BLAST/PSIBLAST alignment of GI: peg_1142 and GI: 315121926 at iteration 1
>gi|315121926|ref|YP_004062415.1| hypothetical protein CKC_00880 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 810
>gi|315122888|ref|YP_004063377.1| hypothetical protein CKC_05720 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 810
>gi|313495328|gb|ADR51927.1| hypothetical protein CKC_00880 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 810
>gi|313496290|gb|ADR52889.1| hypothetical protein CKC_05720 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 810
 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/217 (30%), Positives = 115/217 (52%), Gaps = 11/217 (5%)

Query: 1   VQEHARGSVGSTIQDKRWITGKDGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLV---- 56
            Q++ARGSVGS+++D ++ + + G +  L+ L+ QFL  PIS +  HL  +P +LV    
Sbjct: 591 TQDNARGSVGSSLRDTKYTSSR-GGIPGLS-LVTQFLTTPISMAEKHLWAVPKTLVGGAN 648

Query: 57  GVSSQVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYER-F 115
           G+S+  YRAK L  GI+ E ++  T    ++G+E   DF+DP          +THY+R F
Sbjct: 649 GMSAWSYRAKFLAFGIVLEGIVANTARKALTGQELD-DFTDPKVLALMTARTLTHYDRFF 707

Query: 116 SPFNSSGWDVLG--PWSSQAGKLAIAGKEAVWD-EGTRKQRGKAQAQFGKELVNTFVPFQ 172
           + ++    D+L   P +S    L  AG E   +  G  +++         + V   +P +
Sbjct: 708 NEYHHDFKDLLHSVPVASTVIGLGDAGLEVSRNIFGEDEEKKAKANAKLAKEVANNMPLK 767

Query: 173 NLWYARGAFNHFVRNSIDDVLNPGGRARAEVYRQRQK 209
           NL+Y + AF   V +++ +  N G + R  + R+ +K
Sbjct: 768 NLFYVKAAFQKMVVDNLCEYFNEGYKDRLAMNRELRK 804