Query         537021.9.peg.116_1
Match_columns 39
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 39220
Date          Mon May 23 20:30:52 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_116.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR02733 desat_CrtD C-3',4' d  21.9      36 0.00092   17.4   0.8   26    7-32    305-334 (499)
  2 TIGR01090 apt adenine phosphor  21.2      21 0.00053   18.5  -0.6   15   14-28     81-95  (175)
  3 TIGR01648 hnRNP-R-Q hnRNP-R, Q  16.6      36 0.00091   17.4  -0.2   10   15-24     67-76  (611)
  4 TIGR00313 cobQ cobyric acid sy  14.9      57  0.0015   16.5   0.5   21   16-36    442-463 (502)
  5 TIGR01548 HAD-SF-IA-hyp1 HAD s  12.6      67  0.0017   16.2   0.3   16   24-39     15-30  (245)
  6 KOG1279 consensus               11.4      90  0.0023   15.6   0.6   15   22-36     83-97  (506)
  7 TIGR00115 tig trigger factor;   10.6      88  0.0023   15.6   0.4   15   14-28     48-62  (475)
  8 pfam10909 DUF2682 Protein of u  10.3      85  0.0022   15.7   0.2   20   19-38     48-67  (77)
  9 COG3143 CheZ Chemotaxis protei   7.5 1.7E+02  0.0043   14.3   0.8   21   11-32     20-40  (217)
 10 TIGR02662 dinitro_DRAG ADP-rib   6.0 1.4E+02  0.0035   14.7  -0.3   13   25-37    231-243 (295)

No 1  
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104   Members of this family are encoded by slr1293, a carotenoid biosynthesis protein which was shown to be the C-3',4' desaturase (CrtD) of myxoxanthophyll biosynthesis in Synechocystis sp. (strain PCC 6803), and close homologues (presumed to be functionally equivalent) from other cyanobacteria, where myxoxanthophyll biosynthesis is either known or expected. This enzyme can act on neurosporene and so presumably catalyses the first step that is committed to myxoxanthophyll..
Probab=21.93  E-value=36  Score=17.40  Aligned_cols=26  Identities=27%  Similarity=0.557  Sum_probs=19.5

Q ss_pred             ECCCHHHHHHHCCHH----HHHHHHHHHHH
Q ss_conf             001377785203244----53212332121
Q 537021.9.peg.1    7 EAYNYKKRIGKLPRT----MFYNSYRNCII   32 (39)
Q Consensus         7 eaynykkrigklprt----mfynsyrncii   32 (39)
                      -..+|++||-|||..    .||-.-|.+-|
T Consensus       305 ~~~~Yr~Rl~~LP~pSGA~V~Y~gvk~~al  334 (499)
T TIGR02733       305 LPPGYRKRLKKLPEPSGAFVLYLGVKRAAL  334 (499)
T ss_pred             CCHHHHHHHHHCCCCCCEEEEEECCCHHHC
T ss_conf             661479999727788972886000133337


No 2  
>TIGR01090 apt adenine phosphoribosyltransferase; InterPro: IPR005764    Adenine phosphoribosyltransferase (APRTase, 2.4.2.7 from EC) is a widely distributed enzyme, and its deficiency in humans causes the accumulation of 2,8-dihydroxyadenine. It is the sole catalyst for adenine recycling in most eukaryotes.  AMP + diphosphate = adenine + 5-phospho-alpha-D-ribose 1-diphosphate  ; GO: 0003999 adenine phosphoribosyltransferase activity, 0006168 adenine salvage.
Probab=21.24  E-value=21  Score=18.51  Aligned_cols=15  Identities=40%  Similarity=0.609  Sum_probs=12.4

Q ss_pred             HHHHCCHHHHHHHHH
Q ss_conf             852032445321233
Q 537021.9.peg.1   14 RIGKLPRTMFYNSYR   28 (39)
Q Consensus        14 rigklprtmfynsyr   28 (39)
                      .-||||+..+..||.
T Consensus        81 K~GKLP~~t~~~~Y~   95 (175)
T TIGR01090        81 KPGKLPGETVSASYD   95 (175)
T ss_pred             CCCCCCCCEEEEEEC
T ss_conf             787668422667403


