Query         537021.9.peg.1142_1
Match_columns 218
No_of_seqs    32 out of 34
Neff          3.8 
Searched_HMMs 13730
Date          Wed May 25 08:40:15 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_1142.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d3c7ba2 d.58.36.2 (A:1-166) Di  16.1      29  0.0021   13.1   1.5   13  127-139    12-24  (166)
  2 d2abka_ a.96.1.1 (A:) Endonucl  14.2      33  0.0024   12.8   4.3   11   82-92     96-106 (211)
  3 d2v7fa1 a.4.5.84 (A:2-150) Rib  13.7      32  0.0023   12.9   1.2   10  112-121    76-85  (149)
  4 d1keaa_ a.96.1.2 (A:) Thymine-  11.0      41   0.003   12.2   3.9   26  162-191   168-193 (217)
  5 d1fs1b1 a.157.1.1 (B:86-140) C  10.5      43  0.0032   12.1   2.3   29   64-92     20-48  (55)
  6 d2es9a1 a.247.1.1 (A:11-107) H   9.2      36  0.0027   12.5   0.3   23  189-211    52-74  (97)
  7 d2diga1 b.34.9.1 (A:8-62) Lami   8.8      15  0.0011   14.7  -1.9   12  165-176    12-23  (55)
  8 d1nexa1 a.157.1.1 (A:116-185)    6.6      64  0.0047   11.2   2.8   31   62-92     19-49  (70)
  9 d1gr0a1 c.2.1.3 (A:14-200,A:31   6.5      61  0.0044   11.3   0.4   26   91-117   160-186 (243)
 10 d1qled_ f.23.8.1 (D:) Bacteria   5.0      30  0.0022   13.0  -1.9   16    3-18      2-17  (43)

No 1  
>d3c7ba2 d.58.36.2 (A:1-166) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
Probab=16.11  E-value=29  Score=13.10  Aligned_cols=13  Identities=31%  Similarity=0.757  Sum_probs=5.9

Q ss_pred             CHHHHHHHHHHHH
Q ss_conf             5246768999987
Q 537021.9.peg.1  127 GPWSSQAGKLAIA  139 (218)
Q Consensus       127 GP~~s~~~~L~~~  139 (218)
                      |||+|.+.++-+.
T Consensus        12 GPWPSfV~~~K~~   24 (166)
T d3c7ba2          12 GPWPSFVKEIKKT   24 (166)
T ss_dssp             SSSCCHHHHHHHH
T ss_pred             CCCCHHHHHHHHH
T ss_conf             9983588999998


No 2  
>d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]}
Probab=14.16  E-value=33  Score=12.79  Aligned_cols=11  Identities=27%  Similarity=0.534  Sum_probs=5.6

Q ss_pred             HHHHHCCCCCC
Q ss_conf             99985489877
Q 537021.9.peg.1   82 LVPLISGKEPQ   92 (218)
Q Consensus        82 lk~LL~GkdP~   92 (218)
                      +.+--+|+-|.
T Consensus        96 i~~~~~g~~p~  106 (211)
T d2abka_          96 LLEQHNGEVPE  106 (211)
T ss_dssp             HHHHTTTSCCS
T ss_pred             HHHHHCCCHHH
T ss_conf             99871486047


No 3  
>d2v7fa1 a.4.5.84 (A:2-150) Ribosomal protein S19e {Pyrococcus abyssi [TaxId: 29292]}
Probab=13.67  E-value=32  Score=12.87  Aligned_cols=10  Identities=10%  Similarity=0.006  Sum_probs=5.1

Q ss_pred             HHCCCCCCCC
Q ss_conf             3020000234
Q 537021.9.peg.1  112 YERFSPFNSS  121 (218)
Q Consensus       112 fgD~t~ygSs  121 (218)
                      ||+-.+.|+.
T Consensus        76 YGg~k~rG~~   85 (149)
T d2v7fa1          76 YGGRKNRGHA   85 (149)
T ss_dssp             HCC----CCC
T ss_pred             HCCCCCCCCC
T ss_conf             7889889999


No 4  
>d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Methanobacterium thermoformicicum [TaxId: 145262]}
Probab=10.97  E-value=41  Score=12.23  Aligned_cols=26  Identities=27%  Similarity=0.119  Sum_probs=12.6

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999862186144899999999999999999
Q 537021.9.peg.1  162 KELVNTFVPFQNLWYARGAFNHFVRNSIDD  191 (218)
Q Consensus       162 ~k~v~~~~P~~NLWYtK~a~d~li~~qlqe  191 (218)
                      .+.+...+|-...-    -|+..+.+-=++
T Consensus       168 ~~~~~~~~p~~~~~----~~~~~l~~~G~~  193 (217)
T d1keaa_         168 WELAETLVPGGKCR----DFNLGLMDFSAI  193 (217)
T ss_dssp             HHHHHHHSCTTCHH----HHHHHHHHHHHH
T ss_pred             HHHHHHCCCCCCHH----HHHHHHHHHHHH
T ss_conf             99998708815599----999999999798


