = 2.4, Method: Compositional matrix adjust. Identities = 11/37 (29%), Positives = 21/37 (56%) Query: 37 EKHYREQQKGVNEILDILKSVKWLFSALKNIAIAVTS 73 E++YRE+ K ++ I + +K + ALK ++ S Sbjct: 32 ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68 >537021.9.peg.410_1 Length = 952 Score = 21.2 bits (43), Expect = 3.2, Method: Compositional matrix adjust. Identities = 9/25 (36%), Positives = 17/25 (68%) Query: 42 EQQKGVNEILDILKSVKWLFSALKN 66 E+++ + +++D K K LFS +KN Sbjct: 725 EREETIKQLMDEQKIPKKLFSPIKN 749 >gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Score = 20.0 bits (40), Expect = 7.7, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 55 KSVKWLFSALKNIAIAVTSLTAIIYGLLNIKGW 87 +++ W+ L+ + AV +T Y L N+ W Sbjct: 190 ETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNW 222 >gi|254780933|ref|YP_003065346.1| valyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 947 Score = 19.6 bits (39), Expect = 9.7, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 15/29 (51%) Query: 30 ISQFKLFEKHYREQQKGVNEILDILKSVK 58 I F F K +K + ++LD L S+K Sbjct: 875 IGDFVDFVKERSRLKKSLEKVLDELSSIK 903 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.136 0.400 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,432 Number of Sequences: 1233 Number of extensions: 1645 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 90 length of database: 328,796 effective HSP length: 58 effective length of query: 32 effective length of database: 257,282 effective search space: 8233024 effective search space used: 8233024 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)