RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= 537021.9.peg.1142_1
         (218 letters)



>3ku3_A Hemagglutinin HA1 chain; viral envelope protein, viral
           fusion protein, envelope protein; HET: NAG; 1.60A
           {Influenza a virus} PDB: 3ku6_A* 3ku5_A* 1jsm_A* 1jsn_A*
           1jso_A* (A:90-262)
          Length = 173

 Score = 26.4 bits (58), Expect = 2.9
 Identities = 8/30 (26%), Positives = 15/30 (50%), Gaps = 1/30 (3%)

Query: 94  DFSDPTEYIKALINGITHYERFSPFNSSGW 123
            F+D  E +K L++ + H+E+        W
Sbjct: 7   SFNDYEE-LKHLLSSVKHFEKVKILPKDRW 35


>1rvx_A Hemagglutinin; viral protein; HET: SIA GAL NAG; 2.20A
           {Influenza a virus} (A:92-265)
          Length = 174

 Score = 26.0 bits (57), Expect = 3.8
 Identities = 8/30 (26%), Positives = 15/30 (50%), Gaps = 1/30 (3%)

Query: 94  DFSDPTEYIKALINGITHYERFSPFNSSGW 123
           DF D  E ++  ++ ++ +ERF  F     
Sbjct: 7   DFIDYEE-LREQLSSVSSFERFEIFPKESS 35


>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction,
           proto-oncogene, complex, ATP-binding, glycoprotein,
           kinase, membrane, nucleotide-binding; HET: PTR; 1.35A
           {Homo sapiens} (B:1-154)
          Length = 154

 Score = 25.9 bits (57), Expect = 4.9
 Identities = 7/24 (29%), Positives = 14/24 (58%)

Query: 130 SSQAGKLAIAGKEAVWDEGTRKQR 153
           + Q   L   GKE +++E ++ +R
Sbjct: 104 TKQTISLFKEGKERMYEENSQPRR 127


>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A
           {Thermosphaera aggregans} (A:)
          Length = 481

 Score = 25.9 bits (55), Expect = 4.9
 Identities = 13/113 (11%), Positives = 32/113 (28%), Gaps = 8/113 (7%)

Query: 29  LARLMGQFLVMPISWSRMHLIEIPSSLVGVSSQVYRAKALVIGILGEELIRKTLVPLISG 88
             +L    + + + WSR+      +  V V          ++ +  ++   + L  L + 
Sbjct: 69  AEKLGVNTIRVGVEWSRIFPKPTFNVKVPVERDEN---GSIVHVDVDDKAVERLDELANK 125

Query: 89  KEPQLDFSDPTEYIKALI-NGITHYERFSPFNSSGWDVLGPWSSQAGKLAIAG 140
           +   ++     E  K  +  G         +    W        + G      
Sbjct: 126 EA--VNHYV--EMYKDWVERGRKLILNLYHWPLPLWLHNPIMVRRMGPDRAPS 174


>1fbv_A Signal transduction protein CBL; CBL, ZAP-70,
           phosphorylation, tyrosine kinase, ubiquitination,
           protein degradation,, ligase; HET: PTR; 2.90A {Homo
           sapiens} (A:1-130)
          Length = 130

 Score = 25.5 bits (56), Expect = 5.6
 Identities = 7/24 (29%), Positives = 14/24 (58%)

Query: 130 SSQAGKLAIAGKEAVWDEGTRKQR 153
           + Q   L   GKE +++E ++ +R
Sbjct: 80  TKQTISLFKEGKERMYEENSQPRR 103


>2ibx_A Hemagglutinin, fragment; haemagglutinin, H5N1, viral
           protein; HET: NAG; 2.80A {Influenza a virus} (A:104-276)
          Length = 173

 Score = 25.2 bits (55), Expect = 7.4
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 94  DFSDPTEYIKALINGITHYERFSPFNSSGWDV 125
           DF+D  E +K L++ I H+E+      S W  
Sbjct: 7   DFNDYEE-LKHLLSRINHFEKIQIIPKSSWSS 37


>3dwl_A Actin-related protein 3; propellor, actin-binding,
           ATP-binding, cytoplasm, cytoskeleton,
           nucleotide-binding; HET: ATP; 3.78A {Schizosaccharomyces
           pombe} (A:248-295)
          Length = 48

 Score = 25.0 bits (55), Expect = 7.8
 Identities = 8/28 (28%), Positives = 11/28 (39%), Gaps = 8/28 (28%)

Query: 96  SDPTEYIKALINGITH--------YERF 115
            +P  Y+K     IT         +ERF
Sbjct: 13  REPDRYLKYASESITGHSTTIDVGFERF 40


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0610    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 1,716,042
Number of extensions: 75256
Number of successful extensions: 169
Number of sequences better than 10.0: 1
Number of HSP's gapped: 169
Number of HSP's successfully gapped: 9
Length of query: 218
Length of database: 4,956,049
Length adjustment: 85
Effective length of query: 133
Effective length of database: 2,082,624
Effective search space: 276988992
Effective search space used: 276988992
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (24.5 bits)