No 5  
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=10.46  E-value=43  Score=12.12  Aligned_cols=29  Identities=24%  Similarity=0.158  Sum_probs=23.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99999999999989999999985489877
Q 537021.9.peg.1   64 RAKALVIGILGEELIRKTLVPLISGKEPQ   92 (218)
Q Consensus        64 ~aaaL~at~tl~Gal~~qlk~LL~GkdP~   92 (218)
                      .||.++---.|+......+-++++||.|+
T Consensus        20 ~AAnyL~I~~Lldl~c~~vA~~ikgKt~e   48 (55)
T d1fs1b1          20 LAANYLDIKGLLDVTCKTVANMIKGKTPE   48 (55)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHHTTCCHH
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHHCCCCHH
T ss_conf             99988194789999999999988699999


No 6  
>d2es9a1 a.247.1.1 (A:11-107) Hypothetical protein YoaC {Salmonella typhimurium [TaxId: 90371]}
Probab=9.20  E-value=36  Score=12.54  Aligned_cols=23  Identities=9%  Similarity=0.063  Sum_probs=14.1

Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             99972841468999999999999
Q 537021.9.peg.1  189 IDDVLNPGGRARAEVYRQRQKYK  211 (218)
Q Consensus       189 lqe~~~Pg~~~r~e~~~~R~~~k  211 (218)
                      -||--||||.+++-..+++.++-
T Consensus        52 ~qegWn~gFT~K~~gWA~k~~sG   74 (97)
T d2es9a1          52 EQEGWNPEFTKKVAGWAEKVASG   74 (97)
T ss_dssp             HHTTCCHHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             22158813889999899986157


No 7  
>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]}
Probab=8.81  E-value=15  Score=14.72  Aligned_cols=12  Identities=33%  Similarity=0.451  Sum_probs=6.5

Q ss_pred             HHHCCCCHHHHH
Q ss_conf             862186144899
Q 537021.9.peg.1  165 VNTFVPFQNLWY  176 (218)
Q Consensus       165 v~~~~P~~NLWY  176 (218)
                      |-+--|++||||
T Consensus        12 vm~RwPgSsLyy   23 (55)
T d2diga1          12 VRGRWPGSSLYY   23 (55)
T ss_dssp             EEEECTTTCCEE
T ss_pred             EEEECCCCCEEE
T ss_conf             773069983589


No 8  
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=6.65  E-value=64  Score=11.19  Aligned_cols=31  Identities=16%  Similarity=0.105  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9999999999999989999999985489877
Q 537021.9.peg.1   62 VYRAKALVIGILGEELIRKTLVPLISGKEPQ   92 (218)
Q Consensus        62 ~~~aaaL~at~tl~Gal~~qlk~LL~GkdP~   92 (218)
                      .-.||.++---.|+......+-++++||.|+
T Consensus        19 li~AAnyL~I~~Ll~l~c~~vA~~ikgkt~e   49 (70)
T d1nexa1          19 IILAANYLNIKPLLDAGCKVVAEMIRGRSPE   49 (70)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHHTTCCHH
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHHCCCCHH
T ss_conf             9999987095789999999999998259999


No 9  
>d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=6.46  E-value=61  Score=11.30  Aligned_cols=26  Identities=19%  Similarity=0.165  Sum_probs=15.7

Q ss_pred             CCCCCCCHHHHHHHHH-HHHHHHHCCCC
Q ss_conf             7778652358999985-22334302000
Q 537021.9.peg.1   91 PQLDFSDPTEYIKALI-NGITHYERFSP  117 (218)
Q Consensus        91 P~~d~tdp~fw~~a~l-~Ggg~fgD~t~  117 (218)
                      |-.--+|| .|.+-|. .|..++||-.+
T Consensus       160 P~fIAsdp-~w~~kF~e~glpivGDDik  186 (243)
T d1gr0a1         160 PVFIASDP-VWAKKFTDARVPIVGDDIK  186 (243)
T ss_dssp             SCCSTTSH-HHHHHHHHHTCEEEESSBC
T ss_pred             CCCCCCCH-HHHHHHHHCCCCEECCCCC
T ss_conf             40004898-9999999869967725334


No 10 
>d1qled_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Paracoccus denitrificans [TaxId: 266]}
Probab=5.05  E-value=30  Score=13.01  Aligned_cols=16  Identities=19%  Similarity=0.414  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHCCCC
Q ss_conf             3476786542201321
Q 537021.9.peg.1    3 EHARGSVGSTIQDKRW   18 (218)
Q Consensus         3 ~~~~~~~~~~~~~~~~   18 (218)
                      ||--|+|..+.|++|+
T Consensus         2 eHkHG~MDi~vQEkTF   17 (43)
T d1qled_           2 DHKHGEMDIRHQQATF   17 (43)
T ss_dssp             CCCTTCSCCHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHH
T ss_conf             8866865338889999


Done!