RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.1142_1 (218 letters) >gnl|CDD|36707 KOG1494, KOG1494, KOG1494, NAD-dependent malate dehydrogenase [Energy production and conversion]. Length = 345 Score = 30.6 bits (69), Expect = 0.37 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 15/71 (21%) Query: 52 PSSLVGVSS-QVYRAKALVIGILGEELIRK------------TLVPLISGKEPQLDFSDP 98 P L GV++ V RA V +L + T++PL+S +P F+D Sbjct: 167 PKKLFGVTTLDVVRANTFVAEVLNLDPAEDVDVPVIGGHAGITIIPLLSQCKPPFRFTD- 225 Query: 99 TEYIKALINGI 109 + I+AL + I Sbjct: 226 -DEIEALTHRI 235 >gnl|CDD|35432 KOG0211, KOG0211, KOG0211, Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms]. Length = 759 Score = 29.2 bits (65), Expect = 0.93 Identities = 22/103 (21%), Positives = 37/103 (35%), Gaps = 19/103 (18%) Query: 23 DGSVNNLARLMGQFLVMPISWSRMHLIEIPSSLVGVSSQVYR-------AKALVIGILGE 75 + + NL L+ F W+R L EIP L Y + + +LG+ Sbjct: 536 EAAARNLPALVETF---GSEWAR--LEEIPKLLAMDLQDNYLVRMTTLFSIHELAEVLGQ 590 Query: 76 ELIRKTLVPLISGKEPQLDFSDPTEYIKALINGITHYERFSPF 118 E+ + L+P+ DP ++ IN H + Sbjct: 591 EITCEDLLPVFLDLV-----KDPVANVR--INVAKHLPKILKL 626 >gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like. NADP+-dependent, p-hydroxybenzaldehyde dehydrogenase (PchA, HBenzADH) which catalyzes oxidation of p-hydroxybenzaldehyde to p-hydroxybenzoic acid and other related sequences are included in this CD. Length = 465 Score = 27.3 bits (61), Expect = 3.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 44 SRMHLIEIPSSLVGVSSQVYRAKALVIGILG 74 RM +PS + G ++VYR V+G++ Sbjct: 108 LRMEGRILPSDVPGKENRVYREPLGVVGVIS 138 >gnl|CDD|146667 pfam04147, Nop14, Nop14-like family. Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production. Length = 809 Score = 26.5 bits (59), Expect = 5.2 Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 6/33 (18%) Query: 189 IDDVLNPGG------RARAEVYRQRQKYKKQRK 215 ++ NP R RAE+ + + + KK+RK Sbjct: 731 FEENFNPDKKSYDPDRERAELNKLKAQLKKERK 763 >gnl|CDD|37454 KOG2243, KOG2243, KOG2243, Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms]. Length = 5019 Score = 26.2 bits (57), Expect = 6.5 Identities = 11/47 (23%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 142 EAVWDEGTRKQRGKAQAQFGKELVNTFVPFQNL-WYARGAFNHFVRN 187 E +WDEG +K++ + + F+ + Y + ++F RN Sbjct: 4504 EYLWDEGKKKKKQLCGHKVEEPEAFEAAFFKGIEAYQQKLLHYFARN 4550 >gnl|CDD|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others. Length = 310 Score = 25.9 bits (58), Expect = 8.5 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Query: 80 KTLVPLISGKEPQLDFSDPTEYIKALINGI 109 T++PL+S +P F E I+AL + I Sbjct: 179 VTILPLLSQCQPPFTFDQ--EEIEALTHRI 206 >gnl|CDD|38903 KOG3699, KOG3699, KOG3699, Cytoskeletal protein Adducin [Signal transduction mechanisms, Cytoskeleton]. Length = 598 Score = 25.9 bits (56), Expect = 9.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Query: 183 HFVRNSIDDVLNPGGRARAEVYRQRQKYKKQRKR 216 +F R S DD R RA RQ +QRKR Sbjct: 14 YFDRFSEDDPEYMRLRNRAADLRQDFNLMEQRKR 47 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.135 0.408 Gapped Lambda K H 0.267 0.0730 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,742,702 Number of extensions: 140511 Number of successful extensions: 280 Number of sequences better than 10.0: 1 Number of HSP's gapped: 280 Number of HSP's successfully gapped: 9 Length of query: 218 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 128 Effective length of database: 4,318,927 Effective search space: 552822656 Effective search space used: 552822656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.0 bits)