No 3  
>TIGR01648 hnRNP-R-Q hnRNP-R, Q splicing factor family; InterPro: IPR006535   Sequences in this subfamily include the human heterogeneous nuclear ribonucleoproteins (hnRNP) R , Q  and APOBEC-1 complementation factor (aka APOBEC-1 stimulating protein) . These proteins contain three RNA recognition domains and a somewhat variable C-terminal domain. .
Probab=16.61  E-value=36  Score=17.43  Aligned_cols=10  Identities=40%  Similarity=1.105  Sum_probs=5.9

Q ss_pred             HHHCCHHHHH
Q ss_conf             5203244532
Q 537021.9.peg.1   15 IGKLPRTMFY   24 (39)
Q Consensus        15 igklprtmfy   24 (39)
                      |||+||.+|-
T Consensus        67 vGKiPRDlyE   76 (611)
T TIGR01648        67 VGKIPRDLYE   76 (611)
T ss_pred             ECCCCCCCCC
T ss_conf             7576765200


No 4  
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin. NH(2) groups are provided by glutamine, and one molecule of ATP is hydrogenolysed for each amidation .; GO: 0003824 catalytic activity, 0009236 cobalamin biosynthetic process.
Probab=14.93  E-value=57  Score=16.48  Aligned_cols=21  Identities=24%  Similarity=0.540  Sum_probs=14.5

Q ss_pred             HHCCHHHHHH-HHHHHHHHHHE
Q ss_conf             2032445321-23321212101
Q 537021.9.peg.1   16 GKLPRTMFYN-SYRNCIINTIN   36 (39)
Q Consensus        16 gklprtmfyn-syrnciintin   36 (39)
                      |---.-+|.| .+|+|++|.+-
T Consensus       442 GtYlHGlF~N~~fRry~~N~LR  463 (502)
T TIGR00313       442 GTYLHGLFENYEFRRYFLNLLR  463 (502)
T ss_pred             ECHHCCCHHHHHHHHHHHHHHC
T ss_conf             2100330011236667763100


No 5  
>TIGR01548 HAD-SF-IA-hyp1 HAD superfamily (subfamily IA) hydrolase, TIGR01548; InterPro: IPR006438   This entry represents a small and phylogenetically curious clade of sequences. Sequences are found from Halobacterium (an archaeon), Nostoc and Synechococcus (cyanobacteria) and Phytophthora (a stramenophile eukaryote). These appear to be members of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases by general homology and the conservation of all of the recognized catalytic motifs. The variable domain is found in between motifs 1 and 2, indicating membership in subfamily I and phylogeny and prediction of the alpha helical nature of the variable domain (by PSI-PRED) indicating membership in subfamily IA..
Probab=12.57  E-value=67  Score=16.17  Aligned_cols=16  Identities=38%  Similarity=0.683  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHEECC
Q ss_conf             2123321212101029
Q 537021.9.peg.1   24 YNSYRNCIINTINVFY   39 (39)
Q Consensus        24 ynsyrnciintinvfy   39 (39)
                      -.|||..||.|+.-|+
T Consensus        15 s~SYRrAi~dtveHf~   30 (245)
T TIGR01548        15 SRSYRRAIVDTVEHFT   30 (245)
T ss_pred             HHHHHHHHHHHHHHHC
T ss_conf             8889999999887632


No 6  
>KOG1279 consensus
Probab=11.44  E-value=90  Score=15.58  Aligned_cols=15  Identities=53%  Similarity=0.738  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHE
Q ss_conf             532123321212101
Q 537021.9.peg.1   22 MFYNSYRNCIINTIN   36 (39)
Q Consensus        22 mfynsyrnciintin   36 (39)
                      -+|.-|||-||||.-
T Consensus        83 e~Y~~yRnfii~tyr   97 (506)
T KOG1279          83 EVYMKYRNFIINTYR   97 (506)
T ss_pred             HHHHHHHHHHHHHHC
T ss_conf             899998876666540


