BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.204_1 (53 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.204_1 Length = 53 Score = 107 bits (267), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 53/53 (100%), Positives = 53/53 (100%) Query: 1 MGLMYFELMNRKLSNSVVLTKTCIFSYARNNTDSKIYHYRTISLHLSKYLSNL 53 MGLMYFELMNRKLSNSVVLTKTCIFSYARNNTDSKIYHYRTISLHLSKYLSNL Sbjct: 1 MGLMYFELMNRKLSNSVVLTKTCIFSYARNNTDSKIYHYRTISLHLSKYLSNL 53 >gi|254780716|ref|YP_003065129.1| 6-phosphogluconate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 475 Score = 21.6 bits (44), Expect = 2.8, Method: Compositional matrix adjust. Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Query: 12 KLSNSVVLTKTCIFSYARN 30 KLS+S+ +T+T IF ARN Sbjct: 274 KLSSSMTITETAIF--ARN 290 >gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 20.8 bits (42), Expect = 4.2, Method: Composition-based stats. Identities = 9/38 (23%), Positives = 18/38 (47%) Query: 7 ELMNRKLSNSVVLTKTCIFSYARNNTDSKIYHYRTISL 44 E+M + ++ +T + Y RNN + + R +S Sbjct: 29 EVMVKAFLSTQEITDDVLHKYVRNNVEEPLSFVRLMSF 66 >gi|254781134|ref|YP_003065547.1| hypothetical protein CLIBASIA_05180 [Candidatus Liberibacter asiaticus str. psy62] Length = 320 Score = 19.6 bits (39), Expect = 9.3, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 15 NSVVLTKTCIFSYARNNTDSKIYHYRTIS 43 NS++ KT + + A NN S +++ T S Sbjct: 134 NSLLSDKTFVMNVAHNNRWSSFHNWFTQS 162 >gi|254781083|ref|YP_003065496.1| hypothetical protein CLIBASIA_04925 [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 19.6 bits (39), Expect = 9.3, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 13/26 (50%) Query: 24 IFSYARNNTDSKIYHYRTISLHLSKY 49 +F Y + H R++S + +KY Sbjct: 89 VFEYLKTRLSDLEAHRRSMSFYFAKY 114 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.133 0.380 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,680 Number of Sequences: 1233 Number of extensions: 842 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 53 length of database: 328,796 effective HSP length: 25 effective length of query: 28 effective length of database: 297,971 effective search space: 8343188 effective search space used: 8343188 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 31 (16.5 bits)