BLAST/PSIBLAST alignment of GI: peg_1142 and GI: 291334971 at iteration 1
>gi|291334971|gb|ADD94604.1| hypothetical protein [uncultured phage MedDCM-OCT-S08-C233] Length = 530
 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 94/210 (44%), Gaps = 40/210 (19%)

Query: 31  RLMGQFLVMPISWS------RMHLIEIPSSLVGVSSQVYRAK---------ALVI--GIL 73
           R +GQF   P+S         M  I     L G+S++  RA+         ALVI  G +
Sbjct: 321 RFVGQFKAFPMSIMNKVLGREMAYIRKGKKLGGLSTEAGRAEIGRGIRGMAALVITSGFM 380

Query: 74  GEELIRKTLVPLISGKEPQLDFSDPTEYIKAL----------INGITHYERFSPFNSSGW 123
           G   +  T+  L+ GKEP+    DPT++   +          I G   ++      S   
Sbjct: 381 G--YMAMTMKDLLKGKEPR----DPTKFKTIMAGFLQGGGLGIYGDVLFKEQRDAGSVIA 434

Query: 124 DVLGPWSSQAGKLAIAGKEAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNLWYARGAFNH 183
            ++GP  +    L +A + A+  EG +  +   +A      +++ +PF NL+Y + AF++
Sbjct: 435 GLVGPAPTTVVDLGLALQYALLGEGGKSGKAAYRA------ISSNIPFLNLFYIKIAFDY 488

Query: 184 FVRNSIDDVLNPGGRARAEVYRQRQKYKKQ 213
            +   I + +NPG   + E  R ++ Y ++
Sbjct: 489 LIGFQIMETVNPGVLKKVE-RRMKKDYNQE 517