No 7  
>TIGR00115 tig trigger factor; InterPro: IPR005215   The trigger factor is found in several prokaryotes, and is involved in protein export. Trigger factor is a ribosome-associated molecular chaperone and is the first chaperone to interact with nascent polypeptide. It acts as a chaperone by maintaining the newly synthesised protein in an open conformation. Trigger factor can bind at the same time as the signal recognition particle (SRP), but is excluded by the SRP receptor (FtsY). The central domain of trigger factor has peptidyl-prolyl cis/trans isomerase activity .; GO: 0015031 protein transport.
Probab=10.62  E-value=88  Score=15.61  Aligned_cols=15  Identities=40%  Similarity=0.767  Sum_probs=13.2

Q ss_pred             HHHHCCHHHHHHHHH
Q ss_conf             852032445321233
Q 537021.9.peg.1   14 RIGKLPRTMFYNSYR   28 (39)
Q Consensus        14 rigklprtmfynsyr   28 (39)
                      |.||.|+..+-+.|.
T Consensus        48 R~GKVP~~l~~qr~~   62 (475)
T TIGR00115        48 RKGKVPRNLVEQRYG   62 (475)
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             578878699985411


No 8  
>pfam10909 DUF2682 Protein of unknown function (DUF2682). This viral family of proteins has no known function.
Probab=10.31  E-value=85  Score=15.69  Aligned_cols=20  Identities=25%  Similarity=0.388  Sum_probs=15.1

Q ss_pred             CHHHHHHHHHHHHHHHHEEC
Q ss_conf             24453212332121210102
Q 537021.9.peg.1   19 PRTMFYNSYRNCIINTINVF   38 (39)
Q Consensus        19 prtmfynsyrnciintinvf   38 (39)
                      |+.++|+.-.+-|.|-||+|
T Consensus        48 ~~~~~l~~Lk~Ni~~CiNi~   67 (77)
T pfam10909        48 PQQTNLKILKTNINNCINIL   67 (77)
T ss_pred             CCHHHHHHHHHHHHHHHHHH
T ss_conf             53556799998899999999


No 9  
>COG3143 CheZ Chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]
Probab=7.51  E-value=1.7e+02  Score=14.32  Aligned_cols=21  Identities=38%  Similarity=0.531  Sum_probs=15.3

Q ss_pred             HHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             7778520324453212332121
Q 537021.9.peg.1   11 YKKRIGKLPRTMFYNSYRNCII   32 (39)
Q Consensus        11 ykkrigklprtmfynsyrncii   32 (39)
                      .-+|||+|.| |.-+|.|+--|
T Consensus        20 m~qrIG~LTR-mL~eslrelgl   40 (217)
T COG3143          20 MIQRIGSLTR-MLRESLRELGL   40 (217)
T ss_pred             HHHHHHHHHH-HHHHHHHHHCC
T ss_conf             9999989999-99999998185


No 10 
>TIGR02662 dinitro_DRAG ADP-ribosyl-[dinitrogen reductase] hydrolase; InterPro: IPR013479   This entry represents ADP-ribosyl-dinitrogen reductase hydrolase (3.2.2.24 from EC), also known as dinitrogenase reductase activating glycohydrolase (DraG). It is involved in the regulation of nitrogen fixation activity by the reversible ADP-ribosylation of the dinitrogenase reductase component of the nitrogenase enzyme complex . The ADP-ribosyltransferase protein DraT acts to inactivate dinitrogen reductase by adding an ADP-ribose group to this enzyme. DraG, in contrast, activates this enzyme by removing the attached ADP-ribose group. .
Probab=5.98  E-value=1.4e+02  Score=14.70  Aligned_cols=13  Identities=38%  Similarity=0.971  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHEE
Q ss_conf             1233212121010
Q 537021.9.peg.1   25 NSYRNCIINTINV   37 (39)
Q Consensus        25 nsyrnciintinv   37 (39)
                      .|+..|+|.|+|-
T Consensus       231 D~fesCLi~~VNq  243 (295)
T TIGR02662       231 DSFESCLIETVNQ  243 (295)
T ss_pred             CCCCCCEEEEECC
T ss_conf             9610020232047


Done!